BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c53317_g1_i1 len=221 path=[1:0-220]

Length=221
                                                                      Score     E

emb|CAN63032.1|  hypothetical protein VITISV_024672                   72.0    2e-12   Vitis vinifera
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg           70.9    5e-12   
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg           68.9    2e-11   
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg           68.6    3e-11   
emb|CAN76892.1|  hypothetical protein VITISV_005356                   66.2    2e-10   Vitis vinifera
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg           65.1    4e-10   
gb|KHN42935.1|  Putative mitochondrial protein                        61.6    4e-10   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764  65.1    5e-10   
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg           63.9    1e-09   
ref|XP_008235758.1|  PREDICTED: uncharacterized protein LOC103334556  63.2    1e-09   
dbj|BAM28750.1|  reverse transcriptase-like protein                   61.6    1e-09   
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...  62.4    2e-09   
dbj|BAM28751.1|  reverse transcriptase-like protein                   60.8    2e-09   
ref|XP_010684764.1|  PREDICTED: uncharacterized protein LOC104899297  63.2    2e-09   
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...  62.8    2e-09   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  63.2    2e-09   
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...  62.4    3e-09   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...  62.4    4e-09   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...  62.4    4e-09   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717  62.0    6e-09   
ref|XP_004295591.1|  PREDICTED: uncharacterized mitochondrial pro...  58.5    6e-09   
ref|XP_007021872.1|  Uncharacterized protein TCM_031959               61.2    9e-09   
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg           60.5    2e-08   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...  60.5    2e-08   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           60.5    2e-08   
ref|XP_008382811.1|  PREDICTED: uncharacterized protein LOC103445579  58.9    2e-08   
gb|EPS69206.1|  hypothetical protein M569_05560                       59.7    2e-08   
ref|XP_007206755.1|  hypothetical protein PRUPE_ppa025210mg           56.6    2e-08   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455  60.1    2e-08   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg           59.7    3e-08   
gb|KHN44029.1|  Putative mitochondrial protein                        55.5    3e-08   
ref|XP_009119473.1|  PREDICTED: putative ribonuclease H protein A...  58.5    3e-08   
ref|XP_007219602.1|  hypothetical protein PRUPE_ppa023113mg           59.3    3e-08   
ref|XP_004292185.1|  PREDICTED: putative ribonuclease H protein A...  58.9    4e-08   
ref|XP_007224680.1|  hypothetical protein PRUPE_ppa025799mg           58.9    6e-08   
ref|XP_009118884.1|  PREDICTED: putative ribonuclease H protein A...  58.5    6e-08   
ref|XP_008347064.1|  PREDICTED: putative ribonuclease H protein A...  58.5    7e-08   
gb|ABN07997.1|  contains similarity to reverse trancriptase , rel...  57.8    8e-08   Medicago truncatula
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg           58.5    8e-08   
gb|AFP55574.1|  non-ltr retroelement reverse transcriptase            58.5    9e-08   
gb|AAG51754.1|AC068667_33  reverse transcriptase, putative; 10003...  58.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298  58.2    1e-07   
ref|XP_002533065.1|  conserved hypothetical protein                   57.0    1e-07   Ricinus communis
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331  58.2    1e-07   
emb|CAN71438.1|  hypothetical protein VITISV_011330                   58.2    1e-07   Vitis vinifera
ref|XP_007044602.1|  Retrotransposon protein, unclassified, putative  57.0    2e-07   
ref|XP_004306191.1|  PREDICTED: putative ribonuclease H protein A...  57.4    2e-07   
ref|XP_008386420.1|  PREDICTED: putative ribonuclease H protein A...  56.6    2e-07   
ref|XP_009138597.1|  PREDICTED: putative ribonuclease H protein A...  57.0    2e-07   
ref|XP_004289071.1|  PREDICTED: uncharacterized protein LOC101292846  55.8    2e-07   
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884  57.4    2e-07   
gb|EPS65500.1|  hypothetical protein M569_09277                       55.5    2e-07   
gb|EMS51173.1|  hypothetical protein TRIUR3_15210                     57.4    2e-07   
ref|XP_008245473.1|  PREDICTED: putative ribonuclease H protein A...  55.1    2e-07   
ref|XP_006492487.1|  PREDICTED: uncharacterized protein LOC102625512  56.2    3e-07   
ref|XP_008352230.1|  PREDICTED: putative ribonuclease H protein A...  56.6    3e-07   
gb|EPS63383.1|  hypothetical protein M569_11401                       56.6    4e-07   
ref|XP_008232502.1|  PREDICTED: putative ribonuclease H protein A...  56.2    4e-07   
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...  56.2    4e-07   
gb|EPS60183.1|  hypothetical protein M569_14621                       55.1    4e-07   
ref|XP_009129274.1|  PREDICTED: uncharacterized protein LOC103854117  55.8    4e-07   
gb|KEH41759.1|  F-box protein interaction domain protein              56.2    4e-07   
ref|XP_007207070.1|  hypothetical protein PRUPE_ppa026519mg           55.8    4e-07   
ref|XP_008381735.1|  PREDICTED: putative ribonuclease H protein A...  55.5    5e-07   
ref|XP_008370156.1|  PREDICTED: uncharacterized protein LOC103433669  54.3    5e-07   
ref|XP_008240677.1|  PREDICTED: putative ribonuclease H protein A...  55.1    5e-07   
ref|XP_010513392.1|  PREDICTED: uncharacterized protein LOC104789381  55.1    6e-07   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase            55.8    6e-07   
ref|XP_006492749.1|  PREDICTED: uncharacterized protein LOC102612946  55.1    8e-07   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  55.5    8e-07   
ref|XP_008351965.1|  PREDICTED: uncharacterized protein LOC103415096  55.1    9e-07   
ref|XP_008388177.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
ref|XP_008353155.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
gb|KHN08341.1|  Putative mitochondrial protein                        52.0    1e-06   
ref|XP_008228453.1|  PREDICTED: putative ribonuclease H protein A...  55.1    1e-06   
gb|EMT18993.1|  hypothetical protein F775_02609                       55.1    1e-06   
ref|XP_008227853.1|  PREDICTED: putative ribonuclease H protein A...  54.3    1e-06   
ref|XP_004292011.1|  PREDICTED: uncharacterized protein LOC101291306  55.1    1e-06   
ref|XP_010445839.1|  PREDICTED: uncharacterized protein LOC104728579  53.9    1e-06   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  54.7    1e-06   
ref|XP_008353829.1|  PREDICTED: putative ribonuclease H protein A...  54.3    1e-06   
ref|XP_008357942.1|  PREDICTED: transcription factor RAX1-like        54.3    1e-06   
ref|XP_007036869.1|  Ribonuclease H-like superfamily protein          54.7    1e-06   
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...  54.7    1e-06   
ref|XP_007224031.1|  hypothetical protein PRUPE_ppa015156mg           54.3    1e-06   
ref|XP_008346916.1|  PREDICTED: putative ribonuclease H protein A...  54.7    1e-06   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  54.7    1e-06   
ref|XP_010474595.1|  PREDICTED: uncharacterized protein LOC104754152  54.3    2e-06   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094  54.7    2e-06   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg           54.7    2e-06   
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725  54.7    2e-06   
ref|XP_008343304.1|  PREDICTED: putative ribonuclease H protein A...  54.3    2e-06   
ref|XP_008391021.1|  PREDICTED: putative ribonuclease H protein A...  54.3    2e-06   
ref|XP_010424572.1|  PREDICTED: uncharacterized protein LOC104709700  53.9    2e-06   
ref|XP_010462630.1|  PREDICTED: uncharacterized protein LOC104743220  54.3    2e-06   
emb|CDP09717.1|  unnamed protein product                              53.9    2e-06   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296  54.3    2e-06   
ref|XP_004295786.1|  PREDICTED: putative ribonuclease H protein A...  52.0    2e-06   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169  54.3    2e-06   
ref|XP_007207089.1|  hypothetical protein PRUPE_ppa023640mg           53.1    2e-06   
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...  54.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54617.2|  retrotransposon protein, putative, unclassified       54.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004297906.1|  PREDICTED: putative ribonuclease H protein A...  53.1    2e-06   
ref|XP_008378657.1|  PREDICTED: putative ribonuclease H protein A...  53.9    3e-06   
ref|XP_010688587.1|  PREDICTED: uncharacterized protein LOC104902499  53.5    3e-06   
ref|XP_002523275.1|  conserved hypothetical protein                   50.4    3e-06   Ricinus communis
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015  53.9    3e-06   
ref|XP_004308707.1|  PREDICTED: putative ribonuclease H protein A...  53.1    3e-06   
ref|XP_010495357.1|  PREDICTED: uncharacterized protein LOC104772442  53.1    3e-06   
ref|XP_008223235.1|  PREDICTED: uncharacterized protein LOC103323054  53.1    3e-06   
ref|XP_007203573.1|  hypothetical protein PRUPE_ppb016510mg           53.1    3e-06   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526  53.5    4e-06   
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860  53.5    4e-06   
ref|XP_010481048.1|  PREDICTED: uncharacterized protein LOC104759863  52.8    4e-06   
ref|XP_010451741.1|  PREDICTED: uncharacterized protein LOC104733916  53.1    4e-06   
ref|XP_002525788.1|  conserved hypothetical protein                   49.7    4e-06   Ricinus communis
ref|XP_007219352.1|  hypothetical protein PRUPE_ppa019455mg           50.4    4e-06   
ref|XP_008364703.1|  PREDICTED: putative ribonuclease H protein A...  53.1    5e-06   
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg           53.1    5e-06   
ref|XP_010446097.1|  PREDICTED: uncharacterized protein LOC104728868  52.8    5e-06   
gb|EEC76774.1|  hypothetical protein OsI_14862                        53.5    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_007200138.1|  hypothetical protein PRUPE_ppa017266mg           52.8    5e-06   
ref|XP_009146521.1|  PREDICTED: putative ribonuclease H protein A...  52.8    5e-06   
ref|XP_002456461.1|  hypothetical protein SORBIDRAFT_03g036763        51.2    5e-06   Sorghum bicolor [broomcorn]
gb|EPS62007.1|  hypothetical protein M569_12785                       52.0    5e-06   
ref|XP_007227248.1|  hypothetical protein PRUPE_ppa018001mg           52.8    6e-06   
ref|XP_007203072.1|  hypothetical protein PRUPE_ppa023514mg           52.8    6e-06   
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148  53.1    6e-06   
ref|XP_008342743.1|  PREDICTED: putative ribonuclease H protein A...  52.8    6e-06   
ref|XP_009114468.1|  PREDICTED: putative ribonuclease H protein A...  52.4    7e-06   
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422  52.8    7e-06   
ref|XP_007204004.1|  hypothetical protein PRUPE_ppa025711mg           52.4    7e-06   
ref|XP_010419043.1|  PREDICTED: uncharacterized protein LOC104704701  52.4    7e-06   
ref|XP_010481009.1|  PREDICTED: uncharacterized protein LOC104759828  52.4    7e-06   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           52.8    7e-06   
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362  52.8    7e-06   
ref|XP_009334552.1|  PREDICTED: uncharacterized protein LOC103927360  52.8    8e-06   
ref|XP_008359109.1|  PREDICTED: putative ribonuclease H protein A...  52.0    8e-06   
ref|XP_009123709.1|  PREDICTED: uncharacterized protein LOC103848581  52.0    9e-06   
ref|XP_010468606.1|  PREDICTED: uncharacterized protein LOC104748702  52.0    9e-06   
emb|CDY12439.1|  BnaC08g09280D                                        49.3    9e-06   
ref|XP_002526091.1|  conserved hypothetical protein                   51.6    9e-06   Ricinus communis
ref|XP_010463143.1|  PREDICTED: uncharacterized protein LOC104743796  52.4    9e-06   
gb|EPS73861.1|  hypothetical protein M569_00896                       52.4    9e-06   
ref|XP_008358476.1|  PREDICTED: uncharacterized protein LOC103422210  51.2    9e-06   
ref|XP_008338514.1|  PREDICTED: uncharacterized protein LOC103401576  52.4    9e-06   
ref|XP_010468816.1|  PREDICTED: uncharacterized protein LOC104748941  52.4    9e-06   
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...  52.4    9e-06   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768  52.4    1e-05   
gb|EEE52627.1|  hypothetical protein OsJ_34967                        52.4    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg           52.4    1e-05   
ref|XP_010686142.1|  PREDICTED: uncharacterized protein LOC104900425  51.6    1e-05   
gb|EEC68711.1|  hypothetical protein OsI_37193                        52.4    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...  52.0    1e-05   
ref|XP_009144145.1|  PREDICTED: putative ribonuclease H protein A...  51.6    1e-05   
gb|ABA96203.1|  retrotransposon protein, putative, unclassified, ...  52.4    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342  52.4    1e-05   
ref|XP_007219650.1|  hypothetical protein PRUPE_ppa023706mg           51.2    1e-05   
ref|XP_006482369.1|  PREDICTED: putative ribonuclease H protein A...  51.6    1e-05   
ref|XP_008237121.1|  PREDICTED: putative ribonuclease H protein A...  51.6    1e-05   
ref|XP_006478211.1|  PREDICTED: putative ribonuclease H protein A...  51.6    1e-05   
ref|XP_006478212.1|  PREDICTED: putative ribonuclease H protein A...  51.2    1e-05   
ref|XP_008376078.1|  PREDICTED: uncharacterized protein LOC103439314  50.1    1e-05   
ref|XP_009126322.1|  PREDICTED: putative ribonuclease H protein A...  51.6    1e-05   
ref|XP_010463261.1|  PREDICTED: uncharacterized protein LOC104743930  50.8    2e-05   
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339  51.6    2e-05   
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...  51.6    2e-05   
gb|EPS58588.1|  hypothetical protein M569_16225                       50.4    2e-05   
ref|XP_007210987.1|  hypothetical protein PRUPE_ppa021345mg           51.6    2e-05   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048  51.6    2e-05   
ref|XP_009141462.1|  PREDICTED: putative ribonuclease H protein A...  50.8    2e-05   
gb|EPS61425.1|  hypothetical protein M569_13371                       51.6    2e-05   
ref|XP_008355160.1|  PREDICTED: putative ribonuclease H protein A...  51.2    2e-05   
ref|XP_008358487.1|  PREDICTED: putative ribonuclease H protein A...  51.2    2e-05   
ref|XP_004293049.1|  PREDICTED: putative ribonuclease H protein A...  51.2    2e-05   
ref|XP_009334551.1|  PREDICTED: uncharacterized protein LOC103927359  51.6    2e-05   
ref|XP_008375526.1|  PREDICTED: putative ribonuclease H protein A...  50.4    2e-05   
ref|XP_010665852.1|  PREDICTED: uncharacterized protein LOC104883097  50.4    2e-05   
ref|XP_010518602.1|  PREDICTED: uncharacterized protein LOC104793875  50.8    2e-05   
ref|XP_008245663.1|  PREDICTED: uncharacterized protein LOC103343804  50.8    2e-05   
gb|EPS61668.1|  hypothetical protein M569_13125                       50.4    2e-05   
ref|XP_009103825.1|  PREDICTED: putative ribonuclease H protein A...  50.8    2e-05   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297  50.4    2e-05   
