BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5230_g2_i1 len=1100 path=[443:0-1099]

Length=1100
                                                                      Score     E

ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    528   0.0      
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    528   0.0      
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    527   0.0      
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    525   0.0      
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    523   0.0      
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    525   0.0      
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    523   0.0      
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    523   0.0      
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    518   1e-180   
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    515   2e-179   
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    514   3e-179   
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    513   1e-178   
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    509   4e-177   
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    509   5e-177   
ref|XP_002517567.1|  conserved hypothetical protein                     496   1e-171   Ricinus communis
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                492   2e-170   
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    489   3e-169   
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    489   5e-169   
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    488   8e-169   Vitis vinifera
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    485   2e-167   
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                483   1e-166   
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    482   2e-166   
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    481   6e-166   
gb|KHN47787.1|  hypothetical protein glysoja_029205                     480   1e-165   
emb|CBI36253.3|  unnamed protein product                                481   2e-165   
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    479   2e-165   
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             478   9e-165   
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    477   1e-164   
emb|CDO98109.1|  unnamed protein product                                474   5e-164   
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    476   8e-164   
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 474   3e-163   
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    474   5e-163   
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    473   5e-163   
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    472   1e-162   
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         472   1e-162   
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             471   7e-162   
gb|KHN44154.1|  hypothetical protein glysoja_031815                     470   1e-161   
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    469   3e-161   
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    468   6e-161   
ref|XP_002515557.1|  conserved hypothetical protein                     467   1e-160   Ricinus communis
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             467   2e-160   Populus trichocarpa [western balsam poplar]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             467   3e-160   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    467   3e-160   
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    466   3e-160   
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             467   3e-160   Populus trichocarpa [western balsam poplar]
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             465   8e-160   
ref|XP_004302947.1|  PREDICTED: uncharacterized protein LOC101306247    465   1e-159   
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    464   4e-159   
ref|XP_010088264.1|  hypothetical protein L484_005140                   464   4e-159   
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    463   4e-159   
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    463   6e-159   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     462   7e-159   
emb|CDO98108.1|  unnamed protein product                                462   1e-158   
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    462   1e-158   
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    462   1e-158   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    464   2e-158   
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    459   2e-157   
gb|AGV54541.1|  hypothetical protein                                    459   2e-157   
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    458   4e-157   
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    458   6e-157   
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    457   6e-157   
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    457   7e-157   
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    457   8e-157   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         457   1e-156   
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    457   1e-156   
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             456   2e-156   
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    454   6e-156   
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    455   7e-156   
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    455   8e-156   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    455   8e-156   
gb|KHG29602.1|  Allergen Act d 3                                        455   8e-156   
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    455   9e-156   
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    455   9e-156   
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             454   1e-155   
ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    454   1e-155   
gb|AAB41813.1|  unknown protein                                         454   2e-155   Medicago sativa [alfalfa]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             454   3e-155   
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    454   3e-155   
emb|CDX91217.1|  BnaC02g03800D                                          452   7e-155   
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    452   1e-154   
gb|ABK94923.1|  unknown                                                 451   2e-154   Populus trichocarpa [western balsam poplar]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    451   2e-154   
emb|CDX85713.1|  BnaA02g01000D                                          450   5e-154   
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             452   7e-154   Populus trichocarpa [western balsam poplar]
gb|KHG10708.1|  Allergen Act d 3                                        450   7e-154   
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             450   7e-154   
ref|NP_196703.1|  uncharacterized protein                               449   9e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    449   9e-154   
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    449   1e-153   
gb|AAM63507.1|  unknown                                                 449   1e-153   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06895.1|  Agmatine deiminase                                      449   1e-153   
gb|AAN31807.1|  unknown protein                                         449   2e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    449   3e-153   
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  448   4e-153   
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    449   4e-153   
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    447   6e-153   
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    447   1e-152   
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  448   1e-152   
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    447   1e-152   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  444   3e-152   
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  446   5e-152   
gb|AES58962.2|  plant/F18G18-200 protein                                445   7e-152   
gb|ACJ84308.1|  unknown                                                 444   1e-151   Medicago truncatula
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               444   2e-151   
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    443   3e-151   
emb|CDX97108.1|  BnaC09g45170D                                          443   3e-151   
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             444   6e-151   Populus trichocarpa [western balsam poplar]
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    442   8e-151   
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    442   1e-150   
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             441   1e-150   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    441   1e-150   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     441   2e-150   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98407.1|  hypothetical protein                                   441   3e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68849.1|  BnaC01g06040D                                          441   3e-150   
ref|NP_567894.1|  uncharacterized protein                               440   5e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    439   8e-150   
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             439   9e-150   
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    439   1e-149   
gb|AAM61720.1|  unknown                                                 439   2e-149   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    439   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    438   3e-149   
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    438   3e-149   
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    438   5e-149   
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             437   5e-149   
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    437   6e-149   
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    437   8e-149   
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    437   1e-148   
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    437   1e-148   
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    436   1e-148   
emb|CDP04798.1|  unnamed protein product                                436   3e-148   
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             434   8e-148   
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    434   9e-148   
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    434   1e-147   
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    434   2e-147   
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             434   2e-147   
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    431   3e-147   
emb|CDY19801.1|  BnaA09g04540D                                          432   8e-147   
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    432   9e-147   
emb|CDY54909.1|  BnaC02g48660D                                          430   2e-146   
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    431   3e-146   
gb|KHG21630.1|  Adenosylhomocysteinase                                  430   5e-146   
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    429   9e-146   
dbj|BAK03126.1|  predicted protein                                      424   2e-143   
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    422   5e-143   
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          422   6e-143   Sorghum bicolor [broomcorn]
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    420   8e-143   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    421   1e-142   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          422   1e-142   Sorghum bicolor [broomcorn]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               420   1e-142   
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             419   5e-142   
ref|XP_010110340.1|  GTP-binding nuclear protein                        427   9e-142   
dbj|BAB21293.1|  unknown protein                                        418   3e-141   Oryza sativa Japonica Group [Japonica rice]
emb|CDX69757.1|  BnaA10g21060D                                          444   4e-141   
ref|NP_001043549.2|  Os01g0611000                                       418   7e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    417   8e-141   
ref|NP_001140426.1|  hypothetical protein precursor                     416   1e-140   Zea mays [maize]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    415   7e-140   
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     414   1e-139   
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    414   1e-139   
gb|EMT06486.1|  hypothetical protein F775_26416                         413   2e-139   
dbj|BAK03627.1|  predicted protein                                      412   6e-139   
gb|KHN07098.1|  hypothetical protein glysoja_023281                     409   4e-138   
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             408   5e-138   
gb|EPS73289.1|  hypothetical protein M569_01466                         409   5e-138   
emb|CAA22573.1|  putative protein                                       408   5e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             408   3e-137   
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  405   6e-137   
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          405   9e-137   
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    407   1e-136   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    405   2e-136   
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    405   5e-136   
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    404   5e-136   
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               402   4e-135   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57694.1|  BnaA07g38340D                                          402   4e-135   
emb|CDY54317.1|  BnaC06g43150D                                          402   4e-135   
gb|KHN07099.1|  hypothetical protein glysoja_023282                     400   2e-134   
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             400   2e-134   
gb|EEE56530.1|  hypothetical protein OsJ_05823                          399   7e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72709.1|  hypothetical protein OsI_06304                          399   9e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         397   5e-133   
gb|ACG40327.1|  hypothetical protein                                    397   5e-133   Zea mays [maize]
emb|CAH67378.1|  OSIGBa0159F11.2                                        397   6e-133   Oryza sativa [red rice]
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    393   2e-131   
ref|NP_001145978.1|  hypothetical protein                               394   3e-131   Zea mays [maize]
emb|CAE01677.2|  OSJNBb0091E11.19                                       388   1e-129   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046247.2|  Os02g0205200                                       387   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    388   2e-129   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    387   4e-129   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             387   4e-129   
emb|CAE01676.2|  OSJNBb0091E11.17                                       386   1e-128   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053189.1|  Os04g0494800                                       386   2e-128   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94676.1|  hypothetical protein OsI_16455                          385   2e-128   Oryza sativa Indica Group [Indian rice]
ref|NP_001053188.1|  Os04g0494600                                       384   5e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67292.1|  OSIGBa0103O01.10                                       382   3e-127   Oryza sativa [red rice]
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    381   9e-127   
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            378   9e-127   
gb|EMT04285.1|  hypothetical protein F775_14657                         379   5e-126   
gb|KHG21629.1|  GTPase Der                                              376   1e-125   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              376   7e-125   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       375   2e-124   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    373   2e-123   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          372   3e-123   Sorghum bicolor [broomcorn]
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          372   4e-123   Sorghum bicolor [broomcorn]
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    370   2e-122   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    370   2e-122   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    369   4e-122   
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    369   4e-122   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    369   6e-122   
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          369   7e-122   
gb|EAY74932.1|  hypothetical protein OsI_02826                          367   1e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    367   2e-121   
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    367   2e-121   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    368   3e-121   
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    367   3e-121   
dbj|BAD52536.1|  unknown protein                                        364   5e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    366   5e-121   
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    366   6e-121   
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    365   9e-121   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    365   1e-120   
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    365   1e-120   
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    365   2e-120   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    365   2e-120   
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             364   2e-120   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    365   3e-120   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    364   3e-120   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    364   4e-120   
ref|XP_002517797.1|  conserved hypothetical protein                     364   4e-120   Ricinus communis
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    363   5e-120   
gb|ACU17881.1|  unknown                                                 360   6e-120   Glycine max [soybeans]
emb|CDP07813.1|  unnamed protein product                                363   7e-120   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    363   8e-120   
emb|CAD41548.2|  OSJNBb0091E11.18                                       363   1e-119   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67377.1|  OSIGBa0159F11.1                                        363   1e-119   Oryza sativa [red rice]
ref|NP_001053190.1|  Os04g0494900                                       363   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    362   2e-119   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             362   2e-119   
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    362   3e-119   
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    362   3e-119   
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          362   4e-119   Sorghum bicolor [broomcorn]
gb|EMT16005.1|  hypothetical protein F775_13621                         360   6e-119   
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    364   7e-119   
ref|NP_001141282.1|  hypothetical protein precursor                     361   8e-119   Zea mays [maize]
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    360   2e-118   
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    360   2e-118   
