BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c52786_g1_i1 len=317 path=[295:0-316]

Length=317
                                                                      Score     E

ref|XP_010054394.1|  PREDICTED: uncharacterized protein LOC104442692  53.5    8e-06   
emb|CDP08030.1|  unnamed protein product                              52.4    2e-05   
ref|XP_010644262.1|  PREDICTED: uncharacterized protein LOC100258913  52.4    2e-05   
emb|CBI20386.3|  unnamed protein product                              51.2    4e-05   
emb|CBI20388.3|  unnamed protein product                              50.4    5e-05   
emb|CBI20393.3|  unnamed protein product                              50.8    6e-05   
gb|EEC76824.1|  hypothetical protein OsI_14965                        50.8    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010644255.1|  PREDICTED: uncharacterized protein LOC100255568  50.1    9e-05   
gb|EEE60550.1|  hypothetical protein OsJ_13900                        50.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010644254.1|  PREDICTED: uncharacterized protein LOC100260642  49.7    1e-04   
emb|CAN75530.1|  hypothetical protein VITISV_001347                   49.7    1e-04   Vitis vinifera
gb|EMT29784.1|  hypothetical protein F775_21169                       49.7    1e-04   
ref|XP_008342346.1|  PREDICTED: uncharacterized protein LOC103405164  49.3    2e-04   
ref|XP_011018639.1|  PREDICTED: uncharacterized protein LOC105121611  49.3    2e-04   
ref|XP_010068527.1|  PREDICTED: uncharacterized protein LOC104455430  48.9    2e-04   
ref|XP_010097434.1|  hypothetical protein L484_003205                 48.5    4e-04   
ref|XP_010042029.1|  PREDICTED: uncharacterized protein LOC104431034  48.1    5e-04   
ref|XP_009371589.1|  PREDICTED: uncharacterized protein LOC103960820  48.1    5e-04   
ref|XP_010654882.1|  PREDICTED: uncharacterized protein LOC100261798  47.8    5e-04   
ref|XP_010039361.1|  PREDICTED: uncharacterized protein LOC104428054  47.8    5e-04   
ref|XP_006368456.1|  hypothetical protein POPTR_0001s02970g           47.8    5e-04   
emb|CDM81475.1|  unnamed protein product                              47.8    6e-04   
ref|XP_010905306.1|  PREDICTED: uncharacterized protein LOC105032542  47.8    6e-04   
gb|EMT11984.1|  hypothetical protein F775_00068                       47.8    6e-04   
gb|EMS65395.1|  hypothetical protein TRIUR3_09082                     47.8    6e-04   
ref|XP_010648157.1|  PREDICTED: uncharacterized protein LOC100255511  47.8    6e-04   
ref|XP_010040125.1|  PREDICTED: uncharacterized protein LOC104428901  47.4    7e-04   
ref|XP_010063782.1|  PREDICTED: uncharacterized protein LOC104450784  47.8    7e-04   
emb|CBI35872.3|  unnamed protein product                              47.8    7e-04   



>ref|XP_010054394.1| PREDICTED: uncharacterized protein LOC104442692 [Eucalyptus grandis]
Length=750

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCE  83
            KN  H +D+++T+CLL GA+ LDAIA+    FSDWTVA I   K+R +
Sbjct  294  KNKFHRVDVRITYCLLYGAIALDAIAIFMAVFSDWTVARIKNIKKRSK  341



>emb|CDP08030.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 8/71 (11%)
 Frame = -2

Query  217  IHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKVCKW  38
            I+H D+ VT+ LL GAV LD +ALI++ FSDWTV  ++L  +R + +      ++ V   
Sbjct  285  INHFDVAVTYILLYGAVGLDLVALIKVIFSDWTV--VVLKNRRVKRI------VSAVRDT  336

Query  37   ISSRRRWSGKM  5
            +SS RRWS  +
Sbjct  337  LSSDRRWSNTI  347



>ref|XP_010644262.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
 ref|XP_010644264.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
Length=735

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 3/78 (4%)
 Frame = -2

Query  229  PKNG-IHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQ-GI  56
            P  G +H  D+ VT+ LL GA+ LD+IA+I+L FSDWT+ L+   + +   LK   +  I
Sbjct  331  PNQGKMHPFDVYVTYALLIGAICLDSIAVIKLIFSDWTIVLLRYRRAKEFLLKTRKRLTI  390