ref|XP_008356060.1|  PREDICTED: uncharacterized protein LOC103419743  51.2    3e-05   
ref|XP_002522452.1|  nucleic acid binding protein, putative           50.8    3e-05   Ricinus communis
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955  50.8    3e-05   
ref|XP_007204776.1|  hypothetical protein PRUPE_ppa015675mg           49.7    3e-05   
ref|XP_008227636.1|  PREDICTED: uncharacterized protein LOC103327128  50.8    3e-05   
ref|XP_008351893.1|  PREDICTED: putative ribonuclease H protein A...  50.4    3e-05   
ref|XP_007221402.1|  hypothetical protein PRUPE_ppa021602mg           50.4    3e-05   
ref|XP_007050815.1|  Uncharacterized protein TCM_004559               47.4    3e-05   
ref|XP_008391158.1|  PREDICTED: uncharacterized protein LOC103453395  50.1    3e-05   
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160  50.4    4e-05   
ref|XP_009137131.1|  PREDICTED: putative ribonuclease H protein A...  50.4    4e-05   
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...  50.4    4e-05   
ref|XP_007226724.1|  hypothetical protein PRUPE_ppa019750mg           50.1    4e-05   
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...  50.4    4e-05
gb|KEH19519.1|  hypothetical protein MTR_8g463110                     50.4    4e-05   
ref|XP_004301837.1|  PREDICTED: putative ribonuclease H protein A...  50.1    4e-05   
ref|XP_009139334.1|  PREDICTED: putative ribonuclease H protein A...  50.1    4e-05   
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282  50.4    4e-05   
ref|XP_009363712.1|  PREDICTED: uncharacterized protein LOC103953670  50.4    4e-05   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           50.4    5e-05   
gb|ABN05778.1|  Polynucleotidyl transferase, Ribonuclease H fold      49.7    5e-05   Medicago truncatula
ref|XP_002465515.1|  hypothetical protein SORBIDRAFT_01g040340        50.1    5e-05   Sorghum bicolor [broomcorn]
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.4    5e-05   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...  50.1    5e-05   
ref|XP_008356403.1|  PREDICTED: uncharacterized protein LOC103420114  50.1    5e-05   
ref|XP_009138123.1|  PREDICTED: putative ribonuclease H protein A...  50.1    5e-05   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493  50.1    5e-05   
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...  50.1    6e-05   
ref|XP_008369650.1|  PREDICTED: putative ribonuclease H protein A...  49.7    6e-05   
ref|XP_009107571.1|  PREDICTED: putative ribonuclease H protein A...  50.1    6e-05   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...  50.1    6e-05   
ref|NP_194638.1|  ribonuclease H-like protein                         49.7    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase   50.1    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832  50.1    6e-05   
ref|XP_010484878.1|  PREDICTED: uncharacterized protein LOC104763170  49.3    7e-05   
ref|XP_009140648.1|  PREDICTED: putative ribonuclease H protein A...  49.3    7e-05   
ref|XP_009340474.1|  PREDICTED: uncharacterized protein LOC103932570  49.3    7e-05   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...  49.7    7e-05   
ref|XP_008387750.1|  PREDICTED: putative ribonuclease H protein A...  49.7    7e-05   
ref|XP_004305827.1|  PREDICTED: putative ribonuclease H protein A...  49.7    8e-05   
ref|XP_009103531.1|  PREDICTED: uncharacterized protein LOC103829604  49.3    8e-05   
emb|CAE01608.2|  OSJNBa0052O21.12                                     49.3    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932  49.7    8e-05   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027  49.7    8e-05   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...  49.7    8e-05
emb|CDY02402.1|  BnaA02g23110D                                        48.5    8e-05   
ref|XP_010495331.1|  PREDICTED: uncharacterized protein LOC104772408  49.7    8e-05   
ref|NP_001066197.2|  Os12g0156200                                     49.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAQ19327.1|  bZIP-like protein                                     49.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29765.1|  hypothetical protein OsJ_13823                        49.3    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68887.1|  hypothetical protein OsI_37529                        49.7    8e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008390254.1|  PREDICTED: putative ribonuclease H protein A...  49.3    8e-05   
ref|XP_008374301.1|  PREDICTED: putative ribonuclease H protein A...  49.3    9e-05   
ref|XP_009115652.1|  PREDICTED: putative ribonuclease H protein A...  48.5    9e-05   
emb|CDY44322.1|  BnaC05g30710D                                        46.6    9e-05   
ref|XP_008377038.1|  PREDICTED: putative ribonuclease H protein A...  48.9    9e-05   
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258  49.7    9e-05   
ref|XP_009343973.1|  PREDICTED: uncharacterized protein LOC103935882  49.3    9e-05   
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                  49.7    9e-05   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695  49.7    9e-05   
ref|NP_001173474.1|  Os03g0418500                                     49.3    9e-05   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                  49.3    9e-05   
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)   49.3    9e-05   Medicago truncatula
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630  49.3    9e-05   
ref|XP_010694349.1|  PREDICTED: uncharacterized protein LOC104907159  48.5    9e-05   
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758  49.7    1e-04   
ref|XP_010496595.1|  PREDICTED: uncharacterized protein LOC104773646  48.5    1e-04   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  49.3    1e-04   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                  49.3    1e-04   
ref|XP_008352462.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
gb|EEE66057.1|  hypothetical protein OsJ_22054                        49.3    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KEH28624.1|  hypothetical protein MTR_4g008350                     48.1    1e-04   
gb|KEH22478.1|  hypothetical protein MTR_7g451250                     47.4    1e-04   
ref|XP_002452893.1|  hypothetical protein SORBIDRAFT_04g034505        48.5    1e-04   Sorghum bicolor [broomcorn]
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034  49.3    1e-04   
gb|AAF18538.1|AC006551_24  Very similar to retrotransposon revers...  49.3    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375111.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
ref|XP_009150014.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
ref|XP_008358230.1|  PREDICTED: putative ribonuclease H protein A...  48.5    1e-04   
ref|XP_008342824.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
ref|XP_008346419.1|  PREDICTED: uncharacterized protein LOC103409384  48.9    1e-04   
ref|XP_002515566.1|  conserved hypothetical protein                   47.8    1e-04   Ricinus communis
ref|XP_004305133.1|  PREDICTED: putative ribonuclease H protein A...  48.5    1e-04   
ref|XP_009150035.1|  PREDICTED: uncharacterized protein LOC103873375  48.9    1e-04   
ref|XP_009116203.1|  PREDICTED: putative ribonuclease H protein A...  48.9    1e-04   
ref|XP_009114092.1|  PREDICTED: uncharacterized protein LOC103839337  48.9    1e-04   
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500  48.9    1e-04   
ref|XP_004292479.1|  PREDICTED: putative ribonuclease H protein A...  48.5    1e-04   
ref|XP_009124085.1|  PREDICTED: putative ribonuclease H protein A...  48.5    1e-04   
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164  48.9    2e-04   
ref|XP_008348723.1|  PREDICTED: uncharacterized protein LOC103411886  48.5    2e-04   
ref|XP_010681744.1|  PREDICTED: uncharacterized protein LOC104896672  48.5    2e-04   
ref|XP_009129609.1|  PREDICTED: putative ribonuclease H protein A...  48.1    2e-04   
gb|EEC75481.1|  hypothetical protein OsI_12067                        47.8    2e-04   Oryza sativa Indica Group [Indian rice]
gb|AAK39575.1|AC025296_10  putative reverse transcriptase             48.5    2e-04   Oryza sativa [red rice]
gb|EEC79647.1|  hypothetical protein OsI_20882                        48.5    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010445303.1|  PREDICTED: uncharacterized protein LOC104727950  48.5    2e-04   
emb|CCA66044.1|  hypothetical protein                                 48.5    2e-04   
ref|XP_008361653.1|  PREDICTED: putative ribonuclease H protein A...  48.1    2e-04   
ref|XP_010105295.1|  hypothetical protein L484_002345                 48.5    2e-04   
gb|EEC80386.1|  hypothetical protein OsI_22511                        48.1    2e-04   
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852  48.5    2e-04   
ref|XP_007099712.1|  Retrotransposon, unclassified-like protein       46.2    2e-04   
ref|XP_009113510.1|  PREDICTED: putative ribonuclease H protein A...  47.8    2e-04   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160  48.1    2e-04   
ref|XP_002519559.1|  conserved hypothetical protein                   44.7    2e-04   
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579  48.1    2e-04   
ref|XP_007219414.1|  hypothetical protein PRUPE_ppa021915mg           47.8    2e-04   
ref|XP_009140188.1|  PREDICTED: uncharacterized protein LOC103864181  48.1    2e-04   
ref|XP_010678904.1|  PREDICTED: uncharacterized protein LOC104894381  47.4    2e-04   
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...  48.1    2e-04   
ref|XP_008229832.1|  PREDICTED: putative ribonuclease H protein A...  47.8    2e-04   
ref|XP_009115638.1|  PREDICTED: putative ribonuclease H protein A...  47.8    2e-04   
gb|EEC83406.1|  hypothetical protein OsI_28856                        48.1    3e-04   
ref|XP_007214372.1|  hypothetical protein PRUPE_ppb017580mg           47.4    3e-04   
ref|XP_007217441.1|  hypothetical protein PRUPE_ppb015968mg           45.1    3e-04   
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159  48.1    3e-04   
ref|XP_010445815.1|  PREDICTED: uncharacterized protein LOC104728555  48.1    3e-04   
ref|XP_010678900.1|  PREDICTED: uncharacterized protein LOC104894376  46.2    3e-04   
ref|XP_009150027.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191  48.1    3e-04   
ref|XP_008351857.1|  PREDICTED: putative ribonuclease H protein A...  47.0    3e-04   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_009140406.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_009144136.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
gb|ABN07957.1|  Polynucleotidyl transferase, Ribonuclease H fold      47.4    3e-04   
ref|XP_004301203.1|  PREDICTED: uncharacterized protein LOC101302660  47.8    3e-04   
ref|XP_009587735.1|  PREDICTED: uncharacterized protein LOC104085422  47.0    3e-04   
ref|XP_009120142.1|  PREDICTED: putative ribonuclease H protein A...  47.8    3e-04   
ref|XP_010669804.1|  PREDICTED: uncharacterized protein LOC104886944  47.8    3e-04   
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase         47.8    3e-04   
ref|XP_004305033.1|  PREDICTED: uncharacterized protein LOC101307612  47.8    3e-04   
ref|XP_003629388.1|  Cytochrome P450                                  47.4    3e-04   
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249  47.8    4e-04   
ref|XP_009137704.1|  PREDICTED: putative ribonuclease H protein A...  47.4    4e-04   
ref|XP_002450843.1|  hypothetical protein SORBIDRAFT_05g019526        47.8    4e-04   
ref|XP_002442481.1|  hypothetical protein SORBIDRAFT_08g020692        45.8    4e-04   
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152  47.8    4e-04   
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622  47.8    4e-04   
ref|XP_009150012.1|  PREDICTED: uncharacterized protein LOC103873347  47.0    4e-04   
ref|XP_008237106.1|  PREDICTED: uncharacterized protein LOC103335848  47.4    5e-04   
ref|XP_010468802.1|  PREDICTED: uncharacterized protein LOC104748921  47.0    5e-04   
ref|XP_006478726.1|  PREDICTED: putative ribonuclease H protein A...  47.0    5e-04   
ref|NP_085499.1|  hypothetical protein ArthMp029                      44.7    5e-04   
emb|CCA66040.1|  hypothetical protein                                 47.4    5e-04   
ref|XP_010472440.1|  PREDICTED: uncharacterized protein LOC104752070  47.4    5e-04   
ref|XP_008378144.1|  PREDICTED: putative ribonuclease H protein A...  47.0    5e-04   
ref|XP_002515359.1|  conserved hypothetical protein                   46.2    6e-04   
ref|XP_009102170.1|  PREDICTED: putative ribonuclease H protein A...  46.2    6e-04   
ref|XP_010451826.1|  PREDICTED: uncharacterized protein LOC104734010  46.6    6e-04   
ref|XP_009139523.1|  PREDICTED: putative ribonuclease H protein A...  47.0    6e-04   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...  47.0    6e-04   
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312  47.0    6e-04   
ref|XP_009119741.1|  PREDICTED: putative ribonuclease H protein A...  46.6    6e-04   
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...  47.0    6e-04   
ref|XP_004295829.1|  PREDICTED: uncharacterized protein LOC101302635  47.0    7e-04   
gb|EEC74955.1|  hypothetical protein OsI_10942                        47.0    7e-04   
ref|XP_010431111.1|  PREDICTED: uncharacterized protein LOC104715400  47.0    7e-04   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574  47.0    7e-04   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase   47.0    7e-04   
ref|XP_009109964.1|  PREDICTED: putative ribonuclease H protein A...  46.6    8e-04   
gb|EEC72938.1|  hypothetical protein OsI_06800                        46.6    8e-04   
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977  46.6    8e-04   
ref|XP_009139680.1|  PREDICTED: putative ribonuclease H protein A...  46.2    8e-04   
ref|NP_001175214.1|  Os07g0501200                                     46.6    8e-04   
ref|XP_010418622.1|  PREDICTED: uncharacterized protein LOC104704195  46.6    8e-04   
ref|XP_010251367.1|  PREDICTED: uncharacterized protein LOC104593313  46.6    8e-04   
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase   46.6    8e-04   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187  46.6    8e-04   
ref|XP_008364539.1|  PREDICTED: putative ribonuclease H protein A...  46.6    8e-04   
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949  46.6    9e-04   
ref|XP_008222409.1|  PREDICTED: uncharacterized protein LOC103322282  46.2    9e-04   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...  46.6    9e-04   
gb|EMT20940.1|  ABC transporter C family member 10                    46.6    9e-04   
ref|XP_010502015.1|  PREDICTED: uncharacterized protein LOC104779362  45.8    9e-04   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified       46.6    9e-04   
gb|AAM01179.2|AC113336_31  Putative retroelement                      46.6    9e-04   
ref|XP_010673997.1|  PREDICTED: uncharacterized protein LOC104890275  46.6    0.001   
ref|XP_010684763.1|  PREDICTED: uncharacterized protein LOC104899296  46.6    0.001   
ref|XP_009107036.1|  PREDICTED: putative ribonuclease H protein A...  45.4    0.001   
ref|XP_010682911.1|  PREDICTED: uncharacterized protein LOC104897672  46.2    0.001   
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...  46.2    0.001   
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...  46.2    0.001   
ref|XP_008225175.1|  PREDICTED: putative ribonuclease H protein A...  46.2    0.001   
ref|XP_010456985.1|  PREDICTED: uncharacterized protein LOC104738517  46.6    0.001   



>emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera]
Length=1413

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             NSSFL A +G+NPS++W S++A QD++++   W I +G + ++W D+WLPD +N  I++ 
Sbjct  1090  NSSFLNAELGSNPSYMWRSILAAQDLLKRGYYWSIASGTKVQVWGDSWLPDNSNRLIITP  1149

Query  181   PFPFMENSKVEDL  219
             P    +  KV++L
Sbjct  1150  PIAGFDEIKVDEL  1162



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             N S LEA +G +PS+IW SL   + +I K SRWRIGNG   RIW D WLP+  + ++ S 
Sbjct  1255  NCSILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSP  1314

Query  181   PFPFMENSKVEDL  219
                  E +KV  L
Sbjct  1315  QVEGFEEAKVNSL  1327



>ref|XP_007210228.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
 gb|EMJ11427.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
Length=787

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N S LEA +G +PS+IW SL   + +I K SRWRIGNG   RIW D WLP+  + ++ S 
Sbjct  487  NCSILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSP  546

Query  181  PFPFMENSKVEDL  219
                 + +KV  L
Sbjct  547  QAEGFDEAKVNSL  559



>ref|XP_007224193.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
 gb|EMJ25392.1| hypothetical protein PRUPE_ppa017155mg, partial [Prunus persica]
Length=916

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N S LEA +G +PS+IW SL   + +I K SRWRIGNG   RIW D WLP+  + ++ S 
Sbjct  705  NCSILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSP  764

Query  181  PFPFMENSKVEDL  219
                 + +KV  L
Sbjct  765  QTEGFDEAKVNSL  777



>emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera]
Length=1793

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             NSSFL A +G+NPS++W S++A QD+++    W I +G + ++W D+WLP+ +N  I++ 
Sbjct  1447  NSSFLNAELGSNPSYMWRSILAAQDLLKMGCYWSIASGTKVQVWGDSWLPNSSNRLIITP  1506

Query  181   PFPFMENSKVEDL  219
                  +  KV++L
Sbjct  1507  HVADFDGIKVDEL  1519



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            FLEA VG NPSFIW SL   ++++ K  RWR+G+G   +++ D WLP  +  KIMS P
Sbjct  848  FLEAEVGTNPSFIWGSLQWGKELLNKGVRWRVGSGVSIQVYTDKWLPAPSCFKIMSPP  905



>gb|KHN42935.1| Putative mitochondrial protein [Glycine soja]
Length=130

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            LEA +G+NPS++  S+MA +DI    + WRIGNG Q R+WRD W+ D
Sbjct  16   LEAQIGSNPSYVGRSIMAVKDITLHGTIWRIGNGRQVRVWRDKWIVD  62



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            N SFLEA  G NPS+ W SL   +D++ + ++WR+GNG Q R+W D WLP
Sbjct  858  NCSFLEAPCGFNPSYSWRSLWGVKDLLMEGTKWRVGNGTQIRVWEDAWLP  907



>ref|XP_007207773.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
 gb|EMJ08972.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
Length=1060

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP-F  186
            FLEA VG NPSFIW SL   ++++ K  RWR+G+G   +++ D WLP  +  KIMS P  
Sbjct  598  FLEAEVGTNPSFIWRSLQWGKELLNKGLRWRVGSGVSIQVYTDKWLPAPSCFKIMSPPQL  657

Query  187  PFMENSKVEDL  219
            P   +++V DL
Sbjct  658  PL--STRVCDL  666



>ref|XP_008235758.1| PREDICTED: uncharacterized protein LOC103334556 [Prunus mume]
Length=489

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N S LEA +G + S+IW SL   + II + +RWRIGNG   RIW D WLP   + +I S 
Sbjct  30   NCSILEAQLGHSSSYIWQSLCKARVIIEQGTRWRIGNGNSVRIWGDRWLPSSESFQISSP  89

Query  181  PFPFMENSKVEDL  219
                 E +KV  L
Sbjct  90   QAQGFEEAKVSFL  102



>dbj|BAM28750.1| reverse transcriptase-like protein, partial [Camellia sinensis 
var. sinensis]
Length=255

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            +SFL+A VG+NPSF W S++ ++ ++    RWR+GNGA   +  D W+P  ++ K++  P
Sbjct  142  TSFLDALVGSNPSFTWRSIVGSRSLLNAGLRWRVGNGASISVKYDKWVPRPHSFKVILPP  201

Query  184  FPFMENSKVEDL  219
                ++++V DL
Sbjct  202  STLSDDARVSDL  213



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            N++F +A++G NPS+ W S+MA  D++ K SR RIGNG  T I  D WLPD++N  + S
Sbjct  28   NTNFSQASIGKNPSYSWRSIMAAHDLVLKGSRIRIGNGTCTLIKNDPWLPDLSNGLVSS  86



>dbj|BAM28751.1| reverse transcriptase-like protein, partial [Camellia sinensis 
var. sinensis]
Length=255

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            +SFL+A VG+NPSF W S++ ++ ++    RWR+GNGA   +  D W+P  ++ K++  P
Sbjct  142  TSFLDALVGSNPSFTWRSIVGSRRLLNAGLRWRVGNGASISVKYDKWVPRPHSFKVILPP  201

Query  184  FPFMENSKVEDL  219
                ++++V DL
Sbjct  202  STLSDDARVSDL  213



>ref|XP_010684764.1| PREDICTED: uncharacterized protein LOC104899297 [Beta vulgaris 
subsp. vulgaris]
Length=939

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            NS+FLEA+ G NPS+ W S+  +++++ +  +WRIGNG Q R+W D WLP
Sbjct  773  NSTFLEASCGFNPSYSWRSIWGSKELLLEGVKWRIGNGTQVRVWDDAWLP  822



>ref|XP_008222895.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=605

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            FLEA VG NPSFIW SL   ++++ K  RWR+GNG   +++ + WLP  +  KIMS P
Sbjct  167  FLEAGVGTNPSFIWRSLQWGKELLNKGLRWRVGNGESIQVYTNKWLPVPSFFKIMSAP  224



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SFL+A  G+NPSFIW S++  + +I+K +RWRIGNG+   +++DNW+P  +  K +S 
Sbjct  869  SCSFLDAKPGSNPSFIWRSILWGRQVIQKGARWRIGNGSNILVYKDNWIPRPDTFKPISP  928

Query  181  P  183
            P
Sbjct  929  P  929



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +S F+EA +G+NPS+IW S++  +++IRK  RWRIG+G   ++++  WLP     K +S 
Sbjct  303  HSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPISP  362

Query  181  P  183
            P
Sbjct  363  P  363



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +S F+EA +G+NPS+IW S++  +++IRK  RWRIG+G   ++++  WLP     K +S 
Sbjct  303  HSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPISP  362

Query  181  P  183
            P
Sbjct  363  P  363



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +S F+EA +G+NPS+IW S++  +++IRK  RWRIG+G   ++++  WLP     K +S 
Sbjct  506  HSCFMEAQIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWLPRPETFKPISP  565

Query  181  P  183
            P
Sbjct  566  P  566



>ref|XP_010667704.1| PREDICTED: uncharacterized protein LOC104884717 [Beta vulgaris 
subsp. vulgaris]
Length=1578

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
             NS+F+++N+GA PS+ W  +   + ++R+  RWR+G+G   RIW+D W+P   + KI+S
Sbjct  1147  NSNFMDSNLGATPSYTWRGIWEAKWVLRRGVRWRVGDGESIRIWKDAWIPGSQSRKIIS  1205



>ref|XP_004295591.1| PREDICTED: uncharacterized mitochondrial protein AtMg00310-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
            NSSFLEA +G NPS IW ++M  + ++ K  RWR+ NGA  R+++D W+P I + +I
Sbjct  87   NSSFLEAVIGRNPSSIWRAVMWGKQLLTKGLRWRVSNGADIRVFQDPWVPGIPDFRI  143



>ref|XP_007021872.1| Uncharacterized protein TCM_031959 [Theobroma cacao]
 gb|EOY13397.1| Uncharacterized protein TCM_031959 [Theobroma cacao]
Length=1217

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             + FL A +G+NPS++W S+  +Q +IRK + WR+G+G    +  D W+P   +P+++SF
Sbjct  767  TTDFLNAPIGSNPSYLWRSIRESQQLIRKGAIWRVGDGQSISVLNDVWIP-YESPRLLSF  825

Query  181  PFPFM-ENSKVEDL  219
            P   + E  KV +L
Sbjct  826  PNQLIDEEMKVSEL  839



>ref|XP_007217321.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
 gb|EMJ18520.1| hypothetical protein PRUPE_ppa019733mg [Prunus persica]
Length=1275

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             ++F EA +G+ PS +W S+   + ++   SR++IG+G   RIW D W+P      +++ 
Sbjct  830  QTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITS  889

Query  181  PFPFMENSKVEDL  219
            P   MEN+KV +L
Sbjct  890  PLDGMENTKVSEL  902



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            NS+F  A VG+NPSFIW S++    +I+K  RWRIG+G +  +++D W+P
Sbjct  299  NSTFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIP  348



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
              ++F EA +G+ PS +W S+   + ++   SR++IG+G   RIW D W+P      +++ 
Sbjct  1310  QTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITS  1369

Query  181   PFPFMENSKVEDL  219
             P   MEN+KV +L
Sbjct  1370  PLDGMENTKVSEL  1382



>ref|XP_008382811.1| PREDICTED: uncharacterized protein LOC103445579 [Malus domestica]
Length=333

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +  FL A V +N SF W S+   + +I++ +RWR+G+G Q  IW D+WLP  N  K++S 
Sbjct  88   DMEFLIAPVKSNSSFCWRSITTARVLIQRGARWRVGDGLQIEIWGDSWLPRXNYAKVLS-  146

Query  181  PFP  189
            P P
Sbjct  147  PVP  149



>gb|EPS69206.1| hypothetical protein M569_05560, partial [Genlisea aurea]
Length=474

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +S+FL+A +G +PS+ W S+ + +D++    RWRIG+G+   +W+D W+PD    K  S 
Sbjct  8    HSTFLQAPLGRSPSYAWRSIHSCRDVLTGGLRWRIGDGSSIDVWKDPWIPDTFAFKPSS-  66

Query  181  PFPF-MENSKVEDL  219
            P P  M N +V++L
Sbjct  67   PAPLGMANMRVKEL  80



>ref|XP_007206755.1| hypothetical protein PRUPE_ppa025210mg, partial [Prunus persica]
 gb|EMJ07954.1| hypothetical protein PRUPE_ppa025210mg, partial [Prunus persica]
Length=107

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            +F  A  G  PS++W SL+A +++I + SRW++GNG   RIW D W+P
Sbjct  42   TFFIAQPGMRPSYMWKSLLAAKEVIIRSSRWQVGNGHMVRIWGDRWVP  89



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
             NS+F  A VG+NPSFIW S++    +I+K  RWRIG+G +  +++D W+P
Sbjct  986   NSTFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWIP  1035



>ref|XP_007225095.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
 gb|EMJ26294.1| hypothetical protein PRUPE_ppa016563mg, partial [Prunus persica]
Length=925

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +++F EA +G+ PS +W S+   + ++   SR++IG+G   RIW D W+P      +++ 
Sbjct  461  HTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPAAFVVITS  520

Query  181  PFPFMENSKVEDL  219
            P   MEN+KV +L
Sbjct  521  PLDGMENTKVSEL  533



>gb|KHN44029.1| Putative mitochondrial protein, partial [Glycine soja]
Length=68

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            N  FL+  +G NPS++W S+ A+  ++R+  +W+IGNG+   IW D WL
Sbjct  20   NVDFLDVKLGNNPSYVWGSIFASPVVVRQGMKWKIGNGSSINIWHDLWL  68



>ref|XP_009119473.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=339

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            ++S L A VG  PSFIW SLM  +++++   R +IGNG +T IWRD WLP
Sbjct  88   DTSILNARVGNKPSFIWRSLMEGKELLKSGLRVQIGNGEETLIWRDAWLP  137



>ref|XP_007219602.1| hypothetical protein PRUPE_ppa023113mg, partial [Prunus persica]
 gb|EMJ20801.1| hypothetical protein PRUPE_ppa023113mg, partial [Prunus persica]
Length=851

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             SFL+A  G   S+ WSSL+  +DII K +RW+IGNG    +W+D WL    + KI   P
Sbjct  452  CSFLDAKKGGRASWAWSSLLVGRDIIEKGARWQIGNGHLVSVWKDRWLMGYGSEKISPLP  511



>ref|XP_004292185.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            +SSFLEA +G  PSF W S+M  + +++   +W+IG+G    IW D WLP ++ P+ +  
Sbjct  119  HSSFLEAELGEAPSFSWRSIMQGRKVLKADLQWKIGDGKNGVIWNDKWLP-LSTPEFIQK  177

Query  181  P  183
            P
Sbjct  178  P  178



>ref|XP_007224680.1| hypothetical protein PRUPE_ppa025799mg [Prunus persica]
 gb|EMJ25879.1| hypothetical protein PRUPE_ppa025799mg [Prunus persica]
Length=867

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            +FLE+ +G  PS IWSSL+  +D+++   RWR+ NG    +++D W+P   N KI+S P
Sbjct  548  NFLESGLGYQPSLIWSSLIWGKDLLKAGLRWRVENGEDIHVYQDRWVPLPMNFKIISAP  606



>ref|XP_009118884.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=570

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            + +FLEA +G  PSF W SL+  +D+++K  R R+GNG   R+W D WL D
Sbjct  88   DGNFLEAAIGERPSFAWRSLLFGRDLLKKGLRLRVGNGLTIRVWTDKWLED  138



>ref|XP_008347064.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=821

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +SSFL+A +G   S+ W+SL+  +DI++K + W+I NG  TR+W D WLP +
Sbjct  391  HSSFLDAKLGGRASWAWASLLVGRDILKKGAHWQILNGKDTRLWVDRWLPSL  442



>gb|ABN07997.1| contains similarity to reverse trancriptase , related [Medicago 
truncatula]
Length=407

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            ++  L+A VG  PS+ W S+     +I K S WRIG+G    IW DNW+P     K+M+ 
Sbjct  172  HTDILQAKVGNYPSYAWKSIQNAIWVISKGSCWRIGDGGSINIWEDNWVPTYKGLKVMTT  231

Query  181  PFPFMENSKVEDL  219
              P    ++V+DL
Sbjct  232  KGPNHFVNRVKDL  244



>ref|XP_007203701.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
 gb|EMJ04900.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
Length=1367

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDN  141
             N S LEA +G +PS+IW SL   + +I K S+WRIGNG   RIW D+
Sbjct  1141  NCSILEAQIGHSPSYIWQSLCKARVLIEKESQWRIGNGHSVRIWGDS  1187



>gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1656

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  4     SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             SSFLEA  G NPS+IW+SL+  ++ I K + W IGNG    I  DNW+P I  P  +S P
Sbjct  1501  SSFLEAPKGPNPSWIWNSLLIGRNFIHKEALWNIGNGFSVNIVGDNWIPSI-PPSTVSLP  1559

Query  184   FPFMENSKVEDL  219
                 +NS+V +L
Sbjct  1560  LN-EDNSRVCEL  1570



>gb|AAG51754.1|AC068667_33 reverse transcriptase, putative; 100033-105622 [Arabidopsis thaliana]
Length=1557

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI-MS  177
             +  FLEA++GA PS+ W S++  +D++ K  R  IGNG    +W DNW+ D N P+I + 
Sbjct  1166  DEDFLEADLGARPSYAWRSVLHGRDLLTKGLRKEIGNGNSISVWMDNWIYD-NGPRIPLQ  1224

Query  178   FPFPFMENSKVEDL  219
               F    N +V+DL
Sbjct  1225  KHFSVSLNLRVKDL  1238



>ref|XP_006494016.1| PREDICTED: uncharacterized protein LOC102608298 [Citrus sinensis]
Length=1570

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            +  F+ A +G+NPSFIW S++  + +I K SRWRIGNG    + ++NWLP
Sbjct  806  HKDFMNARLGSNPSFIWRSILWGRQVISKGSRWRIGNGQSIMLHKENWLP  855



>ref|XP_002533065.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29304.1| conserved hypothetical protein [Ricinus communis]
Length=339

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
              +FL + +GANPSFIW+SL    D+IR+ +RW+IG G    I    WL D  N  I +
Sbjct  28   TGTFLSSKLGANPSFIWASLQKISDVIRRGTRWKIGRGETITIGHHAWLLDDTNGFIQT  86