emb|CDY39990.1|  BnaC06g40680D                                          358   4e-118   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          358   6e-118   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              358   9e-118   
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       357   1e-117   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    358   1e-117   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    357   2e-117   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         357   2e-117   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    357   3e-117   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          357   3e-117   Sorghum bicolor [broomcorn]
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             357   4e-117   
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             356   6e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    356   6e-117   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    362   1e-116   
dbj|BAJ96954.1|  predicted protein                                      355   1e-116   
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    355   1e-116   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    355   2e-116   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    354   2e-116   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    354   4e-116   
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   353   5e-116   
ref|XP_002532070.1|  conserved hypothetical protein                     353   5e-116   Ricinus communis
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                353   7e-116   
ref|XP_007052493.1|  F17A17.37 protein                                  353   7e-116   
emb|CDY28002.1|  BnaC05g44040D                                          352   2e-115   
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    352   2e-115   
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    352   2e-115   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             352   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    352   3e-115   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    352   4e-115   Vitis vinifera
emb|CDX87297.1|  BnaA07g35760D                                          350   4e-115   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             351   6e-115   Populus trichocarpa [western balsam poplar]
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    350   7e-115   
dbj|BAJ97095.1|  predicted protein                                      350   9e-115   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             350   1e-114   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    349   2e-114   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    349   4e-114   
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    348   7e-114   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    347   1e-113   
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    347   2e-113   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             347   2e-113   
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    347   2e-113   
ref|NP_566328.1|  germination-related protein                           347   3e-113   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    346   3e-113   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    345   5e-113   
gb|AES87990.2|  DUF642 family protein                                   346   5e-113   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             345   7e-113   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  345   8e-113   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    345   9e-113   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          345   1e-112   
gb|EPS66311.1|  hypothetical protein M569_08463                         343   2e-112   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    343   3e-112   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             343   4e-112   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    343   5e-112   
emb|CBI20999.3|  unnamed protein product                                338   7e-112   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             343   8e-112   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    343   8e-112   
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              343   1e-111   
emb|CDY22149.1|  BnaC01g39520D                                          342   1e-111   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             342   2e-111   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             341   3e-111   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    341   3e-111   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    341   4e-111   
gb|EAY94679.1|  hypothetical protein OsI_16458                          340   1e-110   
ref|NP_001053191.2|  Os04g0495000                                       340   1e-110   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    340   1e-110   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    339   2e-110   
emb|CDX79912.1|  BnaA05g02440D                                          342   2e-110   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    339   2e-110   
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       338   4e-110   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    337   9e-110   
ref|NP_181712.1|  uncharacterized protein                               337   9e-110   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             337   1e-109   
gb|KHN11697.1|  hypothetical protein glysoja_006150                     337   2e-109   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     347   2e-109   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    336   3e-109   
ref|XP_007028767.1|  F17A17.37 protein                                  336   3e-109   
ref|NP_181711.1|  uncharacterized protein                               336   4e-109   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                336   5e-109   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    335   9e-109   
gb|KEH17090.1|  DUF642 family protein                                   335   9e-109   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    335   1e-108   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    335   1e-108   
emb|CDY48765.1|  BnaC04g02180D                                          337   2e-108   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    334   2e-108   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             334   3e-108   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    334   3e-108   
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  333   3e-108   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             333   3e-108   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    333   4e-108   
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    333   7e-108   
gb|AFK39561.1|  unknown                                                 332   8e-108   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  332   8e-108   
gb|AFK39148.1|  unknown                                                 332   1e-107   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             330   1e-107   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    332   2e-107   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    331   3e-107   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    331   4e-107   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    330   6e-107   
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     330   6e-107   
gb|AFK34548.1|  unknown                                                 330   7e-107   
ref|NP_974254.1|  germination-related protein                           328   7e-107   
emb|CDY06908.1|  BnaA04g24070D                                          330   8e-107   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    330   8e-107   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             330   1e-106   
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             330   1e-106   
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    330   1e-106   
gb|AGV54808.1|  hypothetical protein                                    330   1e-106   
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    330   1e-106   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    329   1e-106   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          337   2e-106   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    329   2e-106   
ref|XP_010097437.1|  hypothetical protein L484_003208                   329   2e-106   
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              329   3e-106   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         328   3e-106   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          329   4e-106   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    328   6e-106   
gb|KHG07966.1|  Imidazolonepropionase                                   328   6e-106   
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     328   7e-106   
dbj|BAD16016.1|  unknown protein                                        324   1e-105   
emb|CDY14785.1|  BnaC04g47820D                                          326   3e-105   
gb|KHN45084.1|  hypothetical protein glysoja_040000                     325   7e-105   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    325   1e-104   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    325   2e-104   
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     323   2e-104   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    323   3e-104   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             324   3e-104   
dbj|BAJ89665.1|  predicted protein                                      323   8e-104   
gb|EMT25156.1|  hypothetical protein F775_26385                         323   1e-103   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    321   2e-103   
emb|CDP21696.1|  unnamed protein product                                321   3e-103   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             320   3e-103   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    322   3e-103   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             322   4e-103   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    320   5e-103   
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                317   7e-103   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    320   1e-102   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    319   1e-102   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    320   1e-102   
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   316   2e-102   
ref|NP_001051644.1|  Os03g0807700                                       319   3e-102   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    319   3e-102   
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             315   4e-102   
gb|EAY92272.1|  hypothetical protein OsI_13995                          316   2e-101   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            316   4e-101   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    316   4e-101   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    315   6e-101   
ref|XP_003581665.1|  PREDICTED: uncharacterized protein LOC100833550    315   1e-100   
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    315   1e-100   
emb|CDP19178.1|  unnamed protein product                                315   1e-100   
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    314   2e-100   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    314   2e-100   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    313   4e-100   
gb|EMT25742.1|  hypothetical protein F775_05959                         313   5e-100   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    313   6e-100   
gb|ABK24630.1|  unknown                                                 313   7e-100   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             312   8e-100   
dbj|BAJ94417.1|  predicted protein                                      312   1e-99    
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    313   1e-99    
gb|AGV54847.1|  hypothetical protein                                    312   1e-99    
gb|EMS51275.1|  hypothetical protein TRIUR3_06876                       311   2e-99    
gb|AFK48735.1|  unknown                                                 311   3e-99    
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    311   4e-99    
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    311   4e-99    
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  310   4e-99    
gb|ACN40837.1|  unknown                                                 311   4e-99    
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             311   5e-99    
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          310   8e-99    
ref|XP_010508665.1|  PREDICTED: uncharacterized protein LOC104785...    308   1e-98    
gb|AGV54803.1|  hypothetical protein                                    310   1e-98    
ref|NP_180998.1|  uncharacterized protein                               310   1e-98    
emb|CDY17255.1|  BnaA05g09330D                                          310   1e-98    
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    310   1e-98    
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    309   2e-98    
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             310   2e-98    
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         309   2e-98    
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    308   7e-98    
gb|EMT04284.1|  hypothetical protein F775_14656                         306   8e-98    
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             308   9e-98    
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    307   1e-97    
emb|CDX84311.1|  BnaC04g10730D                                          308   1e-97    
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    306   3e-97    
ref|XP_003581384.1|  PREDICTED: uncharacterized protein LOC100823957    305   7e-97    
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          305   8e-97    
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    305   9e-97    
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                305   9e-97    
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    305   1e-96    
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    304   4e-96    
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    303   5e-96    
ref|XP_003580050.1|  PREDICTED: uncharacterized protein LOC100841598    302   7e-96    
gb|EMS51358.1|  hypothetical protein TRIUR3_26274                       300   1e-95    
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    302   1e-95    
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             302   2e-95    
ref|XP_002519690.1|  conserved hypothetical protein                     302   2e-95    
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    301   2e-95    
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    301   5e-95    
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 303   5e-95    
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    301   6e-95    
emb|CDM84231.1|  unnamed protein product                                300   7e-95    
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             300   8e-95    
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    300   9e-95    
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    300   1e-94    
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                300   1e-94    
emb|CBI30867.3|  unnamed protein product                                299   1e-94    
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             300   1e-94    
ref|NP_564344.1|  uncharacterized protein                               299   2e-94    
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             299   3e-94    
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    298   4e-94    
ref|XP_002893594.1|  predicted protein                                  297   5e-94    
ref|NP_001044289.1|  Os01g0756600                                       298   6e-94    
emb|CDY26302.1|  BnaA09g26530D                                          298   6e-94    
ref|NP_973938.1|  uncharacterized protein                               297   7e-94    
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    298   8e-94    
gb|KHN47316.1|  hypothetical protein glysoja_020184                     296   2e-93    
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    296   2e-93    
ref|XP_010665821.1|  PREDICTED: uncharacterized protein LOC104883071    296   2e-93    
gb|ACF86181.1|  unknown                                                 295   5e-93    
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    295   7e-93    
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    295   8e-93    
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    295   9e-93    
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          295   1e-92    
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  294   2e-92    
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    294   3e-92    
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       292   3e-92    
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              295   3e-92    
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    293   4e-92    
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    293   4e-92    
gb|ABF99456.1|  expressed protein                                       290   5e-92    
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    292   1e-91    
gb|EMT19274.1|  hypothetical protein F775_14136                         291   2e-91    
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    293   3e-91    
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    291   4e-91    
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    291   4e-91    
gb|AFK48067.1|  unknown                                                 284   4e-91    
gb|KHG28355.1|  putative metabolite transport                           290   7e-91    
gb|AFK49395.1|  unknown                                                 290   7e-91    
gb|EEC71507.1|  hypothetical protein OsI_03789                          294   1e-90    
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    288   3e-90    
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    288   3e-90    
gb|EMS50963.1|  hypothetical protein TRIUR3_30516                       293   3e-90    
ref|XP_008439641.1|  PREDICTED: uncharacterized protein LOC103484373    288   4e-90    
gb|KHG06200.1|  Periplasmic nitrate reductase                           288   4e-90    
gb|EPS66859.1|  hypothetical protein M569_07917                         288   4e-90    
dbj|BAD93856.1|  hypothetical protein                                   281   6e-90    
gb|ACG32132.1|  hypothetical protein                                    287   1e-89    
ref|NP_001143645.1|  hypothetical protein precursor                     287   1e-89    
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    293   1e-89    
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    286   2e-89    
gb|KHN32410.1|  hypothetical protein glysoja_026304                     283   2e-89    
ref|XP_010110985.1|  hypothetical protein L484_021680                   287   4e-89    
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    284   2e-88    
gb|ACN30906.1|  unknown                                                 283   4e-88    
ref|XP_003581666.1|  PREDICTED: uncharacterized protein LOC100833858    282   8e-88    
gb|KHN33140.1|  La-related protein 7                                    288   3e-86    
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       263   2e-81    
emb|CDX99870.1|  BnaC05g22920D                                          265   3e-81    
ref|NP_001143445.1|  uncharacterized protein LOC100276100               260   2e-80    
gb|ABR13280.1|  unknown protein                                         254   5e-80    