Query  55   NKVCKWISS-RRRWSGKM  5
             ++  W  +  RRWS  M
Sbjct  391  YRIGSWSKTFGRRWSNSM  408



>emb|CBI20386.3| unnamed protein product [Vitis vinifera]
Length=442

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+ IH  D+ VT+ LL GA+ LD IA+++L FSDWT+ L+  S  +  W+    + +   
Sbjct  267  KHKIHKFDIGVTYALLIGAIGLDVIAIVKLIFSDWTIVLLKNSTAK-RWIYYAREKLFFY  325

Query  46   CKWISSR----RRWSGKM  5
              W  S+    RRWS  +
Sbjct  326  KLWEPSKSFFDRRWSNSI  343



>emb|CBI20388.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 11/81 (14%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLS--KQRCEWLKQCAQGIN  53
            K+ IH  D+ VT+ LL GA+ LD IA+++L FSDWT+ L+  S  K+R  + ++      
Sbjct  272  KHKIHKFDIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREKLF---  328

Query  52   KVCK-WISSR----RRWSGKM  5
              CK W +S+    RRWS  +
Sbjct  329  -FCKLWETSKSFLDRRWSNSI  348



>emb|CBI20393.3| unnamed protein product [Vitis vinifera]
Length=643

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  217  IHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQ-GINKVCK  41
            +H  D+ VT+ LL GA+ LD+IA+I+L FSDWT+ L+   + +   LK   +  I ++  
Sbjct  273  MHPFDVYVTYALLIGAICLDSIAVIKLIFSDWTIVLLRYRRAKEFLLKTRKRLTIYRIGS  332

Query  40   WISS-RRRWSGKM  5
            W  +  RRWS  M
Sbjct  333  WSKTFGRRWSNSM  345



>gb|EEC76824.1| hypothetical protein OsI_14965 [Oryza sativa Indica Group]
Length=781

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+G    DL VT+ LLAGA++L+ I+++   FS WTV  + L K +  WL      I +V
Sbjct  447  KHGHSRKDLAVTYVLLAGALLLEMISMVRAVFSTWTV--VFLYKLKWYWLYGEVLSIRRV  504

Query  46   CKWISSRRRWSGKM  5
             + +++ RRWSG +
Sbjct  505  FR-VATHRRWSGTV  517



>ref|XP_010644255.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644256.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644258.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
Length=733

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+ IH  D+ VT+ LL GA+ LD IA+++L FSDWT+ L+  S  +  W+    + +   
Sbjct  320  KHKIHKFDIGVTYALLIGAIGLDVIAIVKLIFSDWTIVLLKNSTAK-RWIYYAREKLFFY  378

Query  46   CKWISSR----RRWSGKM  5
              W  S+    RRWS  +
Sbjct  379  KLWEPSKSFFDRRWSNSI  396



>gb|EEE60550.1| hypothetical protein OsJ_13900 [Oryza sativa Japonica Group]
Length=806

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+G    DL VT+ LLAGA++L+ I+++   FS WTV  + L K +  WL      I +V
Sbjct  572  KHGHSRKDLAVTYVLLAGALLLEMISMVRAVFSTWTV--VFLYKLKWYWLYGEVLSIRRV  629

Query  46   CKWISSRRRWSGKM  5
             + +++ RRWSG +
Sbjct  630  FR-VATHRRWSGTV  642



>ref|XP_010644254.1| PREDICTED: uncharacterized protein LOC100260642 [Vitis vinifera]
Length=721

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 11/81 (14%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLS--KQRCEWLKQCAQGIN  53
            K+ IH  D+ VT+ LL GA+ LD IA+++L FSDWT+ L+  S  K+R  + ++      
Sbjct  320  KHKIHKFDIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREKLF---  376

Query  52   KVCK-WISSR----RRWSGKM  5
              CK W +S+    RRWS  +
Sbjct  377  -FCKLWETSKSFLDRRWSNSI  396



>emb|CAN75530.1| hypothetical protein VITISV_001347 [Vitis vinifera]
Length=730

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 11/81 (14%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLS--KQRCEWLKQCAQGIN  53
            K+ IH  D+ VT+ LL GA+ LD IA+++L FSDWT+ L+  S  K+R  + ++      
Sbjct  320  KHKIHKFDIGVTYALLIGAISLDVIAIVKLIFSDWTIVLLKNSTAKERIYYAREKLF---  376

Query  52   KVCK-WISSR----RRWSGKM  5
              CK W +S+    RRWS  +
Sbjct  377  -FCKLWETSKSFLDRRWSNSI  396



>gb|EMT29784.1| hypothetical protein F775_21169 [Aegilops tauschii]
Length=649

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+G H +D+ VT+ LL GAVIL+  +++   FS WT A +L  +++C WL    +   ++
Sbjct  257  KDGYHRIDVVVTYVLLGGAVILETTSVLRTMFSKWTYAFML--EKKCAWLAPLVRHTRRI  314