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N  FL+A  G +PSF+W S+   + ++ +  +WR+GNGA  R+W   WLP  ++ K+   
Sbjct  744  NVPFLDARRGYDPSFVWRSIWGAKSLLMEGLKWRVGNGASIRVWDMAWLPGDSSSKV---  800

Query  181  PFPFMENSKVEDL  219
            P P +E+   EDL
Sbjct  801  PTPNVESR--EDL  811



>emb|CAN71438.1| hypothetical protein VITISV_011330 [Vitis vinifera]
Length=1484

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFP  189
            FL A +G NPSF W  + +++ I+ K SRWRIG+G    +W + WL D  N K+ +    
Sbjct  416  FLSARLGHNPSFTWKGIWSSRAILLKGSRWRIGDGCSIDVWNNPWLRDAENFKVETPIIH  475

Query  190  FMENSKVEDL  219
             + + KV DL
Sbjct  476  DLAHLKVHDL  485



>ref|XP_007044602.1| Retrotransposon protein, unclassified, putative [Theobroma cacao]
 gb|EOY00434.1| Retrotransposon protein, unclassified, putative [Theobroma cacao]
Length=421

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            N +F EA +G+NPS++W SL  +Q +I+    WR+GNG    + RDNW+P
Sbjct  330  NVNFCEALIGSNPSYLWRSLRESQGLIKNGLIWRVGNGTNISVKRDNWIP  379



>ref|XP_004306191.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=755

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N+SF +A+ G  PS+IWSSL+  ++++ + + WRIGNG  T +W D WLP 
Sbjct  363  NTSFRKAHKGGTPSWIWSSLLEGRNLLFQGTSWRIGNGCLTDMWNDKWLPQ  413



>ref|XP_008386420.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=407

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
            N  FL+A  G+ PS+ W SL+  + ++   + W+IGNG   ++W DNWLPD++  K
Sbjct  71   NCDFLQATRGSCPSWAWVSLLEGRKMLENGALWQIGNGETVKVWNDNWLPDMDRRK  126



>ref|XP_009138597.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=622

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            NS FLEA VGA PSF W S++  +++++K  +  IGNG  TR+W D W+ D
Sbjct  140  NSHFLEAPVGARPSFAWRSIIHGRELLQKGLKKSIGNGGDTRVWLDKWIDD  190



>ref|XP_004289071.1| PREDICTED: uncharacterized protein LOC101292846 [Fragaria vesca 
subsp. vesca]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS F++A + A  SF W S+MA + ++ K  R+++GNG    +W D W+P     K  S 
Sbjct  19   NSDFMKAELKAGASFTWRSIMAGRRVLEKGMRFQVGNGVDISVWHDRWIPVPYGFKPYSE  78

Query  181  PFPFMENSKVEDL  219
            P   +++ KV DL
Sbjct  79   PMEGLDDLKVVDL  91



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            +S+FL A +G+NPS+IW S++  + II   SRWRIGNG    I + NW+P
Sbjct  662  SSNFLNAKIGSNPSYIWRSILWGRQIICGGSRWRIGNGQDVHIHKANWIP  711



>gb|EPS65500.1| hypothetical protein M569_09277, partial [Genlisea aurea]
Length=253

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD--INNPKI  171
            N SF EA +G  PSF W S+ + + +++  SRWRIG+G    IW D WL    I+ P+I
Sbjct  129  NCSFEEAQLGRRPSFTWRSIFSVKTLVQNGSRWRIGDGRSINIWNDRWLSAYPISRPRI  187



>gb|EMS51173.1| hypothetical protein TRIUR3_15210 [Triticum urartu]
Length=1042

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            N  FLEA +G++PS IW +++  +D++R+    RIGNG  T IWRDNWL
Sbjct  35   NIDFLEAELGSHPSQIWRAVLDGRDVLRQGIVRRIGNGHTTDIWRDNWL  83



>ref|XP_008245473.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=246

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
              SFLEA  G   S+ W+SL+  + II + +RW+I NG Q ++W D W+P +++ K+
Sbjct  18   KCSFLEAKKGGRASWAWASLLEGRKIILQGARWQILNGRQAKLWTDCWIPSLHDGKL  74



>ref|XP_006492487.1| PREDICTED: uncharacterized protein LOC102625512 [Citrus sinensis]
Length=500

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            N  F++A +G+ PSF+W S++  + I+   +RWRIG+G + +I +DNW+P
Sbjct  88   NKDFMKAKLGSTPSFVWRSILWGRQILSSGARWRIGDGQKIQIHKDNWIP  137



>ref|XP_008352230.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=775

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+A ++I+R  + W+I +G  TR+W D W+P I
Sbjct  224  NCSFLDAKKGGRASWVWASLLAXREILRAGAHWQIMDGNDTRVWVDRWIPPI  275



>gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea]
Length=1469

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIM  174
             N+SFLEA +G NPSF W SL+  ++++    RWR G+G    +W   WLP   + K M
Sbjct  1267  NTSFLEARLGRNPSFTWRSLLTAKNLLLSGLRWRPGDGVHINVWNSPWLPRAGSFKPM  1324



>ref|XP_008232502.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=586

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SFL+A  G   S+ WSSL+  ++II   +RW+IGNG    +W+D WL   ++ K+  F
Sbjct  185  DCSFLDARKGGRASWAWSSLLIGREIIDSGARWQIGNGRSVDVWKDRWLTGKDSGKLSPF  244

Query  181  P  183
            P
Sbjct  245  P  245



>ref|XP_008385035.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=992

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+A ++I+R  + W+I +G  TR+W D W+P I
Sbjct  508  NCSFLDAKKGGRASWVWASLLAXREILRAGAHWQIMDGNDTRVWVDRWIPPI  559



>gb|EPS60183.1| hypothetical protein M569_14621, partial [Genlisea aurea]
Length=307

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            NSSFL A +   PS IW S+ AT+  + +  RWR+G+G Q  IW D WLP
Sbjct  94   NSSFLSAELSRAPSQIWRSIHATRQTLCQGLRWRVGSGTQIHIWEDPWLP  143



>ref|XP_009129274.1| PREDICTED: uncharacterized protein LOC103854117 [Brassica rapa]
Length=436

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +  FL  ++GA PS+ W SL+  ++++ K  R ++GNG QTR+W D W+ D+
Sbjct  72   DGEFLYVSLGARPSYAWCSLLYGRELLMKGLRHKVGNGRQTRVWLDKWIADL  123



>gb|KEH41759.1| F-box protein interaction domain protein [Medicago truncatula]
Length=651

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = +1

Query  25   VGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFPFMENS  204
            +G  PS+ W S+   +D+I   SRW I NG   RIW+D+WLP+    K+ S    F E +
Sbjct  356  IGNQPSYAWRSMFNIKDVIDLGSRWSISNGQNVRIWKDDWLPNQTGFKVCSPMVDFEEAT  415

Query  205  KVEDL  219
             + +L
Sbjct  416  CISEL  420



>ref|XP_007207070.1| hypothetical protein PRUPE_ppa026519mg, partial [Prunus persica]
 gb|EMJ08269.1| hypothetical protein PRUPE_ppa026519mg, partial [Prunus persica]
Length=431

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
              SFLEA  G   S+ W+SL+  + II + +RW+I NG Q ++W D W+P +++ K+
Sbjct  200  ECSFLEAKKGGRASWAWASLLEGRKIILQGARWQILNGRQAKLWTDCWIPSLHDGKL  256



>ref|XP_008381735.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=389

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF-PFP  189
            + A+ G+  S+ WSSL+  Q II + +RW+IGNGA   IW+D W+ D+++  +  F P P
Sbjct  53   IYASKGSRASWAWSSLLEGQAIIVQGARWQIGNGATVNIWKDKWIMDVDDGLLHPFSPIP  112

Query  190  FMENSKVEDL  219
                  V+D+
Sbjct  113  ESAPCLVKDI  122



>ref|XP_008370156.1| PREDICTED: uncharacterized protein LOC103433669 [Malus domestica]
Length=255

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            SSF +A +G+  S+ W+SL+  +DI++  + W+I NG  TR+W D WLP +    ++  P
Sbjct  14   SSFFDAKLGSRASWAWASLLVGRDILKAGAYWQILNGRDTRLWIDRWLPSL----LLGGP  69

Query  184  FP-----FMENSKVEDL  219
             P        N+KV  L
Sbjct  70   VPRGNNHITMNTKVSSL  86



>ref|XP_008240677.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=380

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFLEA  G+  S+ W+S +  + II + +RW+I NG Q +IW D W+P +++ K+     
Sbjct  189  SFLEAKKGSRASWAWASFLEGRKIILQGARWQILNGRQAKIWTDRWIPSLHDGKL----H  244

Query  187  PFME-----NSKVEDL  219
            P ++     N++VE L
Sbjct  245  PHLQASVDPNTRVETL  260



>ref|XP_010513392.1| PREDICTED: uncharacterized protein LOC104789381 [Camelina sativa]
Length=357

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N   L AN   NPSF W S+ +T+ ++ + +RW +G+G    +WRD WLPDI
Sbjct  28   NKHPLMANKPNNPSFAWQSIYSTKGLVEQGARWAVGSGCSISVWRDPWLPDI  79



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +1

Query  10    FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
             F+EA +G++PS++W S +  ++++RK  RWRIG+G + R++ D W+P +
Sbjct  1182  FMEAELGSSPSYLWRSFLWGRELLRKGVRWRIGDGKEVRVFIDPWVPGL  1230



>ref|XP_006492749.1| PREDICTED: uncharacterized protein LOC102612946 [Citrus sinensis]
Length=589

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (61%), Gaps = 7/76 (9%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK---I  171
             + FL+A +G+NPS+IW S++  + +++K  RWRIGNG + +I   NW+P  +  K   +
Sbjct  124  QTDFLKAKIGSNPSYIWRSIVWGRHVLQKWIRWRIGNGEKIQIHSSNWIPKPSTFKPILV  183

Query  172  MSFPFPFMENSKVEDL  219
             S P      SKV +L
Sbjct  184  QSLP----TESKVSEL  195



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +1

Query  19   ANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFPFME  198
            A+ G+NPSFIW SL A + +++K    RIGNG  TR++ D WLP   +  I S P     
Sbjct  235  ASEGSNPSFIWRSLCAAKYLLQKGCVKRIGNGLDTRVYHDPWLPTGQSMFIQSIPDDENM  294

Query  199  NSKVEDL  219
            N  V DL
Sbjct  295  NLCVADL  301



>ref|XP_008351965.1| PREDICTED: uncharacterized protein LOC103415096 [Malus domestica]
Length=787

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+A ++I+ + + W+I +G  TR+W D WLP I
Sbjct  356  NCSFLDAKKGGRASWVWASLLAGREILXEGAHWQIMDGNDTRVWVDRWLPPI  407



>ref|XP_008388177.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=586

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SF +A  G   S+ WSSL+  ++IIR  + W+I NG   R+W D WLP I
Sbjct  152  NCSFFDAKRGGRASWAWSSLLVGREIIRGGAHWQIMNGKDVRVWVDKWLPSI  203



>ref|XP_008353155.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=637

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SF +A  G   S+ WSSL+  ++IIR  + W+I NG   R+W D WLP I
Sbjct  152  NCSFFDAKRGGRASWAWSSLLVGREIIRGGAHWQIMNGKDVRVWVDKWLPSI  203



>gb|KHN08341.1| Putative mitochondrial protein [Glycine soja]
Length=119

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             +FL+ ++G NPS+ W S+  ++ ++R+  RW+IG+ +   +W++ W+      + ++  
Sbjct  41   GAFLDTDIGPNPSYSWLSICNSRIVLREGLRWKIGDKSLINVWKETWIKGATGDRFLTQF  100

Query  184  FPFMENSKVEDL  219
             P  E+  V+DL
Sbjct  101  VPGSEDLAVKDL  112



>ref|XP_008228453.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=658

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            + SFL+  V  N S++W S+ A + I+ + SRW++G+GA+  IW++ WLP
Sbjct  262  DKSFLDVPVSDNSSYVWKSICAARKILLQGSRWQVGSGAEIDIWKEPWLP  311



>gb|EMT18993.1| hypothetical protein F775_02609 [Aegilops tauschii]
Length=1349

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
             N + LEA +G+ PS IW +++  +D++++    RIGNG  T IW DNW+P    P+
Sbjct  1050  NRTILEAELGSRPSQIWRAMLEGRDMLKQGLIQRIGNGQDTMIWEDNWIPKETVPR  1105



>ref|XP_008227853.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=384

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
            N++FLEA  G   S+ W+SL+  +D+I+  + W++ NG   +IW D W+P   N ++
Sbjct  54   NTNFLEAKKGGRASWAWASLLQGRDLIKNEALWQVSNGGSVKIWEDRWIPSTLNMRL  110



>ref|XP_004292011.1| PREDICTED: uncharacterized protein LOC101291306 [Fragaria vesca 
subsp. vesca]
Length=948

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD------INN  162
            N+ F+EA  G  PS+ WSS++A +D+I K   W++ NG   RIW+D W+P       I N
Sbjct  545  NTGFMEAGKGHRPSWSWSSMIAARDLIAKGCCWQVMNGKSIRIWQDIWVPPPHVGALIPN  604

Query  163  PKIMSFP  183
            P   + P
Sbjct  605  PSQSTLP  611



>ref|XP_010445839.1| PREDICTED: uncharacterized protein LOC104728579 [Camelina sativa]
Length=323

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            L+A    +PSF W S+ +T+ ++   SRW IG+G +  +WRD W+PDI 
Sbjct  16   LQAKKPYSPSFAWRSIFSTKGLVEHGSRWAIGSGCEVSVWRDPWIPDIQ  64



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            SSF +  VG+NP++ W S+MA   +I + SR +IGNG QT I    WLPD+++  + + P
Sbjct  55   SSFGKTTVGSNPNYAWWSIMAAHTVIIQGSRIQIGNGHQTTIGGSLWLPDLDHGYVTT-P  113

Query  184  FP  189
             P
Sbjct  114  LP  115



>ref|XP_008353829.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=452

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+A ++I ++ + W+I +G  TR+W D WLP I
Sbjct  75   NCSFLDAKKGGRASWVWASLLAGREIPKEGAHWQIMDGNDTRVWVDRWLPPI  126



>ref|XP_008357942.1| PREDICTED: transcription factor RAX1-like [Malus domestica]
Length=462

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            S+F+EA +G+ PS+ W SL+  ++++   SRW IGNG   R++ D W+P+    ++ S P
Sbjct  344  SNFMEAQMGSYPSYTWPSLLWGRELLHHESRWCIGNGRSVRVYDDAWVPNERLFRVHSQP  403



>ref|XP_007036869.1| Ribonuclease H-like superfamily protein [Theobroma cacao]
 gb|EOY21370.1| Ribonuclease H-like superfamily protein [Theobroma cacao]
Length=569

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            F++A VG+NPS++W S+  +Q II+K   WR+GNG   ++  D+W+P
Sbjct  96   FMDAPVGSNPSYLWRSIKESQQIIKKGLVWRVGNGNDIQVLEDSWIP  142



>ref|XP_008222000.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=561

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS FL A+ G+ PSF W SL+  +D++R   RWRIG+G    I+ D W+P      I S 
Sbjct  87   NSDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVPYDRFFTIQSI  146

Query  181  PFPFMENSKVEDL  219
            P      S+V DL
Sbjct  147  P-TLPATSRVCDL  158