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 291/347 (84%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K    ++ LC   HV  C    DG++PNGNFE GPKPSQMKG++V++ H IP W IS 
Sbjct  1     MKKAAIFLVLLCATIHV--CSSQKDGILPNGNFELGPKPSQMKGTKVVNRHAIPNWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+ QG+M+L VP G +AVRLGEDASI T V+V KG +YSLSF F RTCAQEE
Sbjct  58    GYVEYIKSGQTQGDMLLPVPVGDYAVRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSEPNDWG+LP+QTMYSS G+D+YSW FLAE+N + +V+HNPA EKDP+CGP
Sbjct  118   KLNVSVSPNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDVVIHNPAVEKDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +ID VALK L  P+R +GNMLKNG+FEEGPYI PNTTWGVLIPPNIEDDHSPL GW+IES
Sbjct  178   LIDFVALKALKTPKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYID+ HF VP G RAVELVAGRESA+ Q+VRT PGKVY+L+FS+GDA+NSCEGSM
Sbjct  238   LKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEAFAG++T+Q PY+SKGKGG  R+  RFTA+S RTR+RFLS++YH
Sbjct  298   LVEAFAGKITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYH  344



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/347 (72%), Positives = 292/347 (84%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K  A++L L  +F         DGL+ NGNFE GPKPSQMKG++V+D H IP W IS 
Sbjct  1     MKKAAAILLVL--LFATVANSSQKDGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+ QG+M+L VPQG +AVRLGEDASI T V+V KG +YS+SF F RTCAQEE
Sbjct  58    GYVEYIKSGQTQGDMLLPVPQGDYAVRLGEDASIKTKVKVTKGIFYSISFVFARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSEPNDWG+LPLQTMYSS G+D+YSW FLAE++ + IV+HNPA EKDP+CGP
Sbjct  118   KLNVSVSPNSEPNDWGMLPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAVEKDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +ID VALK L  P+R RGNMLKNG+FEEGPYI PNTTWGVLIPPNIEDDHSPL GW+IES
Sbjct  178   LIDFVALKALKTPKRPRGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G RAVELVAGRESA+ Q+VRT PGK+Y+L+FS+GDA+NSCEGSM
Sbjct  238   LKAVKYIDSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASNSCEGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEAFAG++T+Q PY+SKGKGGF RA  RFTA+S RTR+RFLS++YH
Sbjct  298   LVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYH  344



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 290/347 (84%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K     + LC   H+G  +   DG++PNGNFE GPK SQMKG++V+D H IP W IS 
Sbjct  1     MKKTAIFFVLLCATTHIGSSQ--KDGILPNGNFELGPKASQMKGTKVVDRHAIPDWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+ QG+M+L VP G +AVRLGEDASI T V+V KG +YSLSF F RTCAQEE
Sbjct  58    GYVEYIKSGQTQGDMLLPVPVGDYAVRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSEPNDWG+LP+QTMYSS G+D+YSW FLAE+N + +V+HNP  EKDP+CGP
Sbjct  118   KLNVSVSPNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDVVIHNPVVEKDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +ID VALK L  P+R +GNMLKNG+FEEGPYI PNTTWGVLIPPNIEDDHSPL GW+IES
Sbjct  178   LIDFVALKALKTPKRPKGNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYID+ HF VP G RAVELVAGRESA+ Q+VRT PGKVY+L+FS+GDA+NSCEGSM
Sbjct  238   LKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEAFAG++T+Q PY+SKGKGGF RA  RFTA+S RTR+RFLS++YH
Sbjct  298   LVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYH  344