Query  46   CK  41
             K
Sbjct  315  HK  316



>ref|XP_008342346.1| PREDICTED: uncharacterized protein LOC103405164 [Malus domestica]
Length=739

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALI  107
            K G+H  D+++T+ LL GA+ LD+IA++ L FSDWT+A +
Sbjct  325  KEGLHSFDVRITYTLLFGAISLDSIAIVMLTFSDWTIAAL  364



>ref|XP_011018639.1| PREDICTED: uncharacterized protein LOC105121611 [Populus euphratica]
Length=727

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = -2

Query  304  ILGYTFRLATiflivaatvffvvfIPKNGIHHLDLKVTHCLLAGAVILDAIALIELFFSD  125
            ++GY FRL +  L++ A   F   + K+    LD+K T+ LL G+V LD IA +   FSD
Sbjct  298  VIGYVFRLLSFILVLVALALFRFNVKKDKFSPLDVKFTYVLLLGSVSLDTIAFVRAIFSD  357

Query  124  WTVA  113
            WTVA
Sbjct  358  WTVA  361



>ref|XP_010068527.1| PREDICTED: uncharacterized protein LOC104455430 [Eucalyptus grandis]
Length=545

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            + G+  LD+K++H +L G +I+D IAL +L FSDWTVA I    +    L      +  +
Sbjct  298  RYGLPELDVKISHIILFGGIIIDGIALFQLIFSDWTVAGIKHPNEGSSKLDAFLYNLVSI  357

Query  46   CKWI  35
              W+
Sbjct  358  MDWL  361



>ref|XP_010097434.1| hypothetical protein L484_003205 [Morus notabilis]
 gb|EXB68164.1| hypothetical protein L484_003205 [Morus notabilis]
Length=785

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K G   L++ +T+ LL GA++LDAI++++L FSDW++A++   K    W    A  I K 
Sbjct  343  KKGFGSLEIILTYALLIGAIVLDAISMMKLVFSDWSLAVVPKEKS---WRGYFAGTILKR  399

Query  46   CKW  38
             KW
Sbjct  400  SKW  402



>ref|XP_010042029.1| PREDICTED: uncharacterized protein LOC104431034 [Eucalyptus grandis]
Length=666

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALI  107
            K+G+  LD+++T+ LL G + LD IAL+ L FSDWTVA I
Sbjct  255  KDGLFELDVEITYSLLFGGIALDVIALLMLIFSDWTVAGI  294



>ref|XP_009371589.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
 ref|XP_009371593.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
Length=739

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALI  107
            K G+H  D+++T+ LL GA+ LD+IA + L FSDWT+A +
Sbjct  325  KEGLHSFDVRITYTLLFGAISLDSIATVMLTFSDWTIAAL  364



>ref|XP_010654882.1| PREDICTED: uncharacterized protein LOC100261798 [Vitis vinifera]
Length=449

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+   ++D+ +T+ LL GA+ L+  A+I L  SDWT+A   LS ++C       + I   
Sbjct  338  KHQFSNIDINITYTLLFGAIFLEIYAIIMLILSDWTIA--WLSSKKCFLTDSICRAITSF  395

Query  46   CKWISSRRRWSGKM  5
               ++S +RW+ +M
Sbjct  396  RSVLTSDKRWTRRM  409



>ref|XP_010039361.1| PREDICTED: uncharacterized protein LOC104428054 [Eucalyptus grandis]
Length=395

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVA  113
            K+ +  LD+KVT+ LL G ++LDAIAL  L FSDWT+A
Sbjct  164  KHQLSKLDVKVTYILLFGGIVLDAIALSMLIFSDWTLA  201



>ref|XP_006368456.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
 gb|ERP65025.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
Length=729

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = -2

Query  304  ILGYTFRLATiflivaatvff--vvfIPKNGIHHLDLKVTHCLLAGAVILDAIALIELFF  131
            ++GY FRL +  L++ A   F  +V   K+  H LD+K T+ LL G+V LD IA +   F
Sbjct  298  VIGYVFRLLSFILVLVALALFRFIVKNKKDTFHPLDVKFTYVLLLGSVSLDTIAFVRAIF  357