>ref|XP_007224031.1| hypothetical protein PRUPE_ppa015156mg [Prunus persica]
 gb|EMJ25230.1| hypothetical protein PRUPE_ppa015156mg [Prunus persica]
Length=443

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFLE  V  + S +W SL   + +I + SRW++G+G    IW D WLP  N+ +I S   
Sbjct  84   SFLETAVSPHASVVWKSLCEARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIFSPKP  143

Query  187  PFMENSKVEDL  219
                 +KV DL
Sbjct  144  EHSAITKVSDL  154



>ref|XP_008346916.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1007

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SFLEA+ G   S+ WSSL++ +D+I + + W+I  G   R+W D WLP +    ++  
Sbjct  505  HCSFLEASKGGRASWAWSSLLSGRDVILQGTHWQILGGEDVRVWVDRWLPSL----LLGH  560

Query  181  PFPF  192
            P P 
Sbjct  561  PVPL  564



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS FL A+ G+ PSF W SL+  +D++R   RWRIG+G    I+ D W+P      I S 
Sbjct  491  NSDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVPYDRFFTIQSI  550

Query  181  PFPFMENSKVEDL  219
            P      S+V DL
Sbjct  551  P-TLPATSRVCDL  562



>ref|XP_010474595.1| PREDICTED: uncharacterized protein LOC104754152 [Camelina sativa]
Length=535

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  34   NPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            NPSF W S+ +T+D++ + +RW +G+G    +WRD WLPD+
Sbjct  285  NPSFAWRSIYSTKDLVGQGARWAVGSGCSISVWRDPWLPDV  325



>ref|XP_008387639.1| PREDICTED: uncharacterized protein LOC103450094 [Malus domestica]
Length=1306

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD--INNPKIM  174
            +SSFL+A +G+   + W+SL   +DI++  + W+I NG  TR+W D WLP   + +P I 
Sbjct  866  HSSFLDAKLGSRAXWAWASLPVGRDILKNGAHWQILNGXDTRLWVDRWLPSXPLGHP-IP  924

Query  175  SFPFPFMENSKVEDL  219
            S P     N+KV  L
Sbjct  925  SSPTSVTLNTKVSSL  939



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 6/74 (8%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFLE  V  + S +W SL   + +I + SRW++G+G    IW D WLP  N+ +I    F
Sbjct  787  SFLETAVSLHASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIF---F  843

Query  187  PFMENS---KVEDL  219
            P  E+S   KV DL
Sbjct  844  PKPEHSAITKVSDL  857



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  19   ANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            A    NPSF W S+ +T+D++ + +RW +G+G    +WRD WLPD+
Sbjct  799  AKKSYNPSFAWRSIYSTKDLVEEGARWTVGSGVSISVWRDPWLPDV  844



>ref|XP_008343304.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=506

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+A ++I+R+ + W+I +G  TR+W D WL  I
Sbjct  75   NCSFLDAKKGGXASWVWASLLAGREILREXAHWQIMDGNDTRVWVDRWLXPI  126



>ref|XP_008391021.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=655

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N S L+A  G   S+ WSSL+  +DII   + W+I NG + R+W D WLP I
Sbjct  88   NCSLLDAKRGGRASWAWSSLLVGRDIILGGAHWQIMNGKEVRVWVDRWLPSI  139



>ref|XP_010424572.1| PREDICTED: uncharacterized protein LOC104709700 [Camelina sativa]
Length=428

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N   L A    NPSF W S+ +T++++   +RW IG+G    +WRD WLPDI
Sbjct  12   NKHPLMAKKPNNPSFAWRSIYSTKELVEHGARWVIGSGCSISVWRDPWLPDI  63



>ref|XP_010462630.1| PREDICTED: uncharacterized protein LOC104743220 [Camelina sativa]
Length=746

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            SF+E ++ +NPS  W S+MA +++I++ + W IGNG   +IWRD WL
Sbjct  302  SFMECSIPSNPSHGWRSIMAGRNVIKQGAGWLIGNGESVKIWRDPWL  348



>emb|CDP09717.1| unnamed protein product [Coffea canephora]
Length=613

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            S  +  +    S+IW SLM  +D +RK +R +IGNG  T IW DNW+P   + K+ +   
Sbjct  148  SIFKCKIPKCASWIWQSLMNVRDFVRKGTRRKIGNGKATNIWEDNWIPGNKDGKVTTVMP  207

Query  187  PFMENSKVEDL  219
                  +VE+L
Sbjct  208  QSCNIRRVEEL  218



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N   L A   +NPSF W S+ +T+D++   +RW +G+G+   +WRD W+PDI
Sbjct  793  NKHPLMAKKPSNPSFAWRSIFSTKDLVEYGARWAVGSGSSISVWRDPWIPDI  844



>ref|XP_004295786.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=210

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            NS+FL+A  G+ PS++W+SL+A ++ I +H+ W+I +     +W D W+P+ N
Sbjct  8    NSNFLKAKKGSRPSWVWNSLLAGRETISEHALWQINSEKNVDVWTDRWVPNSN  60



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A+ G   S+ WSSL+  +D+I K + W+I  G + R+W D WLP +
Sbjct  845  NCSFLDASKGGRASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWLPAL  896



>ref|XP_007207089.1| hypothetical protein PRUPE_ppa023640mg, partial [Prunus persica]
 gb|EMJ08288.1| hypothetical protein PRUPE_ppa023640mg, partial [Prunus persica]
Length=294

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  19   ANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            A +   PS+IW SL   + +I K SRW+IGNG   RIW D WLP+  + ++ S
Sbjct  1    AQIRHCPSYIWQSLCNARVLIEKGSRWQIGNGHSVRIWGDRWLPNSESFQVSS  53



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NSSF EA    +PSF W SL+  ++++ K  RW +G+G   +I+ DNW+P    P++++ 
Sbjct  907  NSSFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGF-RPQLVTT  965

Query  181  PFPFMENSKVEDL  219
              PF  ++ V  L
Sbjct  966  LSPFPTDATVSCL  978



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NSSF EA    +PSF W SL+  ++++ K  RW +G+G   +I+ DNW+P    P++++ 
Sbjct  864  NSSFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNWIPGF-RPQLVTT  922

Query  181  PFPFMENSKVEDL  219
              PF  ++ V  L
Sbjct  923  LSPFPTDATVSCL  935



>ref|XP_004297906.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=341

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SF +A +G NPS+ W  ++  + +++   +WRIG+G +  IW+D W+P+   PK +    
Sbjct  190  SFQDAQLGDNPSYPWRRILEGRSVLQASVKWRIGDGTKASIWKDAWIPEC--PKYLIQKP  247

Query  187  PFMENSKVEDL  219
            P      V DL
Sbjct  248  PHTPYELVSDL  258



>ref|XP_008378657.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=653

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S++W+SL+  ++I+R  + W+I +G  TR+W D W+P I
Sbjct  144  NXSFLDAKXGXRASWVWASLLXGREILRAGAHWQIMDGNDTRVWVDRWIPPI  195



>ref|XP_010688587.1| PREDICTED: uncharacterized protein LOC104902499 [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIM  174
            N+SFLE  V  + SF W S++  +D++++  +  IG+G  TR+W+D W+ +++N  ++
Sbjct  38   NTSFLETKVAPHESFTWKSILQARDVLKRGVKRVIGDGLNTRVWQDPWINNVSNGGVL  95



>ref|XP_002523275.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39114.1| conserved hypothetical protein [Ricinus communis]
Length=75

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  61   MATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFPFMENSKVEDL  219
            MA QD+I++ +RWRIG+  + ++W D WL D +NP +++     ME + V  L
Sbjct  1    MAIQDLIQRGTRWRIGSSERIKVWGDAWLLDEDNPTVVTPCIEGMEGTMVNSL  53



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             NS FL A+ G+ PSF W SL+  +D++R   RWRIG+G    I+ D W+P      I S 
Sbjct  1291  NSDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVPYDRFFTIQSI  1350

Query  181   PFPFMENSKVEDL  219
             P      S+V DL
Sbjct  1351  P-TLPATSRVCDL  1362



>ref|XP_004308707.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=498

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             SF EAN+  +PSF W S++ ++ ++     W++G+G Q +IW D+W+P++   ++   P
Sbjct  29   CSFWEANLSDSPSFSWRSIVQSRPVLAAGVHWKVGDGTQIQIWTDDWIPEVPRYRVHKPP  88



>ref|XP_010495357.1| PREDICTED: uncharacterized protein LOC104772442 [Camelina sativa]
Length=507

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            L+A    +PSF W S+ +T+ ++   SRW IG+G    +WRD W+PDI 
Sbjct  149  LQAKKPYSPSFAWRSIFSTKSLVEHGSRWAIGSGCNVSVWRDPWIPDIQ  197



>ref|XP_008223235.1| PREDICTED: uncharacterized protein LOC103323054 [Prunus mume]
Length=492

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
              S L+A  G   S+ WSSL+  +DII   +RW+IGNG    +W+D WL   ++ K    
Sbjct  43   ECSLLDAKKGERASWAWSSLLVGRDIIENGARWQIGNGRSVDVWKDRWLMGCDSRKTSPL  102

Query  181  P  183
            P
Sbjct  103  P  103



>ref|XP_007203573.1| hypothetical protein PRUPE_ppb016510mg, partial [Prunus persica]
 gb|EMJ04772.1| hypothetical protein PRUPE_ppb016510mg, partial [Prunus persica]
Length=421

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFLE  V    S +W SL   + +I + SRW++G+G    IW D WLP  N+ +I S   
Sbjct  25   SFLETTVSPYASVVWKSLCDARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIFSPRP  84

Query  187  PFMENSKVEDL  219
                 +KV DL
Sbjct  85   EHSAITKVSDL  95



>ref|XP_009108843.1| PREDICTED: uncharacterized protein LOC103834526 [Brassica rapa]
Length=1084

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 10/77 (13%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI------NNPK  168
            +FL++   +NPS+ W S+ A ++++ K  R +IGNG  T +WRD W+P I       NP+
Sbjct  891  TFLQSTCSSNPSYGWRSIQAGKELLLKGLRVQIGNGRTTDVWRDKWIPTIPPRQINRNPQ  950

Query  169  IMSFPFPFMENSKVEDL  219
             +  P   +E + V DL
Sbjct  951  FLG-P---LETTLVSDL  963



>ref|XP_004310201.1| PREDICTED: uncharacterized protein LOC101298860 [Fragaria vesca 
subsp. vesca]
Length=1164

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFP  189
            FL+A +G++ S++W SL+  +D++RK  R+ +GNG    +W D W+      K  S    
Sbjct  855  FLKAEMGSDASYVWRSLLKGRDLLRKGIRYHVGNGESISVWHDPWILRPCTFKTYSTVME  914

Query  190  FMENSKVEDL  219
             +E+ KV DL
Sbjct  915  GLEDLKVADL  924



>ref|XP_010481048.1| PREDICTED: uncharacterized protein LOC104759863 [Camelina sativa]
Length=438

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N   L A    NPSF W S+ +T+ ++ + +RW +G+G    +WRD WLPDI
Sbjct  321  NKHPLMAKKPNNPSFAWRSIFSTKGLVEQGARWAVGSGCSISVWRDPWLPDI  372



>ref|XP_010451741.1| PREDICTED: uncharacterized protein LOC104733916 [Camelina sativa]
Length=919

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  34   NPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            NPSF W S+ +T+ ++ + +RW +G+G    +WRD WLPDI
Sbjct  157  NPSFAWRSIFSTKGLVEQGARWAVGSGCSISVWRDPWLPDI  197



>ref|XP_002525788.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36624.1| conserved hypothetical protein [Ricinus communis]
Length=76

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRI  129
            SFL+A +G  PS++W S+MA QD+IR   R R+G GA   +
Sbjct  36   SFLDAEMGVIPSYVWRSVMAAQDLIRGRVRMRVGTGALVNV  76



>ref|XP_007219352.1| hypothetical protein PRUPE_ppa019455mg, partial [Prunus persica]
 gb|EMJ20551.1| hypothetical protein PRUPE_ppa019455mg, partial [Prunus persica]
Length=168

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 38/73 (52%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             +S  +A  G   S  W +++  + ++   S+W +GNG    +WR  WLP  N  K++SF
Sbjct  40   TTSLWDAAAGPGASHCWRNIINARSVLVGGSKWLMGNGGSISVWRGRWLPVPNTFKVISF  99

Query  181  PFPFMENSKVEDL  219
               F  +  V+DL
Sbjct  100  TPIFFADLHVQDL  112



>ref|XP_008364703.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=749

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            SFLEA+ G   S+ WSSL++ +D+I + + W+I  G   R+W D WLP +
Sbjct  249  SFLEASKGGRASWAWSSLLSGRDVILQGTHWQILGGEDVRVWVDRWLPSL  298



>ref|XP_007207581.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
 gb|EMJ08780.1| hypothetical protein PRUPE_ppa018489mg, partial [Prunus persica]
Length=1146

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             SFL+A  G   S+  SSL+  +DII K + W+IGNG    +W+D WL    + KI   P
Sbjct  764  CSFLDAKKGGRASWALSSLLVGRDIIEKGAYWQIGNGRSVSVWKDRWLMGYGSGKISPLP  823



>ref|XP_010446097.1| PREDICTED: uncharacterized protein LOC104728868 [Camelina sativa]
Length=488

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            +S L+A    N S+ W S++    +I    ++ +GN AQ  +W DNWLP +N PK +S P
Sbjct  13   TSLLKATAKTNSSYAWKSIIHGTQLISHGLKYIVGNRAQIEVWNDNWLP-LNPPKPLSEP  71

Query  184  FPFM-ENSKVEDL  219
              +M  + KV DL
Sbjct  72   GAYMFPHLKVSDL  84



>gb|EEC76774.1| hypothetical protein OsI_14862 [Oryza sativa Indica Group]
Length=1860

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             NS    A      SF W S++  +D++RK  RW IGNG+  +I +D+W+P I  P ++  
Sbjct  1666  NSDLWNAPKPTATSFTWRSILFGRDLLRKGVRWGIGNGSSVKILKDHWIPGI-KPSMVRP  1724

Query  181   PFPFMENSKVEDL  219
               P  E+  V+ L
Sbjct  1725  LLPLPEDVTVDFL  1737



>ref|XP_007200138.1| hypothetical protein PRUPE_ppa017266mg, partial [Prunus persica]
 gb|EMJ01337.1| hypothetical protein PRUPE_ppa017266mg, partial [Prunus persica]
Length=525

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N +FL+A  G+  S+ W+SL+  +DI+ + + W++ +G+Q R+W DNW+P     +  S+
Sbjct  368  NENFLQARKGSRASWAWASLLQGRDILLQGAHWQVLDGSQVRLWVDNWIPGFEQNRPSSY  427



>ref|XP_009146521.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=642

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            NSSFLEA++G  PSFIW S++  ++ ++      IG+G QT +W  NWL
Sbjct  162  NSSFLEASIGTRPSFIWRSILHGREALKSGLLRVIGDGDQTNVWTSNWL  210



>ref|XP_002456461.1| hypothetical protein SORBIDRAFT_03g036763 [Sorghum bicolor]
 gb|EES01581.1| hypothetical protein SORBIDRAFT_03g036763 [Sorghum bicolor]
Length=218

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            +   LEA   +  S+ W S++A  +  ++   WR+G+G Q  IW DNW+P  +N KI +
Sbjct  75   DGKLLEARSKSGSSYTWQSVLAGLECFKRGYIWRVGDGTQINIWNDNWIPSSHNMKIHT  133