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/349 (71%), Positives = 287/349 (82%), Gaps = 4/349 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             KM K   +++ LC    V  C  + DGL+PNGNFE+GPKPSQMK +RV+DPH IP W +S
Sbjct  6     KMKKAATVLVLLCATLQV--CSSLIDGLLPNGNFEQGPKPSQMKHTRVMDPHAIPHWELS  63

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITT-TVRVIKGGYYSLSFTFVRTCAQ  688
              G+VEYIKSG+ QG+M+L VPQG  AVRLGEDAS+ T  V V KG +Y+LSF F RTCAQ
Sbjct  64    -GYVEYIKSGQMQGDMLLPVPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQ  122

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EERLNVSV+P+ EP DWG+LPLQTMYSS G+DTYSW FLAE+N V+IVLHNPAREKDP+C
Sbjct  123   EERLNVSVTPSKEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANVVEIVLHNPAREKDPAC  182

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP+ID VALK L  P R +GNMLKNG+FEEGPYI PNT WG+LIPPNIEDDH PLPGWII
Sbjct  183   GPLIDFVALKALKTPHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWII  242

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVKYID+ HF VP G RAVELVAGRESA+ Q V T  GK+Y+L+F+VGDANNSCEG
Sbjct  243   ESLKAVKYIDTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEG  302

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM +EAFAG++ LQVPY SKGKGGF RA  RFTA+S RTR+RFLS+ YH
Sbjct  303   SMLIEAFAGKVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYH  351



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   523 bits (1348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/351 (70%), Positives = 293/351 (83%), Gaps = 6/351 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKKM  L  ++LF      + +   + DGL+PNGNFE+GPK SQMKG++V DPH IP W 
Sbjct  3     MKKMGILNIVLLFAT----INVALSVQDGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWE  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVRTC  694
             IS G+VEYI+SG+ QG+M+L VP+G+ AVRLGEDASI T V  V  G +YSLSF F RTC
Sbjct  59    IS-GYVEYIRSGQTQGDMLLPVPEGAFAVRLGEDASIKTRVTNVTSGSFYSLSFNFARTC  117

Query  693   AQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDP  514
             AQEE+LNVSVSPN+EPNDWG+LP+QTMYSS G+D+YSW FLA++N ++I LHNPA EKDP
Sbjct  118   AQEEKLNVSVSPNTEPNDWGMLPMQTMYSSDGWDSYSWGFLAQANEIEITLHNPAVEKDP  177

Query  513   SCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW  334
             +CGP+ID +ALK L  P R RGNMLKNG+FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW
Sbjct  178   ACGPLIDFIALKALKNPHRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGW  237

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             +IESLKAVKYID+ HF VP G RA+ELVAGRESA+ QIVRT  GKVY+LMFSVGDA+NSC
Sbjct  238   MIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSC  297

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             +GSM +EAFAG++TL+VPY+S GKGGF RA  RFTAV+ RTR+RFLS++YH
Sbjct  298   QGSMLIEAFAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYH  348



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/350 (71%), Positives = 294/350 (84%), Gaps = 4/350 (1%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKK+   T L+L L + F + LC  +TDGL+PNGNFE GPKPSQMKG++VIDPH IP W 
Sbjct  28    MKKVNIFT-LLLVLFSTFTIALC--LTDGLLPNGNFEYGPKPSQMKGTKVIDPHAIPSWE  84

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI SG KQG+M+LVVP+G+ AVRLG++ASI T V+V  G +YSLSF+  RTCA
Sbjct  85    IS-GFVEYITSGHKQGDMLLVVPEGASAVRLGDEASIKTKVKVTNGMFYSLSFSAARTCA  143

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE+LNVSV PN E  DWGILP+QT+YSS G+D+YSW FLA+SN ++I++HNP +EKDP+
Sbjct  144   QEEKLNVSVLPNKESKDWGILPIQTVYSSDGWDSYSWGFLAQSNDIEIMIHNPGKEKDPA  203

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+ALK L  P+R RGN+LKNG+FEEGPYI PNT++G+LIPPNIEDDHSPLPGW+
Sbjct  204   CGPLIDSIALKALPNPKRQRGNILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSPLPGWM  263

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKY+DSNHF VP G RAVELVAGRESA+ Q VRT+PGK Y L+FS+GDA NSCE
Sbjct  264   IESLKAVKYVDSNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKNSCE  323

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEA AGR  LQVPY+SKG GGF RA  RF AVS+RTR+RFLS+FYH
Sbjct  324   GSMTVEANAGRDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYH  373


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 81/185 (44%), Gaps = 30/185 (16%)
 Frame = -3

Query  963  LVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQGEMVLV  808
            ++ NGNFE GP   P+   G      + D H  +P W+I S   V+Y+ S          
Sbjct  226  ILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSPLPGWMIESLKAVKYVDSNH------FA  279

Query  807  VPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWG  634
            VP+G  AV L  G ++++  TVR + G  Y+L F+ +         +++V  N+     G
Sbjct  280  VPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFS-IGDAKNSCEGSMTVEANA-----G  333

Query  633  ILPLQTMYSSTG---FDTYSWAFLAESNRVQI-----VLHNPAREKDPSCGPIIDSVALK  478
               LQ  Y S G   F      F A S+R ++       H  +      CGPIID V L 
Sbjct  334  RDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSGSLCGPIIDDVRLV  393

Query  477  LLNAP  463
             +  P
Sbjct  394  SIRYP  398



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 292/350 (83%), Gaps = 7/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKK   L  LVL   T+ +        DGL+ NGNFE GPKPSQMKG++V+D H IP W 
Sbjct  1     MKKAAIL--LVLLFATVANSSQ----KDGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWE  54

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS G+VEYIKSG+ QG+M+L VPQG +AVRLGEDASI T V++ KG +YS+SF F RTCA
Sbjct  55    IS-GYVEYIKSGQTQGDMLLPVPQGDYAVRLGEDASIKTKVKLTKGVFYSISFVFARTCA  113

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE+LNVSVSPNSEPNDWGILPLQTMYSS G+D+YSW FLAE++ + IV+HNPA EKDP+
Sbjct  114   QEEKLNVSVSPNSEPNDWGILPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAVEKDPA  173

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VALK L  P+R RGNMLKNG+FE GPYI PNTTWGVLIPPNIEDDHSPL GW+
Sbjct  174   CGPLIDFVALKALKTPKRPRGNMLKNGNFEVGPYIFPNTTWGVLIPPNIEDDHSPLLGWM  233

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKYIDS HF VP G RAVELVAGRESA+ Q+VRT PGK+Y+L+FS+GDA+NSCE
Sbjct  234   IESLKAVKYIDSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASNSCE  293

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFAG++T+Q PY+SKGKGGF RA  RFTA+S RTR+RFLS++YH
Sbjct  294   GSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYH  343



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/349 (70%), Positives = 291/349 (83%), Gaps = 4/349 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             KM K   L++ LC    V L   + DGL+PNGNFE+GPKPSQ+KG+RV +PH IP W IS
Sbjct  2     KMKKTAILIVLLCATISVVLS--VNDGLLPNGNFEQGPKPSQLKGTRVTNPHAIPHWEIS  59

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVRTCAQ  688
              G+VEYIKSG+ QG+M+L VP+G+ AVRLGEDASI T +    KG +YSLSF F RTCAQ
Sbjct  60    -GYVEYIKSGQTQGDMLLPVPEGAFAVRLGEDASIKTRITNFTKGTFYSLSFNFARTCAQ  118

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EE+LNVSVSPNSEPNDWG+LP+QTMYSS G+D+YSW FLAE+N + I+LHNPA EKDP+C
Sbjct  119   EEKLNVSVSPNSEPNDWGMLPMQTMYSSDGWDSYSWGFLAEANEIDIMLHNPAIEKDPAC  178

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP+ID +ALK L  P R +GNMLKNG+FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+I
Sbjct  179   GPLIDFIALKALKNPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMI  238

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVKYID+ HF VP G RA+ELVAGRESA+ Q+V T  GKVY+LMFSVGDA+NSC+G
Sbjct  239   ESLKAVKYIDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASNSCQG  298

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM +EAFAG++TL+VPY+SKG GGF RA  RF AVS RTR+RFLS++YH
Sbjct  299   SMLIEAFAGQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYH  347



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   518 bits (1335),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 242/349 (69%), Positives = 291/349 (83%), Gaps = 4/349 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             KM K   L++ LC   +V L   + DGL+PNGNFE+GPKPSQ+KG++V +PH IP W IS
Sbjct  2     KMKKTAILIVLLCATINVVLS--VDDGLLPNGNFEQGPKPSQLKGTKVTEPHAIPHWEIS  59