Query  130  SDWTVA  113
            SDWTVA
Sbjct  358  SDWTVA  363



>emb|CDM81475.1| unnamed protein product [Triticum aestivum]
 emb|CDM87228.1| unnamed protein product [Triticum aestivum]
Length=651

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            KN  + +D  VT+ L+AGAV+L+ IA+++   S WT A  LL  +R   L      + + 
Sbjct  79   KNDFNRVDAIVTYILIAGAVLLEMIAVLKAMGSTWTCA--LLHARRWHRLHNIVVSVRRC  136

Query  46   CKWISSRRRWSGKM  5
             K     RRWSG +
Sbjct  137  VKAAERNRRWSGSI  150



>ref|XP_010905306.1| PREDICTED: uncharacterized protein LOC105032542 [Elaeis guineensis]
Length=629

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -2

Query  208  LDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKVCKWISS  29
            +D+ +T+ LLAGA++L+  AL+ L  SDWT  ++ L+K      K   +G+  +   + S
Sbjct  243  VDVAITYILLAGALVLEVYALVYLTLSDWT--MVWLTKSANPRTKSIREGVYSLHTRLIS  300

Query  28   RRRWSGKM  5
             +RWSG M
Sbjct  301  GKRWSGSM  308



>gb|EMT11984.1| hypothetical protein F775_00068 [Aegilops tauschii]
Length=921

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 2/74 (3%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            KN  +  D+ VT+ L+AGAV+L+   L++   S WT A  LL  +R +WL      + + 
Sbjct  416  KNDFNRGDVIVTYILIAGAVLLEMAGLLKAMGSTWTCA--LLHARRWQWLHSIVVSVRRR  473

Query  46   CKWISSRRRWSGKM  5
                   RRWSG +
Sbjct  474  VNAAERNRRWSGSI  487



>gb|EMS65395.1| hypothetical protein TRIUR3_09082 [Triticum urartu]
Length=960

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQGINKV  47
            K+  + +D  VT+ L+AGAV+L+  AL++   S WT A  LL   R  WL +    + + 
Sbjct  389  KHDFNRVDAIVTYILIAGAVLLEMTALLKAMGSTWTCA--LLHAGRWHWLHRIIVSVRRR  446

Query  46   CKWISSRRRWSGKM  5
             K     RRWSG +
Sbjct  447  VKAAERNRRWSGSI  460



>ref|XP_010648157.1| PREDICTED: uncharacterized protein LOC100255511 [Vitis vinifera]
Length=759

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = -2

Query  229  PKN--GIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALILLSKQRCEWLKQCAQ-G  59
            P N   +H  D+ VT+ LL GA+ LD+IA+I+L FSDWT+ L+   + +   LK   +  
Sbjct  331  PPNQAKMHPFDVYVTYALLIGAICLDSIAVIKLIFSDWTIVLLRCRRTKEFLLKTRKRLT  390

Query  58   INKVCKWISS-RRRWSGKM  5
            I ++  W  +   RWS  M
Sbjct  391  IYRIGSWSKTFGGRWSNSM  409



>ref|XP_010040125.1| PREDICTED: uncharacterized protein LOC104428901 [Eucalyptus grandis]
Length=476

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVALI  107
            K+G+  LD+++T+ LL G + LD IAL  L FSDWTVA I
Sbjct  64   KDGLFELDVEITYSLLFGGIALDVIALFMLIFSDWTVARI  103



>ref|XP_010063782.1| PREDICTED: uncharacterized protein LOC104450784 [Eucalyptus grandis]
Length=679

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  226  KNGIHHLDLKVTHCLLAGAVILDAIALIELFFSDWTVA  113
            K  +H LD+K+T+ LL G + LD IA++ L FSDWT+A
Sbjct  258  KQQLHKLDVKITYILLFGGITLDVIAVLMLIFSDWTIA  295



>emb|CBI35872.3| unnamed protein product [Vitis vinifera]
Length=1298

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = -2

Query  304  ILGYTFRLATiflivaatvffvvfIPKNGIHHLDLKVTHCLLAGAVILDAIALIELFFSD  125
            +LG   R A+    ++    F  FI ++   ++D+ +T+ LL GA+ L+  A+I L  SD
Sbjct  228  LLGILLRTASFLSTISTLAAFYFFIDRHEFSNIDINITYALLFGAIFLEIYAIIMLILSD  287

Query  124  WTVALILLSKQRCEWLKQCAQGINKVCKWISSRRRWSGKM  5
            W++  + LS ++        + I      ++S +RWSG+M
Sbjct  288  WSI--VWLSSKKNSLTDSICRAITPFRSVLTSDKRWSGRM  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304