>gb|EPS62007.1| hypothetical protein M569_12785, partial [Genlisea aurea]
Length=317

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            NS+F+EA +G +PS  W  + A++ ++    RWR+G+G + ++W+D W+P
Sbjct  94   NSTFIEAGLGRSPSRTWRGIHASRQLLTVGLRWRVGSGEKIQVWKDPWIP  143



>ref|XP_007227248.1| hypothetical protein PRUPE_ppa018001mg [Prunus persica]
 gb|EMJ28447.1| hypothetical protein PRUPE_ppa018001mg [Prunus persica]
Length=541

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (55%), Gaps = 1/64 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIM-S  177
            +  FLEA  G   S+ WSS++  +DII   + W+I NG+ T IW D W+P I    +   
Sbjct  86   DCCFLEAQKGGRASWAWSSILLGRDIILSGAHWQILNGSSTSIWADKWIPGIPGGYLQPC  145

Query  178  FPFP  189
             P P
Sbjct  146  LPVP  149



>ref|XP_007203072.1| hypothetical protein PRUPE_ppa023514mg [Prunus persica]
 gb|EMJ04271.1| hypothetical protein PRUPE_ppa023514mg [Prunus persica]
Length=670

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
            N +FL+A  G+  S+ W+SL+   DI+ + + W++ +G+Q R+W DNW+P     ++
Sbjct  406  NENFLQARKGSRASWAWASLLQGGDILLQGAHWQVLDGSQVRLWVDNWIPGFEGGRL  462



>ref|XP_009146506.1| PREDICTED: uncharacterized protein LOC103870148 [Brassica rapa]
Length=1206

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N  FL A +G+ PS+ W S++  ++++++  R R+GNG+ T++W D W+ D
Sbjct  724  NGDFLSATLGSRPSYAWRSILFGRELLQEGIRHRVGNGSATKVWLDKWIED  774



>ref|XP_008342743.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=577

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S+ WSSL+  ++++ + + W+I NG+ TR+W D W+P I
Sbjct  63   NGSFLDAIRGGRASWGWSSLLVGREVLLQGAHWQIMNGSTTRVWMDRWIPSI  114



>ref|XP_009114468.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=573

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            NSSFLEA++G+ PSFIW S++  ++ +       +GNG QT +W  NWL D
Sbjct  88   NSSFLEASLGSRPSFIWRSILHGREALNSGLLRVVGNGDQTNVWTSNWLLD  138



>ref|XP_004296207.1| PREDICTED: uncharacterized protein LOC101297422 [Fragaria vesca 
subsp. vesca]
Length=1096

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SF+EA V    SF W S++  +D+++K  R+++GNG    +W D W+P   + +  S 
Sbjct  657  SESFMEAEVAKGCSFTWRSILKGRDLLKKGLRFQVGNGESISVWDDPWIPLPYSFRPYSP  716

Query  181  PFPFMENSKVEDL  219
            P    E  +V DL
Sbjct  717  PMEGTEELRVCDL  729



>ref|XP_007204004.1| hypothetical protein PRUPE_ppa025711mg, partial [Prunus persica]
 gb|EMJ05203.1| hypothetical protein PRUPE_ppa025711mg, partial [Prunus persica]
Length=534

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            N  FL A  GA  S+ WSSL+  ++II + +RW++ +G+  +IW D W+P  +
Sbjct  183  NGDFLRAGKGAKSSWAWSSLLVGRNIIMRGARWQVLDGSHVKIWTDKWIPGCS  235



>ref|XP_010419043.1| PREDICTED: uncharacterized protein LOC104704701 [Camelina sativa]
Length=515

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            +  FL+A++GA PS+ W S++  +D++ K  R  IG+G+ TR+W   WL D
Sbjct  462  DHQFLDASLGARPSYAWRSILYGRDLLVKGLRLCIGDGSSTRVWTGQWLLD  512



>ref|XP_010481009.1| PREDICTED: uncharacterized protein LOC104759828 [Camelina sativa]
Length=575

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N   L+A    +PS  W S+ +T+DI+   +RW IG+G    +WRD W+PD
Sbjct  359  NKHPLQAKKPCSPSLAWRSIFSTKDIVEYGARWVIGSGCNVSVWRDPWIPD  409



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (54%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFLE  V    S +W SL   + +I + SRW++G+G    IW D WLP  N+ +I S   
Sbjct  539  SFLETTVSPYASVVWKSLCDARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFQIFSPRP  598

Query  187  PFMENSKVEDL  219
                 +KV DL
Sbjct  599  EHSAITKVSDL  609



>ref|XP_009139360.1| PREDICTED: uncharacterized protein LOC103863362 [Brassica rapa]
Length=892

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
               F+ A++G  PSF W SLM  ++++ K  R R+G+G  TR+W D W+ D
Sbjct  442  GGEFIAASLGERPSFAWRSLMFGKELLLKGLRQRVGDGKTTRVWIDKWIDD  492



>ref|XP_009334552.1| PREDICTED: uncharacterized protein LOC103927360 [Pyrus x bretschneideri]
Length=1270

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +SS  +A  G   S+ WSSL+  +D+IR+ S W+I  G + R+W+D WLP +
Sbjct  785  HSSIWDAKKGGRASWAWSSLICGRDLIREGSHWQILGGQEVRVWQDRWLPSL  836



>ref|XP_008359109.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=422

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFLEA  G   S+ WSSL+  +DI+   + W+I NG + ++W D W+P +
Sbjct  88   NYSFLEAKKGGRASWAWSSLLKGRDILLNGAHWQIMNGKEIKVWGDRWVPAL  139



>ref|XP_009123709.1| PREDICTED: uncharacterized protein LOC103848581 [Brassica rapa]
Length=520

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
               F+ A++G  PSF W SLM  ++++ K  R R+G+G  TR+W D W+ D
Sbjct  40   GGEFIAASLGEKPSFAWRSLMFGKELLLKGLRQRVGDGKTTRVWIDKWIDD  90



>ref|XP_010468606.1| PREDICTED: uncharacterized protein LOC104748702 [Camelina sativa]
Length=406

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            N   L A    NPSF W S+ +T+ ++ + ++W +G+G    +WRD WLPDI+
Sbjct  12   NKHPLMAKKPNNPSFAWRSIFSTKGLVEQGAQWTVGSGCSISVWRDPWLPDIH  64



>emb|CDY12439.1| BnaC08g09280D [Brassica napus]
Length=101

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +E     +PSF W S+MA QD++    R RIG+G  TR+W + W+P I
Sbjct  1    MEVKTSNSPSFGWKSIMAAQDLLAAGLRRRIGSGYNTRVWSEPWIPTI  48



>ref|XP_002526091.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36285.1| conserved hypothetical protein [Ricinus communis]
Length=328

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            S LEA +G N SFIW S++  +++  K  RWRIG+G  TRI+ +N L
Sbjct  3    SILEAPLGLNASFIWRSILWRRELFMKGFRWRIGDGGTTRIYENNRL  49



>ref|XP_010463143.1| PREDICTED: uncharacterized protein LOC104743796 [Camelina sativa]
Length=761

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (6%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNP  165
            S  +EAN+G  PS  W S+     +I+K  +WRIG+G   RIW D W   I+NP
Sbjct  323  SKLMEANLGHRPSHAWRSIHQGIQLIKKGLKWRIGDGNTVRIWSDQW---IDNP  373



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
             +SSFL A +G +PS++W  + ++++++    RWRIGNG     W+D W+P+
Sbjct  1203  HSSFLMAPLGRSPSYVWRGIHSSREVLLGGLRWRIGNGLSVDAWKDPWIPN  1253



>ref|XP_008358476.1| PREDICTED: uncharacterized protein LOC103422210 [Malus domestica]
Length=270

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SF +A  G   S+ WSSL+  ++++RK + W+I  G   R+W D WLP +
Sbjct  15   NCSFWDAXKGGXASWAWSSLLVGREVLRKGAHWQIMGGHDVRVWVDRWLPSL  66



>ref|XP_008338514.1| PREDICTED: uncharacterized protein LOC103401576 [Malus domestica]
Length=866

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINN  162
            N   L A  G+  S+ WSSL+  Q II + +RW+IGNGA   IW+D W+ D ++
Sbjct  436  NVDALSATKGSRASWAWSSLLEGQAIIIQGARWQIGNGAAVSIWKDKWIMDADD  489



>ref|XP_010468816.1| PREDICTED: uncharacterized protein LOC104748941 [Camelina sativa]
Length=988

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            NS  L+A    +PSF W S+ +T+ ++   SRW IG G    +WRD W+PDI 
Sbjct  396  NSHPLQAKKPYSPSFAWWSIFSTKGLVEHGSRWAIGLGCNVSVWRDPWIPDIQ  448



>ref|XP_008367096.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=924

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            + SFL+A  G   S+ WSSL++ +D++   S W+I NG   R+W D WLP +
Sbjct  439  HCSFLDAKRGGRASWAWSSLLSGRDLLLBESHWQIFNGKXVRVWLDRWLPTL  490



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  19   ANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            A +G  PSFIW SL+  + ++    RWR+GNG   RIW D WLP
Sbjct  902  APIGPKPSFIWRSLVWGKKLLCAGIRWRVGNGTAIRIWEDKWLP  945



>gb|EEE52627.1| hypothetical protein OsJ_34967 [Oryza sativa Japonica Group]
Length=1395

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            +   L A + +  S+ W S++A     ++   WR+G+G Q +IW DNW+P  +N KI +
Sbjct  386  DGKLLNARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQT  444



>ref|XP_007199601.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica]
 gb|EMJ00800.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica]
Length=933

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N SFLEA      S+ W+SL+  +DI+ + + W++ NGA  R+W D WLP+
Sbjct  474  NVSFLEAKKSGRTSWAWASLLEGRDILLRGAHWQVMNGAHIRLWVDRWLPN  524



>ref|XP_010686142.1| PREDICTED: uncharacterized protein LOC104900425 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            SSF+   +G  PS+ W      + ++ +  RWR+GNG   +IW D W+P     KI+S
Sbjct  37   SSFMHTELGNMPSYTWRGNWEARWVLDRGIRWRVGNGEIIKIWSDAWIPGTQTRKILS  94



>gb|EEC68711.1| hypothetical protein OsI_37193 [Oryza sativa Indica Group]
Length=1546

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            +   L A + +  S+ W S++A     ++   WR+G+G Q +IW DNW+P  +N KI +
Sbjct  537  DGKLLNARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQT  595



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S+ WSSL+  +D+I+K + W+I  G + R+W D W P +
Sbjct  478  NCSFLDATKGDRTSWAWSSLLVGRDLIQKGAHWQIMGGEEVRLWVDRWXPAL  529



>ref|XP_009144145.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=484

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            +  FL A +G  PSF W SL+  ++++ K  + ++GNG Q R+W D W+ D
Sbjct  40   HGDFLSATLGPRPSFAWRSLLYGRELLLKAIKLKVGNGRQVRVWMDKWIDD  90



>gb|ABA96203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1378

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            +   L A + +  S+ W S++A     ++   WR+G+G Q +IW DNW+P  +N KI +
Sbjct  356  DGKLLNARMKSGSSYTWQSILAGLQCFKQGYIWRVGDGTQIKIWEDNWIPGSHNMKIQT  414



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            SFL+A +G  PS+ W  + +++ ++++   WR+GNG    IWRD W+ D
Sbjct  701  SFLDAPLGYAPSYSWRGIWSSKALVKEGMLWRVGNGQDINIWRDPWIAD  749



>ref|XP_007219650.1| hypothetical protein PRUPE_ppa023706mg [Prunus persica]
 gb|EMJ20849.1| hypothetical protein PRUPE_ppa023706mg [Prunus persica]
Length=345

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 40/67 (60%), Gaps = 4/67 (6%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
             +FLEA      S+ W+SL+  + II + +RW+I N  Q ++W D W+P ++N K+    
Sbjct  63   CNFLEAKKCGCASWAWASLLEGRKIILQGARWQILNCRQAKLWMDCWIPSLHNGKL----  118

Query  184  FPFMENS  204
             P ++NS
Sbjct  119  HPHLQNS  125



>ref|XP_006482369.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=494

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDN  141
             + FL A++G+NPS+IW S+M  + +I    RWRIGN  +  ++RDN
Sbjct  88   KTDFLRASIGSNPSYIWRSIMWGRQVIHNGHRWRIGNREKISVYRDN  134



>ref|XP_008237121.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=534

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            +  F +A +G  PS+IW SL+A +D +  ++R +I NG  T IW DNW+P++ 
Sbjct  49   DCDFKDATLGHRPSWIWRSLLAGRDTVMNNARRQIMNGESTNIWADNWVPEVG  101



>ref|XP_006478211.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=478

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            ++ F+EA +G+NPSF+W S++  + ++ +  RWR+GNG +  ++  NW+
Sbjct  328  HTDFMEAKLGSNPSFVWRSILWGRQLLHEGLRWRVGNGHKISVFSRNWM  376



>ref|XP_006478212.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=387

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            ++ F+EA +G+NPSF+W S++  + ++ +  RWR+GNG +  ++  NW+
Sbjct  237  HTDFMEAKLGSNPSFVWRSILWGRQLLHEGLRWRVGNGHKISVFSRNWM  285



>ref|XP_008376078.1| PREDICTED: uncharacterized protein LOC103439314 [Malus domestica]
Length=233

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S+ WSSL+  ++I+++ + W+I N    R+W D WLP I
Sbjct  15   NCSFLDAKQGGRASWAWSSLLVGRNILKEGAHWQIMNRNNVRVWIDRWLPSI  66



>ref|XP_009126322.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=593

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNP  165
            ++F+EA      S+ W S++  + +I K +RW IGNG   R+W+D WL +  +P
Sbjct  96   TTFMEAKSYQTSSYAWRSILQAKPLIHKGARWIIGNGENVRVWKDRWLTENQSP  149



>ref|XP_010463261.1| PREDICTED: uncharacterized protein LOC104743930 [Camelina sativa]
Length=370

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            ++ FL A VG  PSF W S++    +++   + +IGNG   R+WRD W+ D   P  ++F
Sbjct  71   DTDFLNAEVGDRPSFAWRSVLHGSALLQNGLKKKIGNGKSVRVWRDQWIYD-EKPWKITF  129

Query  181  PFPFME  198
              P +E
Sbjct  130  TPPCVE  135



>ref|XP_010451225.1| PREDICTED: uncharacterized protein LOC104733339 [Camelina sativa]
Length=922

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N   L A    NPSF W S+ +T++++ + +RW +G+G    +WRD W+PD
Sbjct  459  NKHPLMATKPYNPSFAWRSIFSTKELVAQGARWAVGSGCSISVWRDPWIPD  509



>ref|XP_004301927.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=968

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N  +    VG  PSF+W  L+  +D++    RWRIG+G   +IW D WLP   + K+++ 
Sbjct  488  NGDWAATGVGVKPSFVWPGLVWGKDLMCAGIRWRIGSGDLVKIWGDKWLPTPWSFKVVT-  546

Query  181  PFPFMENSKVEDL  219
            P     N++V  L
Sbjct  547  PCFMDPNARVSQL  559



>gb|EPS58588.1| hypothetical protein M569_16225, partial [Genlisea aurea]
Length=265