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVRTCAQ  688
              G+VEYIKSG+ QG+M+L VP+G+ AVRLGEDASI T +  V KG +YSLSF F RTCAQ
Sbjct  60    -GYVEYIKSGQTQGDMLLPVPEGAFAVRLGEDASIKTRITNVTKGTFYSLSFNFARTCAQ  118

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EE+LNVSVSPN+EPNDWG+LP+QTMYSS G+D+YSW FLA++  + I+LHNPA EKDP+C
Sbjct  119   EEKLNVSVSPNNEPNDWGMLPMQTMYSSDGWDSYSWGFLAQATEIDIMLHNPAVEKDPAC  178

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP+ID +ALK L  P R +GNMLKNG+FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+I
Sbjct  179   GPLIDYIALKALKNPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMI  238

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVKYID+ HF VP G RA+ELVAGRESA+ Q V T  GKVY+LMFSVGDA+NSC+G
Sbjct  239   ESLKAVKYIDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASNSCQG  298

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM +EAFAG++TL+VPY+SKG GGF RA  RF AVS RTR+RFLS++YH
Sbjct  299   SMLIEAFAGQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYH  347



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   515 bits (1327),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 248/354 (70%), Positives = 285/354 (81%), Gaps = 5/354 (1%)
 Frame = -3

Query  1056  EYMKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPK  877
             E   KM K+  +++ LC    +G    + DGL+PNGNFE+GPKPSQMK +RVIDPHGIP 
Sbjct  2     EEAMKMKKVVLVLMILCASLQIGSS--LIDGLLPNGNFEQGPKPSQMKKTRVIDPHGIPH  59

Query  876   WVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVR  700
             W +S G+VEYIKSG+ QG+M+L VPQG +AVRLGEDAS+ T V  V K  +YSLSF F R
Sbjct  60    WELS-GYVEYIKSGQMQGDMLLPVPQGDYAVRLGEDASLKTKVINVTKETFYSLSFVFAR  118

Query  699   TCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP-ARE  523
             TCAQEERLNVSVSPNSEP DWG+LPLQTMYSS G+DTYSW FLAE+N + IVLHNP A E
Sbjct  119   TCAQEERLNVSVSPNSEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNPIAHE  178

Query  522   KDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPL  343
             KDP+CGP+ID VALK L    R + NMLKNG+FEEGPYI PNTTWGVLIPPNIEDDH PL
Sbjct  179   KDPACGPLIDFVALKALKTTHRPKDNMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHCPL  238

Query  342   PGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDAN  163
             PGWI+ESLKAVKY+D++HF VP G RA+ELVAGRESA+ Q V T  G++Y+L FSVGDAN
Sbjct  239   PGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDAN  298

Query  162   NSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             NSCEGSM VEAFAG + LQ  Y SKGKGGF RA  RFTA S RTR+RFLSS+YH
Sbjct  299   NSCEGSMVVEAFAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYH  352



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   514 bits (1325),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 244/350 (70%), Positives = 291/350 (83%), Gaps = 8/350 (2%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M KL  +V+ LC  FH+     + DG +PNGNFE GPKPSQMKG++V+DPH IP W  +S
Sbjct  1     MKKL--IVVLLCATFHIAFS--LIDGQLPNGNFEFGPKPSQMKGTKVMDPHSIPHWE-TS  55

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIKSG+KQG+M+LVVP+G+ AVRLG++ASI T V+V  G +YS+SF+  RTCAQEE
Sbjct  56    GFVEYIKSGQKQGDMLLVVPEGASAVRLGDEASIKTKVKVKNGLFYSVSFSAARTCAQEE  115

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSE  DWGILP+QT+YSS G+D+Y W FLA+SN ++IV+HNP  EKD +CGP
Sbjct  116   KLNVSVSPNSESMDWGILPMQTVYSSDGWDSYCWGFLAQSNEIEIVIHNPGVEKDKACGP  175

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALK L  P+R RGNMLKNG+FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+IES
Sbjct  176   LIDSVALKALYTPKRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIES  235

Query  321   LKAVKYIDSNHFLVPSGTRAVELVA---GRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             LKAVKYIDS+HF VP G RAVELVA   GRE A+ Q VRT+PGK Y+L+FS+GDA NSCE
Sbjct  236   LKAVKYIDSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGDAKNSCE  295

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEA AG++ LQVPY+SKG GGF RA  RF A+STRTRIRFLS++YH
Sbjct  296   GSMMVEATAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYH  345



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   513 bits (1321),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 242/345 (70%), Positives = 289/345 (84%), Gaps = 5/345 (1%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             L  +VL   TI +V L   + DGL+PNGNFE+GPK SQMKG++V DPH IP W IS G+V
Sbjct  3     LLNIVLLFATI-NVALS--VQDGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEIS-GYV  58

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVRTCAQEERL  676
             EYIK+G+ QG+M+L VP+G+ AVRLGEDA I T V  V  G +YSLSF F RTCAQEE+L
Sbjct  59    EYIKAGQTQGDMLLPVPEGAFAVRLGEDAYIKTRVTNVTNGTFYSLSFNFARTCAQEEKL  118

Query  675   NVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPII  496
             NVSVSPN+EPNDW +LP+QTMYSS G+D+YSW FLA++N ++I+LHNPA EKDP+CGP+I
Sbjct  119   NVSVSPNNEPNDWAMLPMQTMYSSDGWDSYSWGFLAQANEIEIMLHNPAVEKDPACGPLI  178

Query  495   DSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLK  316
             D +ALK L  P R +GNMLKNG+FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+IESLK
Sbjct  179   DFIALKALKTPHRPKGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLK  238

Query  315   AVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGV  136
             AVKYID+ HF VP G RA+ELVAGRESA+ QIVRT  GKVY+LMFSVGDA+NSC+GSM +
Sbjct  239   AVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLI  298

Query  135   EAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             EAFAG +TL+VPY+S GKGGF RA  RFTAV+ RTR+RFLS++YH
Sbjct  299   EAFAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYH  343



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   509 bits (1312),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 243/349 (70%), Positives = 283/349 (81%), Gaps = 4/349 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             KM K   L++ LC    VG    + DGL+PNGNFE+GPKPSQMK + VI+PH IP W +S
Sbjct  6     KMKKTAILLVLLCATLQVGSS--LIDGLLPNGNFEQGPKPSQMKHTIVINPHAIPHWELS  63

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITT-TVRVIKGGYYSLSFTFVRTCAQ  688
              G+VEYIKSG+ QG+M+L VPQG  AVRLGEDAS+ T  V V KG +Y+LSF F RTCAQ
Sbjct  64    -GYVEYIKSGQMQGDMLLPVPQGDFAVRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQ  122

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EERLNVSV+P+ EP DWG+LPLQTMYSS G+DTYSW F AE+N ++IVLHNPAREKDP+C
Sbjct  123   EERLNVSVTPSKEPKDWGMLPLQTMYSSDGWDTYSWGFFAEANVIEIVLHNPAREKDPAC  182

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP+ID VALK L  P R +GNMLKNG+FEEGPYI PNT WG+LIPPNIEDDH PLPGWII
Sbjct  183   GPLIDFVALKALKTPHRPKGNMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWII  242

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVKY+D+ HF VP G RAVELVAGRESA+ Q V T  GK+Y+L+F+VGDANNSCEG
Sbjct  243   ESLKAVKYVDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEG  302

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM +EAFAG++ LQV Y SKGKGGF RA  RFTA+S RT +RFLS+ YH
Sbjct  303   SMLIEAFAGKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYH  351



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   509 bits (1311),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 244/354 (69%), Positives = 285/354 (81%), Gaps = 5/354 (1%)
 Frame = -3

Query  1056  EYMKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPK  877
             E   KM K+  +++ LC    +G    + DGL+PNGNFE+GPK SQMK +RVIDPH IP 
Sbjct  2     EEAMKMKKVVIVLVILCATLQIGSS--LIDGLLPNGNFEQGPKSSQMKNTRVIDPHAIPH  59

Query  876   WVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTV-RVIKGGYYSLSFTFVR  700
             W +S G+VEYIKSG+ QG+M+L VPQG +AVRLGE AS+ T V  V KG +YSLSF F R
Sbjct  60    WELS-GYVEYIKSGQMQGDMLLPVPQGDYAVRLGEGASLKTKVTSVTKGTFYSLSFVFAR  118