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPF  186
            SFL A +G  PS+ W S+ +++ ++    RWRIG G    +W D W+P+    +  S   
Sbjct  43   SFLHAPLGRAPSYSWHSIHSSRKVLASGLRWRIGGGNSVNVWHDPWIPENLAFRPSSPAP  102

Query  187  PFMENSKVEDL  219
            P   + KV+DL
Sbjct  103  PGTADMKVKDL  113



>ref|XP_007210987.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
 gb|EMJ12186.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
Length=759

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N SFLEA      S+ W+SL+  +DI+ + + W++ NGA  R+W D WLP+
Sbjct  286  NVSFLEAKRSGRTSWAWASLLEGRDILLRGAHWQVMNGAHIRLWIDRWLPN  336



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N  FL+A +G + S+ WSS+ +++ ++++   WRIGNG   RIW D WL D
Sbjct  800  NFDFLDAPLGVSTSYTWSSIWSSKALLKEGMVWRIGNGTNVRIWEDPWLLD  850



>ref|XP_009141462.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=401

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS  L A +G+ PS+ W S+ A Q +I++ +R  IGNG  T++W++ WL       I S 
Sbjct  88   NSDTLNATLGSRPSYAWRSIHAAQKLIQQGARVVIGNGKDTKLWQERWLGATLATMIQS-  146

Query  181  PFPFMENSKVEDL  219
               ++EN   E L
Sbjct  147  -MKWVENQSHERL  158



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDIN  159
            N+SFL A++G +PSF W SL+  ++++    RW  G+G+Q  IW   WLP + 
Sbjct  787  NTSFLCASLGRSPSFTWRSLLTARELLVSGLRWCPGDGSQINIWSSPWLPRMG  839



>ref|XP_008355160.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=573

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SF +A  G   S+ WSSL+  ++++RK + W+I  G   R+W D WLP +
Sbjct  88   NCSFWDAXKGGXASWAWSSLLVGREVLRKGAHWQIMGGHDVRVWVDRWLPSL  139



>ref|XP_008358487.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=573

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SF +A  G   S+ WSSL+  ++++RK + W+I  G   R+W D WLP +
Sbjct  88   NCSFWDAXKGGXASWAWSSLLVGREVLRKGAHWQIMGGHDVRVWVDRWLPSL  139



>ref|XP_004293049.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=677

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            NS+F+ A  G+ PS++W+SL+A QD I  ++ W++ N     +W+D W+P+
Sbjct  268  NSNFVHAKKGSRPSWVWNSLLAGQDTITSNAFWQVRNRQSIEVWKDRWVPN  318



>ref|XP_009334551.1| PREDICTED: uncharacterized protein LOC103927359 [Pyrus x bretschneideri]
Length=1270

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +SS  +A  G   S+ WSSL+  +D++R  S W+I  G + R+W+D WLP +
Sbjct  785  HSSIWDAKKGGRASWAWSSLICGRDVLRGGSHWQILGGQEVRVWQDRWLPSL  836



>ref|XP_008375526.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=327

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS FL+A V    SF W S+ A + ++   SRW++ +G   RIW D W+P  ++ ++ S 
Sbjct  109  NSMFLDATVKVGASFCWHSICAARVVLTCGSRWQVRSGEGIRIWEDRWIPQPSSLRVFS-  167

Query  181  PFPFMEN  201
            P P   N
Sbjct  168  PKPVGTN  174



>ref|XP_010665852.1| PREDICTED: uncharacterized protein LOC104883097 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            SSFL+AN+G   S+ W S+  ++ ++ +   WRIGNGA  +IW D W+
Sbjct  41   SSFLDANLGPVGSYSWKSIWGSKSLVIEGVLWRIGNGASIKIWEDPWV  88



>ref|XP_010518602.1| PREDICTED: uncharacterized protein LOC104793875 [Camelina sativa]
Length=387

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
            +S FL A +G  PSF W S++  +D++ K    ++GNG    +W D W+ D + P+
Sbjct  316  DSEFLTAVLGQRPSFAWKSILHGRDLLYKGITKKVGNGESLNVWLDKWIEDEDGPR  371



>ref|XP_008245663.1| PREDICTED: uncharacterized protein LOC103343804 [Prunus mume]
Length=496

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            +  FL+A +G+ PS+IWSSL+  +D I  H+R  + +GA T IW+DNW+
Sbjct  418  DCDFLKAVLGSWPSWIWSSLIDGRDFILSHARKLVLSGAHTSIWKDNWV  466



>gb|EPS61668.1| hypothetical protein M569_13125, partial [Genlisea aurea]
Length=317

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            +SSFLEA +G  PS+ W SL+  ++++    RW  G+G Q  +W   WLP
Sbjct  94   SSSFLEARLGRRPSYTWPSLLTARELLVSGLRWCPGDGTQINVWNSPWLP  143



>ref|XP_009103825.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=570

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            +S FLE   G  PS+ W S++  +D+++K     IGNGA TRIW + W+ D
Sbjct  95   SSDFLECGKGYQPSYAWRSILYGRDLLKKGLIQSIGNGASTRIWSEKWIMD  145



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINN  162
            +S + A++G NPS++W S++A ++++ + SR ++G+G    I +D WLPD+ +
Sbjct  29   TSVVRASLGHNPSYVWRSILAAKEVVVQGSRVQVGSGHSISIGKDPWLPDLQD  81



>ref|XP_008356060.1| PREDICTED: uncharacterized protein LOC103419743 [Malus domestica]
Length=1341

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFL+A  G   S+ WSSL+  ++++ + + W+I NG  TR+W D W+P I
Sbjct  881  NGSFLDAIRGGXASWGWSSLLVGREVLLQGAHWQIMNGRTTRVWMDMWIPSI  932



>ref|XP_002522452.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF39944.1| nucleic acid binding protein, putative [Ricinus communis]
Length=483

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINN  162
            N  FL + +G NPS+IW+SL   +D+I K  +W+IG G +  I    WL D +N
Sbjct  39   NGDFLSSLLGTNPSYIWASLQQVRDLICKGVQWKIGKGTEVSIGLHEWLLDASN  92



>ref|XP_004954924.1| PREDICTED: uncharacterized protein LOC101756955 [Setaria italica]
Length=1203

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            N   L+A      SF W S++A  +  +    WR+G+G Q  IW DNW+P  +N KI +
Sbjct  758  NGKLLQARNKNGSSFTWQSILAGLECFKHGYIWRVGDGTQINIWEDNWIPGSHNLKIQT  816



>ref|XP_007204776.1| hypothetical protein PRUPE_ppa015675mg, partial [Prunus persica]
 gb|EMJ05975.1| hypothetical protein PRUPE_ppa015675mg, partial [Prunus persica]
Length=278

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  31   ANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNP  165
            A  S+ WSSL+A +D+I + +RW+I +G++  +W D WLP + NP
Sbjct  98   ARASWAWSSLLAGRDLILRGARWQILDGSRVHLWTDKWLPCVANP  142



>ref|XP_008227636.1| PREDICTED: uncharacterized protein LOC103327128 [Prunus mume]
Length=713

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             S FL A+ G+ PSF W SL+  +D++R   RWRIG+G    I+ D W+P      + S 
Sbjct  647  QSDFLAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWVPYDRFFTVQSI  706

Query  181  P  183
            P
Sbjct  707  P  707



>ref|XP_008351893.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=532

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            SF +A  G   S+ WSS++  ++++R  S W+I +GA  R+W D WLP +
Sbjct  210  SFWDAKKGGRASWAWSSILVGREVLRNGSHWQIMSGADVRVWDDRWLPSL  259



>ref|XP_007221402.1| hypothetical protein PRUPE_ppa021602mg, partial [Prunus persica]
 gb|EMJ22601.1| hypothetical protein PRUPE_ppa021602mg, partial [Prunus persica]
Length=697

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            SFL+A + ++PS IW +L+  +D++     W++GNG   R+++D W P +
Sbjct  510  SFLQAELESSPSLIWRALLWGRDVLHDGLVWQVGNGNSIRVFQDKWTPTV  559



>ref|XP_007050815.1| Uncharacterized protein TCM_004559 [Theobroma cacao]
 gb|EOX94972.1| Uncharacterized protein TCM_004559 [Theobroma cacao]
Length=88

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            F+EA +G NPS++W SL     ++++   WRIG+G    + RD W+
Sbjct  21   FMEAPIGTNPSYLWRSLREGHHVLKRGLIWRIGDGKNISVRRDCWI  66



>ref|XP_008391158.1| PREDICTED: uncharacterized protein LOC103453395 [Malus domestica]
Length=423

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 5/65 (8%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP-----DINNPKI  171
            +FLEA+V A+ S+ W ++ ATQ+II   S  ++ +GA  +IW D W+P      I  PK+
Sbjct  359  TFLEASVKADASYFWKNIYATQNIISLGSSRQVSSGALLKIWEDPWIPLPARFRIFTPKM  418

Query  172  MSFPF  186
             + P 
Sbjct  419  DTSPL  423



>ref|XP_008242862.1| PREDICTED: uncharacterized protein LOC103341160 [Prunus mume]
Length=872

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            +  F +A +G  PS+IW+S++  +D +   +R +I NGA T IW DNW+PD
Sbjct  468  DCEFKDAVLGHRPSWIWTSILEGRDALMGRARVQIINGADTNIWGDNWIPD  518



>ref|XP_009137131.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=508

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNW-LPDINNP  165
            N +FLE  +G  PS+ W S+M  ++++ +    R+G+G  T +W DNW L D+  P
Sbjct  40   NGTFLECGIGTRPSYAWRSIMHGRELLVQGLMKRVGDGQSTHVWYDNWILLDVPRP  95



>ref|XP_008385416.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=821

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SF EA  GA  S+ WSSL++ ++++   S W+I  G   R+W D WLP + +      
Sbjct  389  HCSFWEAKKGARASWAWSSLLSGRELLASGSHWQIMGGEDVRVWVDRWLPSLPS----GH  444

Query  181  PFPFMENSKVEDL  219
            P P  E    ++L
Sbjct  445  PMPLGEVEVTKNL  457



>ref|XP_007226724.1| hypothetical protein PRUPE_ppa019750mg, partial [Prunus persica]
 gb|EMJ27923.1| hypothetical protein PRUPE_ppa019750mg, partial [Prunus persica]
Length=478

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N  FL A  G +PS IW S++  + +I +   WRIG G   R++ D W+P 
Sbjct  345  NGDFLTAGYGQSPSLIWRSILWGRQVIEQGLIWRIGGGTSVRVFHDKWIPK  395



>pir||S65812 RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW15) - Arabidopsis 
thaliana retrotransposon Ta11-1
 gb|AAA75254.1| reverse transcriptase [Arabidopsis thaliana]
Length=1333

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI-MSFPF  186
            FL+A + A PS+ W S++  +D++ K  R ++GNG+ T +W D W+ D N+P++ +   F
Sbjct  897  FLDAELKATPSYAWRSILHGRDLLIKGFRKKVGNGSSTSVWMDPWIYD-NDPRLPLQKHF  955

Query  187  PFMENSKVEDL  219
                + +V DL
Sbjct  956  SVNLDLRVHDL  966



>gb|KEH19519.1| hypothetical protein MTR_8g463110 [Medicago truncatula]
Length=667

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            + S+L A +G NPS++W S+M  + ++R  +RW+IG+GA   I  + WL
Sbjct  619  SGSYLSAVIGHNPSYVWRSIMHARFVVRGGARWKIGSGASIAILNEPWL  667



>ref|XP_004301837.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=420

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFP  189
             LEA V A  S+ W SLM   D++++  R++IG G+   +W D WLP     K  S    
Sbjct  1    MLEATVKAGDSYAWRSLMKGVDLLKQGVRFQIGTGSSVSVWNDPWLPRPYTFKPYSGVME  60

Query  190  FMENSKVEDL  219
             +E+  V DL
Sbjct  61   GLEDLMVGDL  70



>ref|XP_009139334.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=614

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            SSFLE   G  PSF W S++  ++++++     IGNG Q+ +W +NW+ D
Sbjct  388  SSFLECGTGTRPSFAWRSILQGRELLKQGLIRHIGNGEQSNVWVENWIID  437



>ref|XP_009367701.1| PREDICTED: uncharacterized protein LOC103957282 [Pyrus x bretschneideri]
Length=1363

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +1

Query  7    SFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            S  EA  G   S+ WSSL+  +++IR  S W++  G + R+W+D WLP +
Sbjct  926  SIWEAKKGGRASWAWSSLLYGRELIRGGSHWQVMGGQEVRVWQDRWLPSL  975



>ref|XP_009363712.1| PREDICTED: uncharacterized protein LOC103953670 [Pyrus x bretschneideri]
Length=908

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            + S  +A  G   S+ WSSL+  +D+IR+ S W+I  G + R+W+D WLP +
Sbjct  626  HCSLWDAKKGGWASWAWSSLLCGRDLIREGSHWQIMGGQEVRVWQDRWLPSL  677



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             SSFL A+V ++ S +W SL A + ++   +RW++ +G    IW D W+P     KI S 
Sbjct  473  TSSFLNASVSSHDSAVWKSLCAARKVLEGGTRWQVSDGNNIDIWHDRWIPQPRQFKIYS-  531

Query  181  PFPFME  198
            P P +E
Sbjct  532  PAPPVE  537



>gb|ABN05778.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=340

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            NSS+L+A +G NPSF+W S++  + ++R+ +RW+IG G    I  + W+
Sbjct  40   NSSYLDARLGHNPSFVWRSILNAKVVVRQGARWKIGTGFNIPIISEPWI  88



>ref|XP_002465515.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
 gb|EER92513.1| hypothetical protein SORBIDRAFT_01g040340 [Sorghum bicolor]
Length=778

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            FL AN+G +PS IW S++  +++++     RIG G  T IWRD+WLP
Sbjct  362  FLGANLGQSPSKIWRSILDGREVLQLGLIKRIGTGETTSIWRDDWLP  408



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
             NS FL++ VG+ PS+ W S++  +D++++     +G+G  T++W DNWL
Sbjct  1388  NSGFLDSGVGSRPSYAWRSILHGRDLLKRGLVRVVGDGNDTKVWTDNWL  1436



>ref|XP_009119675.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1046

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            NS  L A +G+ PS+ W S+ A Q +I++ +R  IGNG  T++W++ WL     P  M  
Sbjct  557  NSDPLNATLGSRPSYAWRSIHAAQKLIQQGARVVIGNGKDTKLWQERWLG--ATPATMIQ  614

Query  181  PFPFMEN  201
               ++EN
Sbjct  615  SMKWVEN  621



>ref|XP_008356403.1| PREDICTED: uncharacterized protein LOC103420114 [Malus domestica]
Length=881

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            + SF +A  G   S+ W+SL+  +++IR+ S W+I  G+  R+W D WLP +
Sbjct  550  HCSFWDAVKGGRASWAWTSLLVGREVIRRGSHWQIMGGSDVRVWVDRWLPSL  601



>ref|XP_009138123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=761

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N SFL A +G+ PS+ W S++  +++++K  R  +GNG    +W   WL D    +I   
Sbjct  286  NGSFLSATLGSRPSYAWRSILHGRELLKKGLRNAVGNGLSISVWSTPWLIDGERLRI---  342

Query  181  PFPFMENSKVE  213
              P M+N+ V+
Sbjct  343  --PLMKNTLVD  351



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKI  171
             +  FL A+ G +PS+ W S+   + ++ +  RWR+GNG   ++W + WL D +  K+
Sbjct  1101  HDEFLTAHRGFDPSYSWRSIWGAKSLLLEGLRWRVGNGVSIKVWDEAWLADDDANKV  1157



>ref|XP_009123679.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1072

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            ++SFL  +V A+ S  W S++A ++I+RK   W +GNG    +W + WL   N+P     
Sbjct  614  DASFLNCSVPASASHGWRSILAGREILRKGLSWMVGNGESINVWSEPWL-SFNSPTQPMG  672

Query  181  PFPFMENS-KVEDL  219
            P PF   S KV DL
Sbjct  673  PQPFHSMSLKVSDL  686



>ref|XP_008369650.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=587

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N SFLEA      S+ WSSL+  +DI+   + W+I NG + ++W D W+P +
Sbjct  88   NCSFLEAKRSVRASWAWSSLLKGRDILLNGAHWQIMNGKEIKVWGDRWVPAL  139



>ref|XP_009107571.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=692

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            S+FLEA +G  PSF W SL+  +++I K  + R+G+G    +W D W+ D  +   M  P
Sbjct  206  SNFLEAKLGDKPSFAWRSLLFGRELILKGLQKRVGDGNSIHVWTDKWVEDEADGYGMRAP  265

Query  184  F----PFMENSKVEDL  219
            +     F  N +V +L
Sbjct  266  WIKNCTFNVNLRVREL  281



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            SS ++A VG   S+ W SLM  ++++++  R+++GNG    +W D WLP     K  S P
Sbjct  651  SSLIQAEVGKRISYSWRSLMRGKELLQQGLRFQVGNGENIHLWDDPWLPLPYTFKPFSLP  710

Query  184  FPFMENSKVEDL  219
                E  +V +L
Sbjct  711  MHGSEGMRVCEL  722



>ref|NP_194638.1| ribonuclease H-like protein [Arabidopsis thaliana]
 emb|CAB43923.1| putative protein [Arabidopsis thaliana]
 emb|CAB79667.1| putative protein [Arabidopsis thaliana]
 gb|AAY78807.1| putative reverse transcriptase/RNA-dependent DNA polymerase [Arabidopsis 
thaliana]
 gb|AEE85585.1| ribonuclease H-like protein [Arabidopsis thaliana]
Length=575

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            L A +G+ PSF+W S+ A+Q+I+R+ +R  +GNG    IWR  WL
Sbjct  99   LNAPLGSRPSFVWKSIHASQEILRQGARAVVGNGEDIIIWRHKWL  143



>gb|AAD21778.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1715

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             N+++L AN G + S+ W+S+   + ++++  R R+G+G  T+IW D WLP +  P+    
Sbjct  1236  NTTYLRANKGGHASYGWNSIQEGKLLLQQGLRVRLGDGQTTKIWEDPWLPTL-PPRPARG  1294

Query  181   PFPFMENSKVEDL  219
             P    E+ KV DL
Sbjct  1295  PI-LDEDMKVADL  1306



>ref|XP_010507236.1| PREDICTED: uncharacterized protein LOC104783832 [Camelina sativa]
Length=1127

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            NSSFL A  G  PSF W S++  +D++    + R+G+GA  ++W   WL D
Sbjct  725  NSSFLSAECGRRPSFAWRSILHGRDLLELGLKQRVGDGAFIKVWSTPWLED  775



>ref|XP_010484878.1| PREDICTED: uncharacterized protein LOC104763170 [Camelina sativa]
Length=405

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N  F EA +G  PS+ W S+M  ++++ K     IGNG  TR+W D W+ D
Sbjct  90   NVPFFEARIGYKPSYAWRSIMFGRELLEKGVMKSIGNGQDTRVWLDKWVFD  140



>ref|XP_009140648.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=491

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            FLE +VG  PS+ W S+M  ++++ +    RIGNG  T +W DNW+
Sbjct  11   FLECSVGYRPSYAWRSIMHGRELLSQGLLKRIGNGKDTHVWYDNWI  56



>ref|XP_009340474.1| PREDICTED: uncharacterized protein LOC103932570 [Pyrus x bretschneideri]
Length=480

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
            +SSF +A V     F+W S+   ++++ K SRWR+G+  + RIW D WLP  ++ +I S
Sbjct  368  SSSFSQAIVKPIDLFLWMSICKGREVVNKGSRWRVGSDGKIRIWDDKWLPLPSSFRIFS  426



>ref|XP_008366311.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=812

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
              SF+EA VG   ++ W  +M  + I+ +  RWR+G+G+  R+  D WLP  +  +++S
Sbjct  464  ECSFMEAKVGKRSTWGWKGIMQGKKILERGRRWRVGDGSSIRVKYDPWLPRPHTFRVIS  522



>ref|XP_008387750.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=670

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 38/73 (52%), Gaps = 2/73 (3%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
              SF EA  G N S+ W  L   + +++   RWR+GNG    I +D WLP  +  K +  
Sbjct  164  GKSFGEALKGKNTSWGWKGLFEARKVLKLGLRWRVGNGKSINIRKDPWLPXPSTYKXI--  221

Query  181  PFPFMENSKVEDL  219
            P P +E + V DL
Sbjct  222  PKPILEGTMVCDL  234



>ref|XP_004305827.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=888

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIM  174
             SF EA +  +PSF W S   ++ +++   +W+IG+GAQ  IW D W+P  N PK +
Sbjct  421  CSFWEAQLSEHPSFSWRSNFQSRPVLQAGIQWKIGDGAQINIWNDAWIP--NCPKYL  475



>ref|XP_009103531.1| PREDICTED: uncharacterized protein LOC103829604 [Brassica rapa]
Length=466

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            +  +  +NPS+ W SL+A++ I+++  R +IGNG  T +W D WLP +
Sbjct  255  MSVDNASNPSYGWKSLLASRPILQQGLRKKIGNGYDTNVWEDLWLPTL  302



>emb|CAE01608.2| OSJNBa0052O21.12 [Oryza sativa Japonica Group]
Length=427

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  40   SFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFPFMENSKVEDL  219
            SF W S++  +D++RK  RW IGNG+  +I +D+W+P I  P ++    P  E+  V+ L
Sbjct  329  SFTWPSILFGRDLLRKGVRWGIGNGSSVKILKDHWIPGI-KPSMVRPLLPLPEDVTVDFL  387



>ref|XP_009375083.1| PREDICTED: uncharacterized protein LOC103963932 [Pyrus x bretschneideri]
Length=1815

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
             +SS  +A  G   S+ WSSL+  + ++R+ S W+I  G + R+W+D WLP +
Sbjct  1330  HSSIWDAKKGGRASWAWSSLICGRGLVREGSHWQILGGQEVRVWQDRWLPSL  1381



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 6/67 (9%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
             N SFL A +G  PS+ W SL+A ++ I  + RW +G+G +  I +D WLP      I S 
Sbjct  1216  NGSFLRAEIGYRPSWGWRSLLAGREAILPNLRWSVGDGKRISIRQDQWLP------IGSI  1269

Query  181   PFPFMEN  201
             P P   +
Sbjct  1270  PGPLARD  1276



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
            NS FL A  G+ PS+ W S++  ++++ +  R  IGNG +T +W D WL D +N +
Sbjct  891  NSDFLSATRGSRPSYAWRSILFGRELLMQGLRTVIGNGQKTFVWTDKWLHDGSNRR  946



>emb|CDY02402.1| BnaA02g23110D [Brassica napus]
Length=260

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            +E     +PSF W S+MA QD++    R RIG+G  TR W D+W+P
Sbjct  1    MEVKTSNSPSFGWKSIMAAQDLLCADLRRRIGSGYNTREWSDSWIP  46



>ref|XP_010495331.1| PREDICTED: uncharacterized protein LOC104772408 [Camelina sativa]
Length=957

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
             SSFLEA++G+ PSF W S++  + ++ K  + ++G+G   ++W   WL D
Sbjct  626  ESSFLEADLGSGPSFAWRSILHGRSLLEKGLKQKVGDGRSLKVWTSPWLSD  676



>ref|NP_001066197.2| Os12g0156200 [Oryza sativa Japonica Group]
 gb|ABA96496.2| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29216.2| Os12g0156200 [Oryza sativa Japonica Group]
Length=1764

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
             + S ++ + G+N S  W S+    D+++K   WR+GNG   RIWRD+WLP
Sbjct  1023  HGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLP  1072



>gb|AAQ19327.1| bZIP-like protein [Oryza sativa Japonica Group]
Length=2367

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
             + S ++ + G+N S  W S+    D+++K   WR+GNG   RIWRD+WLP
Sbjct  1626  HGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLP  1675



>gb|EAZ29765.1| hypothetical protein OsJ_13823 [Oryza sativa Japonica Group]
Length=490

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +1

Query  40   SFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFPFPFMENSKVEDL  219
            SF W S++  +D++RK  RW IGNG+  +I +D+W+P I  P ++    P  E+  V+ L
Sbjct  392  SFTWPSILFGRDLLRKGVRWGIGNGSSVKILKDHWIPGI-KPSMVRPLLPLPEDVTVDFL  450



>gb|EEC68887.1| hypothetical protein OsI_37529 [Oryza sativa Indica Group]
Length=1765

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
             + S ++ + G+N S  W S+    D+++K   WR+GNG   RIWRD+WLP
Sbjct  1349  HGSLIDTSFGSNSSPAWRSIEYGLDLLKKGIIWRVGNGNSIRIWRDSWLP  1398



>ref|XP_008390254.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=758

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 38/73 (52%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            N SFLEA  G   S+  SSL++ +D++   + W+I  G   R+W D WLP I + +    
Sbjct  297  NCSFLEAKKGGRASWAXSSLLSGRDLLXXGTHWQIMXGQDVRVWVDXWLPSIPSGR----  352

Query  181  PFPFMENSKVEDL  219
            P P  E     +L
Sbjct  353  PXPLGEVXVTRNL  365



>ref|XP_008374301.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=600

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            F +A  G   S+ WSSL+  ++I+R  + W+I NG   R+W D WLP I
Sbjct  142  FFBAKRGGRASWAWSSLLVGREILRGGAHWQIMNGNDVRVWVDRWLPSI  190



>ref|XP_009115652.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=337

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
            N+  + A++GA PS+ W S++  +D++ K  +  +GNG   ++W D WL D
Sbjct  12   NTDIMNASLGAKPSYAWRSILHGRDLLEKGLKCSVGNGRSLKVWTDCWLED  62



>emb|CDY44322.1| BnaC05g30710D [Brassica napus]
Length=112

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMS  177
             +SFLEA   A  S  W S +  +D+++ +    IGNG  TR+W+D+WL    N KI+ 
Sbjct  40   KTSFLEAQAPAVCSHGWRSKLHGRDLLKGNVGKAIGNGEDTRVWKDSWLSLEENIKILG  98



>ref|XP_008377038.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=388

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SF EA  GA  S+ WSSL++ +++I   S W+I  G   R+W D WLP + +      
Sbjct  148  HCSFWEAKNGAKASWAWSSLLSGRELIAIGSHWQIMGGEDVRVWVDRWLPLLPSGD----  203

Query  181  PFPFMENSKVEDL  219
            P P  E    ++L
Sbjct  204  PMPLGEVEVTKNL  216



>ref|XP_008372905.1| PREDICTED: uncharacterized protein LOC103436258 [Malus domestica]
Length=1222

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSF  180
            + SF EA  GA  S+ WSSL++ ++++   S W+I  G   R+W D WLP + +      
Sbjct  737  HCSFWEAKKGAXASWAWSSLLSGRELLASGSHWQIMGGEXVRVWVDRWLPSLPS----GH  792

Query  181  PFPFMENSKVEDL  219
            P P    S   +L
Sbjct  793  PMPLXXVSXXSNL  805



>ref|XP_009343973.1| PREDICTED: uncharacterized protein LOC103935882 [Pyrus x bretschneideri]
Length=1173

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
              SFL+A  G   S+ WSSL+  ++I+   + W+I NG   R+W D W+P I   K
Sbjct  735  QCSFLDAKQGGRASWGWSSLLVGREILLGGAHWQIMNGRSVRLWHDRWVPTIPGGK  790



>gb|KFK27798.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1250

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
            ++ +EA  G+ PS+IW SL+  +++++K  R  +G+GA  R ++DNWL D + P+
Sbjct  890  TNIMEAGNGSKPSYIWRSLLDGRELVKKGLRCLVGDGANIRAFQDNWL-DTHPPR  943



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            S+FL A  G +PS++W S+   + ++ +  +WR+G+G+   +W ++WLP  +   +   P
Sbjct  859  SNFLNARRGFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGESAAVV---P  915

Query  184  FPFME---NSKVEDL  219
             P ME   + +V DL
Sbjct  916  TPNMESPADLRVSDL  930



>ref|NP_001173474.1| Os03g0418500 [Oryza sativa Japonica Group]
 gb|AAP44632.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAR01703.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96641.1| hypothetical protein LOC_Os03g30510 [Oryza sativa Japonica Group]
 dbj|BAH92202.1| Os03g0418500 [Oryza sativa Japonica Group]
Length=813

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLP  150
            S FL+A    + S  W +++A +DI+ K    RIG+G  TRIW+D WLP
Sbjct  524  SEFLQATRKKHSSHTWRAILARRDILFKGLVRRIGDGNSTRIWQDRWLP  572



>gb|KFK27800.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1257

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +1

Query  4    SSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPK  168
            ++ +EA  G+ PS+IW SL+  +++++K  R  +G+GA  R ++DNWL D + P+
Sbjct  890  TNIMEAGNGSKPSYIWRSLLDGRELVKKGLRCLVGDGANIRAFQDNWL-DTHPPR  943



>gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=573

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  10   FLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDINNPKIMSFP  183
            FL+A +G NPS+ W SL +TQ ++    RW+IG+G++  +W   W+ ++ + K  + P
Sbjct  427  FLDATLGHNPSYTWRSLWSTQSLLTLGHRWKIGDGSKINVWSMPWIRNLLSLKPSTSP  484



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            + SFL+ ++G   S+ WSSL+  ++I+ + + W+I NG   R+W D W+P I
Sbjct  812  HCSFLDDSLGGRASWGWSSLLVGREILLRGAHWQIMNGRSIRLWHDRWVPSI  863



>ref|XP_010694349.1| PREDICTED: uncharacterized protein LOC104907159 [Beta vulgaris 
subsp. vulgaris]
Length=284

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  13   LEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWL  147
            L+A  G +PS+ W SL   + ++++  +WRIGNG + R+W D WL
Sbjct  32   LDAYRGFDPSYSWRSLWGAKSLLKEGLQWRIGNGTRVRVWEDVWL  76



>ref|XP_009147172.1| PREDICTED: uncharacterized protein LOC103870758 [Brassica rapa]
Length=1637

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  1     NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPD  153
             NS+FLEA +G  PS+ W SL+  ++++ K  + R+G+G    +W D W+ D
Sbjct  1150  NSNFLEAKIGDRPSYAWRSLLFGRELLIKGLQKRVGDGNSINVWTDRWMED  1200



>ref|XP_010496595.1| PREDICTED: uncharacterized protein LOC104773646 [Camelina sativa]
Length=313

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +1

Query  1    NSSFLEANVGANPSFIWSSLMATQDIIRKHSRWRIGNGAQTRIWRDNWLPDI  156
            N   L A    NPSF W S+ + + ++ + +RW +G+G    +WRD W+PDI
Sbjct  168  NKHPLMAKKPYNPSFAWRSIYSIKGLVEQGARWAVGSGNSISVWRDPWIPDI  219



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507827886552