Query  699   TCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP-ARE  523
             TCAQEERLNVSVSPNSEP DWG+LPLQTMYSS G+DTYSW FLAE+N + IVLHNP A E
Sbjct  119   TCAQEERLNVSVSPNSEPKDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNPIAHE  178

Query  522   KDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPL  343
             KDP+CGP+ID VALK L    R + NMLKNG+FEEGPYI PNT+WGVLIPPNIEDDH PL
Sbjct  179   KDPACGPLIDFVALKALKTTHRPKDNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHCPL  238

Query  342   PGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDAN  163
             PGWI+ESLKAVKY+D++HF VP G RA+ELVAGRESA+ Q V T  G++Y+L+FSVGDAN
Sbjct  239   PGWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDAN  298

Query  162   NSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             N+CEGSM VEAFAG + LQ  Y SKGKGGF RA  RFTA+S RTR+RFLSS+YH
Sbjct  299   NACEGSMVVEAFAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYH  352



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   496 bits (1276),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/346 (67%), Positives = 279/346 (81%), Gaps = 3/346 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M + T L+  LC+ FHV     +TDGL+PNGNFE GPKP Q+KG+ V   + IP W IS 
Sbjct  6     MYRATVLLALLCSTFHVAFS--VTDGLLPNGNFEYGPKPWQLKGTVVTAKNAIPNWEIS-  62

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+KQG+M+LVVP G+ AVRLG +ASI   + V KG YYS++F   RTCAQEE
Sbjct  63    GYVEYIKSGQKQGDMLLVVPSGAFAVRLGNEASIKQKISVAKGSYYSITFNVARTCAQEE  122

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPN E NDWGILP+QTMYSS G+D+Y+WAF A+   ++I +HNP  E+DP+CGP
Sbjct  123   KLNVSVSPNIEQNDWGILPMQTMYSSNGWDSYAWAFQADYPDIEISIHNPGSEEDPACGP  182

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             ++DSVALKLL+ P+R RGN+LKNG+FEEGPY+ PNT WGVLIPP+IEDDHSPLPGWIIES
Sbjct  183   LVDSVALKLLSNPKRTRGNLLKNGNFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIES  242

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYID +HF VP G RA+ELVAG+ESA+ Q+V+TIPGK Y L FSVGDANN+CEGSM
Sbjct  243   LKAVKYIDLDHFAVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNACEGSM  302

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEA+AG+  +Q PY SKGKGGF  A  +F AVST TRI FLSSFY
Sbjct  303   IVEAYAGKDKIQFPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFY  348



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   492 bits (1267),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 234/348 (67%), Positives = 280/348 (80%), Gaps = 3/348 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  +  LV+ L   F + LC   TDGL+PNGNFE GPKPSQ+KG++V DPH IP W +S 
Sbjct  1     MKIVNILVVLLFGSFSIALC-FTTDGLLPNGNFEFGPKPSQLKGTKVTDPHSIPDWEVS-  58

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTT-VRVIKGGYYSLSFTFVRTCAQE  685
             G+VEYIKSG+KQG+M+LVVPQG+ AVRLG++ASI T  V+VI G +YS+SF   RTCAQE
Sbjct  59    GYVEYIKSGQKQGDMILVVPQGAAAVRLGDEASIKTKRVKVINGMFYSVSFGAARTCAQE  118

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E+LNVS +PN E  DWG+LP+QT+YSS G+D YSW FLA+S+ + I  HNP  EKDP+CG
Sbjct  119   EKLNVSFAPNKEEKDWGVLPIQTVYSSDGWDCYSWGFLAQSDEIVITFHNPGVEKDPACG  178

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID+VALK+L AP R RGNMLKNG+FEEGPYI PNTT+G LIPPNIEDDHSPLPGWIIE
Sbjct  179   PLIDNVALKVLRAPIRQRGNMLKNGNFEEGPYIFPNTTYGCLIPPNIEDDHSPLPGWIIE  238

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+DS+H+ VP G RAVELVAGRESA+ QIV+T+PGK Y+L F +GDA NSCEG 
Sbjct  239   SLKAVKYVDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKNSCEGM  298

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             M VEA AG+ +LQ  Y+SKG GGF R+  RF AVS RTR+RFLS  YH
Sbjct  299   MTVEAAAGKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYH  346



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   489 bits (1259),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 233/348 (67%), Positives = 282/348 (81%), Gaps = 10/348 (3%)
 Frame = -3

Query  1041  MTKLTALVL--FLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVI  868
             M+K  A VL   LC   HV L   + DGL+PNGNFE GPKPSQMKG+ V D H IP+W +
Sbjct  1     MSKFAATVLSVLLCATCHVSLA--LIDGLLPNGNFEYGPKPSQMKGTLVTDAHAIPEWEL  58

Query  867   SSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQ  688
             + G+VEYIKSG+KQG+M+LVVP+G++AVRLG +ASI   V+VIKG YYS++F+  RTCAQ
Sbjct  59    T-GYVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQ  117

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EERLNVSV+P+S     GILP+QTMYSS G+D+Y+WAF A+   V+IV+HNP  E+DP+C
Sbjct  118   EERLNVSVAPDS-----GILPMQTMYSSNGWDSYAWAFQADYPEVEIVIHNPGVEEDPAC  172

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP+IDS+ALK L  PR    N+LKNG+FEEGPY+ PNT+WGVL+PPNIEDDHSPLPGW+I
Sbjct  173   GPLIDSIALKALYPPRPTGKNLLKNGNFEEGPYVFPNTSWGVLVPPNIEDDHSPLPGWMI  232

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVKYID+ HF VP G RAVELVAG+ESA+ Q+ RT+PGK Y LMF+VGDANN CEG
Sbjct  233   ESLKAVKYIDAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANNRCEG  292

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             SM VEAFAGR T++VPY+SKG GGF RA  +FTA S RTRI FLS+FY
Sbjct  293   SMVVEAFAGRDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFY  340



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   489 bits (1258),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 285/346 (82%), Gaps = 3/346 (1%)
 Frame = -3

Query  1038  TKLTALVLFLCTI-FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
              KLT L++ LC   FHV L   +TDGL+PNGNFE GPK S++KG+ V +P+ IP W IS 
Sbjct  3     NKLTVLLVLLCAANFHVTLS-FVTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEIS-  60

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIKSG+KQG+M+L+VP+G  AVRLG++A I   +++ KGG+YS++FT  RTC QEE
Sbjct  61    GFVEYIKSGQKQGDMLLLVPEGGFAVRLGKEALIKQKLKLTKGGFYSVTFTAGRTCGQEE  120

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSV+PN E  DWGI+P+QTMYSS G+D+Y+W F A+S+ V++V+HNP  E+DP+CGP
Sbjct  121   KLNVSVNPNVEEKDWGIMPIQTMYSSNGWDSYAWGFNADSDEVELVIHNPGGEEDPACGP  180

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALKLL  P+R R N+LKNG+FEEGPY+LPNT+WGVLIPP+IEDDHSPLPGWIIES
Sbjct  181   LIDSVALKLLEPPKRTRANLLKNGNFEEGPYVLPNTSWGVLIPPHIEDDHSPLPGWIIES  240

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G +A+ELV G+ESA+ Q+V T PGK+Y L FSVGD+NN+CEGS+
Sbjct  241   LKAVKYIDSQHFFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSL  300

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ TL+VPYQSKGKGGF RA   FTAV  RTRI F S+FY
Sbjct  301   IVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFY  346



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   488 bits (1256),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 280/346 (81%), Gaps = 8/346 (2%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  +  L+L LC   H+ L    TDGL+PNGNFE GPKPS MKG+ VI PH IP+W  +S
Sbjct  1     MRAVAFLLLLLCATCHIALS--FTDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWE-TS  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GF+EYIK+G+KQG+M+LVVP+G+ AVRLG +ASI   V+VIKG YYS++F+  RTCAQEE
Sbjct  58    GFIEYIKAGQKQGDMLLVVPEGAFAVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLN+SV+P     DWG+LP+QT+YSS G+D+Y+WAF A+ + ++IV+HNP  E+DP+CGP
Sbjct  118   RLNISVAP-----DWGVLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGVEEDPACGP  172

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA + L  PR    N+LKNG FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW++ES
Sbjct  173   LIDSVAFRALYPPRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVES  232

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS+HF VP   RAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM
Sbjct  233   LKAVKYIDSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSM  292

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAGR T++VPY+SKGKGGF RA  RF AVS RTRI FLS+FY
Sbjct  293   VVEAFAGRDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFY  338



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   485 bits (1248),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 282/346 (82%), Gaps = 3/346 (1%)
 Frame = -3

Query  1038  TKLTALVLFLCTI-FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
              KLT L++ LC   FHV L   +TDGL+PNGNFE GPK S++KG+ V +P+ IP W IS 
Sbjct  3     NKLTVLLVLLCAANFHVTL-SFVTDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEIS-  60

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIKSG+KQG+M+LVVP G  AVRLG++A I   +++ KGG+YS++FT  RTC QEE
Sbjct  61    GFVEYIKSGKKQGDMLLVVPAGGFAVRLGKEALIKQKLKLTKGGFYSITFTGGRTCGQEE  120

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSV+PN E NDWGI+P+QTMYS  G+D+Y+W F A+ + V++V+HNP  E+DP+CGP
Sbjct  121   KLNVSVNPNVEKNDWGIIPIQTMYSCNGWDSYAWGFNADFDEVELVIHNPGGEEDPACGP  180

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALKLL  P+R R N+LKNG+FEEGPY+LPN +WGVLIPP+IEDDHSPLPGWIIES
Sbjct  181   LIDSVALKLLEPPKRTRANLLKNGNFEEGPYVLPNASWGVLIPPHIEDDHSPLPGWIIES  240

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G RA+ELV G+ESA+ Q+V T PGK+Y L FSVGD+NN+CEGS+
Sbjct  241   LKAVKYIDSKHFFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSL  300

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ TL+VPYQSKGKGGF RA   FTAV  RTRI F S+FY
Sbjct  301   IVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFY  346



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   483 bits (1242),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/341 (67%), Positives = 274/341 (80%), Gaps = 3/341 (1%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L+L    IFH+      TDGL+PNGNFE GPK S+MKG+RVI+   IP W  ++GFVEYI
Sbjct  5     LLLLSSAIFHIASS--WTDGLLPNGNFENGPKRSEMKGTRVINSRSIPFWE-TTGFVEYI  61

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KS +KQG+M LVVP+G+ AVRLG+ A++ T V+V  G +YS+SF+  RTCAQEE+LN+S 
Sbjct  62    KSTQKQGDMQLVVPEGNSAVRLGDGAAVKTKVKVTNGKFYSVSFSASRTCAQEEKLNISA  121

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             SPNSEP DWG+LP+QT+YSS G+D+Y W FLA+S+ ++I +HNP  EKDP+CGP+IDSVA
Sbjct  122   SPNSEPKDWGMLPIQTVYSSDGWDSYCWGFLAQSDEIEIAIHNPGVEKDPACGPLIDSVA  181

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             LK L+ PRR RGNMLKNG+FE GPYI PNT WGVLIPPNIEDDHSPLPGW+IESLKAVKY
Sbjct  182   LKALHTPRRPRGNMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSPLPGWMIESLKAVKY  241

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             IDS++F VP G RAVELV GRES V Q+VRT P KVY+L+FSVGD+NN CEGSM V A+A
Sbjct  242   IDSDNFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNKCEGSMMVVAYA  301

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             G   LQVPY+SKG GGF  A  RF A STRTRIRF S +YH
Sbjct  302   GVDILQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYH  342



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   482 bits (1241),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/347 (66%), Positives = 282/347 (81%), Gaps = 3/347 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             KM K   L++      H  L   ITDGL+PNG+FE GPKPS++KGS V  P+GIP W IS
Sbjct  2     KMQKFKLLLVLFFATCHSSLS--ITDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTIS  59

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              G VEYIKSG+KQG+MVLVVP G++AVRLG +ASI   ++V+KG +YSL+F+  RTCAQE
Sbjct  60    -GMVEYIKSGQKQGDMVLVVPHGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQE  118

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E+LNVSV P++E +DWG+ P+QTMY S G D+Y+  F A+  RV+IV+HNP  ++DP+CG
Sbjct  119   EKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGVDEDPACG  178

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+IDSVALKLL++P+R R N+LKNG+FEEGPY+ P  +WGVLIPP+IED +SPLPGW++E
Sbjct  179   PLIDSVALKLLHSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVE  238

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKYIDS+HF VP G RA+ELVAG+ESA+ Q+V TI GKVY+L F VGDANNSCEGS
Sbjct  239   SLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGS  298

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ T+QV YQSKGKGGFIR   RF A+STRTRIRFLS+FY
Sbjct  299   MVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFY  345



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   481 bits (1237),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 272/335 (81%), Gaps = 3/335 (1%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C   H  +    T+GL+PNGNFE GPKP +MKG++V+    IPKW IS G+VEYIKSG+K
Sbjct  13    CATCHTAVS--FTNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEIS-GYVEYIKSGQK  69

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             QG+M+L+VP+G++AVRLG +ASI   V+V+KG YYS++F+  RTCAQEE LNVSV+PNSE
Sbjct  70    QGDMLLIVPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSE  129

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
              NDWG+LP+QTMYSS G+D+Y+W F A+   + I +HNP   +DP+CGP+IDSVALK L 
Sbjct  130   ANDWGMLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGVAEDPACGPLIDSVALKALY  189

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              PRR R N+LKNG+FEEGPY+ P  +WGVLIPPNIEDDHSPLPGW+IESLKAVKYIDS+H
Sbjct  190   PPRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDH  249

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G R VELVAG+ESA+ Q+V TIP +VY L FSVGDANNSCEGSM VEAFAG  T+
Sbjct  250   FAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTV  309

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +VPY+SKGKGGF RA  RF A+S RTR+ FLS++Y
Sbjct  310   KVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYY  344



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   480 bits (1235),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/349 (66%), Positives = 285/349 (82%), Gaps = 6/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+K   L  LVLF  T  H  L   ITDGL+PNG+FE GPKPS++KGS V  P+GIP W 
Sbjct  1     MQKFKLL--LVLFFATC-HSSLS--ITDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWT  55

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS G VEYIKSG+KQG+MVLVVP G++AVRLG +ASI   ++V+KG +YSL+F+  RTCA
Sbjct  56    IS-GMVEYIKSGQKQGDMVLVVPHGTYAVRLGNEASIKQKIQVVKGMFYSLTFSASRTCA  114

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE+LNVSV P++E +DWG+ P+QTMY S G D+Y+  F A+  RV+IV+HNP  ++DP+
Sbjct  115   QEEKLNVSVVPSNEKSDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGVDEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVALKLL++P+R R N+LKNG+FEEGPY+ P  +WGVLIPP+IED +SPLPGW+
Sbjct  175   CGPLIDSVALKLLHSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RA+ELVAG+ESA+ Q+V TI GKVY+L F VGDANNSCE
Sbjct  235   VESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCE  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T+QV YQSKGKGGFIR   RF A+STRTRIRFLS+FY
Sbjct  295   GSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFY  343



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   481 bits (1238),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 272/335 (81%), Gaps = 3/335 (1%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C   H  +    T+GL+PNGNFE GPKP +MKG++V+    IPKW IS G+VEYIKSG+K
Sbjct  13    CATCHTAVS--FTNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEIS-GYVEYIKSGQK  69

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             QG+M+L+VP+G++AVRLG +ASI   V+V+KG YYS++F+  RTCAQEE LNVSV+PNSE
Sbjct  70    QGDMLLIVPEGAYAVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSE  129

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
              NDWG+LP+QTMYSS G+D+Y+W F A+   + I +HNP   +DP+CGP+IDSVALK L 
Sbjct  130   ANDWGMLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGVAEDPACGPLIDSVALKALY  189

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              PRR R N+LKNG+FEEGPY+ P  +WGVLIPPNIEDDHSPLPGW+IESLKAVKYIDS+H
Sbjct  190   PPRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSDH  249

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G R VELVAG+ESA+ Q+V TIP +VY L FSVGDANNSCEGSM VEAFAG  T+
Sbjct  250   FAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDTV  309

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +VPY+SKGKGGF RA  RF A+S RTR+ FLS++Y
Sbjct  310   KVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYY  344



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   479 bits (1234),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 233/343 (68%), Positives = 276/343 (80%), Gaps = 7/343 (2%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             L+ L + LC  +   L   + DGL+PNG+FE GPKPS MKG+ VI+ H IP+W +S GFV
Sbjct  6     LSVLSVLLCASY-CHLAVALIDGLLPNGDFEYGPKPSDMKGTVVINRHAIPEWELS-GFV  63

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EYIK+G+KQG+M+LVVP G  AVRLG +ASI   V+VIKG YYS++F+  RTCAQEERLN
Sbjct  64    EYIKAGQKQGDMLLVVPAGEFAVRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLN  123

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             VSV+P+S     GILP+QT YSS G+D+Y+WAF A+   V+IV+HNP  E+DP+CGP+ID
Sbjct  124   VSVAPDS-----GILPIQTTYSSNGWDSYAWAFQADYPEVEIVIHNPGVEEDPACGPLID  178

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKA  313
             SVALK L  PR    N+LKNGDFEEGPYI PNT+WGVL+PPNIEDDHSPLPGW+IESLKA
Sbjct  179   SVALKALYPPRPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPGWMIESLKA  238

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             VKYID+ HF VP G RAVELVAG+ESA+ QI RTIPGKVY L F+VGDANN CEGSM VE
Sbjct  239   VKYIDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANNKCEGSMVVE  298

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AFA R T++VPY+SKG GGF RA  RFTAVSTRTRI FLS+FY
Sbjct  299   AFADRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFY  341


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 87/191 (46%), Gaps = 24/191 (13%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     L+ NG+FE GP   P+   G      + D H  +P W+I S   V+YI +    
Sbjct  189  RPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYIDAEH--  246

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VPQG  AV L  G++++I    R I G  Y+L+F  V     +   ++ V   +
Sbjct  247  ----FSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFA-VGDANNKCEGSMVVEAFA  301

Query  651  EPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGPIIDSV  487
            + N   + P ++   + GF      F A S R +I+  +     R  D +  CGP++D V
Sbjct  302  DRNTVKV-PYESK-GTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMASLCGPVVDDV  359

Query  486  ALKLLNAPRRL  454
             L  +  PRR+
Sbjct  360  KLLSIRNPRRV  370



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   478 bits (1229),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 278/349 (80%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+    L+AL+ F C   H+     ITDGL+PNGNFE GP+PS M G+ V+  + IP W 
Sbjct  1     MRGFIFLSALLCFTC--HHIAFS--ITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI+SG+KQG+M+LVVP+G+ AVRLG +AS+   ++VIKG YYS+SF F RTCA
Sbjct  57    IS-GFVEYIRSGQKQGDMLLVVPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE LN+SV+P     +WG+LPLQT+YSS G+DTY+WAF A+ N  +IVLHNP  E+DP+
Sbjct  116   QEESLNISVAP-----EWGVLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A++ L  PR    N+LKNG FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW+
Sbjct  171   CGPLIDSIAIRGLYPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKYIDS+HF VP G RA+ELVAG+ESA+ QI RTIPGK Y L F+VGDANN+C 
Sbjct  231   IESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF RA  RF AVS RTRI FLS+FY
Sbjct  291   GSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFY  339



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   477 bits (1228),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 278/349 (80%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+    L+AL+ F C   H+     ITDGL+PNGNFE GP+PS M G+ V+  + IP W 
Sbjct  1     MRGFIFLSALLCFTC--HHIAFS--ITDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI+SG+KQG+M+LVVP+G+ AVRLG +AS+   ++VIKG YYS+SF F RTCA
Sbjct  57    IS-GFVEYIRSGQKQGDMLLVVPEGAFAVRLGNEASVKQRIKVIKGNYYSISFNFARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE LN+SV+P     +WG+LPLQT+YSS G+DTY+WAF A+ N  +IVLHNP  E+DP+
Sbjct  116   QEESLNISVAP-----EWGVLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A++ L  PR    N+LKNG FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW+
Sbjct  171   CGPLIDSIAIRGLYPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKYIDS+HF VP G RA+ELVAG+ESA+ QI RTIPGK Y L F+VGDANN+C 
Sbjct  231   IESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF RA  RF AVS RTRI FLS+FY
Sbjct  291   GSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFY  339



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   474 bits (1221),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 260/306 (85%), Gaps = 1/306 (0%)
 Frame = -3

Query  918  MKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVI  739
            MKGSRVIDPH IP W I  GFVEYI+SG+KQG+M+LVVP+G +AVRLG++ASI T V+V 
Sbjct  1    MKGSRVIDPHSIPHWEIW-GFVEYIESGQKQGDMLLVVPEGRYAVRLGDEASIKTKVKVE  59

Query  738  KGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESN  559
            K  +YSLSF+  RTCAQ+E LN+SVSPN EPNDWG+LP+QTMYSS G+D+YSW FLA+S+
Sbjct  60   KDLFYSLSFSAARTCAQDEVLNLSVSPNKEPNDWGMLPMQTMYSSDGWDSYSWGFLADSD  119

Query  558  RVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVL  379
             ++I +HNP REKD +CGP+IDSVALK L  P + RGN+LKNG+FEEGPYI PNTTWG L
Sbjct  120  VIEISIHNPGREKDATCGPLIDSVALKALRRPLKTRGNLLKNGNFEEGPYIFPNTTWGAL  179

Query  378  IPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGK  199
            IPPNIEDDHSPLPGWIIESLKAVKY+DS HF VP G RAVEL+AGRESA+ QIV+TIPG 
Sbjct  180  IPPNIEDDHSPLPGWIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGW  239

Query  198  VYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRF  19
             Y+L+FSVGDA N CEGSM +EA AG++TLQVPYQS GKG FIRA HRF AVS RTR+RF
Sbjct  240  WYDLVFSVGDAKNGCEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRF  299

Query  18   LSSFYH  1
            LS  YH
Sbjct  300  LSINYH  305


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 82/192 (43%), Gaps = 39/192 (20%)
 Frame = -3

Query  963  LVPNGNFERGPK--PSQMKGS----RVIDPHG-IPKWVISS-GFVEYIKSGEKQGEMVLV  808
            L+ NGNFE GP   P+   G+     + D H  +P W+I S   V+Y+ S          
Sbjct  158  LLKNGNFEEGPYIFPNTTWGALIPPNIEDDHSPLPGWIIESLKAVKYVDSEH------FS  211

Query  807  VPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVSPNSEPN  643
            VP+G  AV L  G +++I   V+ I G +Y L F+       C     +  S        
Sbjct  212  VPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAKNGCEGSMLIEASA-------  264

Query  642  DWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVL-----HNPAREKDPSCGPIIDSV  487
              G + LQ  Y S+G   F   +  F A S R ++       H  +      CGP+ID V
Sbjct  265  --GKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNTGTLCGPVIDDV  322

Query  486  ALKLLNAPRRLR  451
             L  L   R+LR
Sbjct  323  RLYSL---RKLR  331



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   476 bits (1224),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 276/345 (80%), Gaps = 3/345 (1%)
 Frame = -3

Query  1035  KLTALVLFLCTI-FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSG  859
             KL+ L++ LC   FH  L   +TDGL+PNGNFE GPK S++KG+ V +PH IP W IS G
Sbjct  4     KLSVLLVLLCAANFHATL-SFVTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEIS-G  61

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER  679
             FVEYIKSG+KQG+MVLVVP+G  AV+LG +A I   +++ KG +YS +FT  RTC QE +
Sbjct  62    FVEYIKSGQKQGDMVLVVPEGGFAVKLGNEALIKQKLKLTKGSFYSTTFTASRTCGQEAK  121

Query  678   LNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPI  499
             LNVSV+PN E NDWGI+P+QT+YS  G+D+Y+W F A+ + V++V+HNP   +DP+CGP+
Sbjct  122   LNVSVNPNLEENDWGIMPIQTIYSCNGWDSYAWGFNADFDDVELVIHNPGVVEDPACGPL  181

Query  498   IDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESL  319
             IDSVALKLL  P+R R N+LKNG+FEEGPY+ PNT+WG LIPP+IEDDHSPLPGWIIESL
Sbjct  182   IDSVALKLLEPPKRTRANLLKNGNFEEGPYVSPNTSWGTLIPPHIEDDHSPLPGWIIESL  241

Query  318   KAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMG  139
             KAVKYIDS HF VP G RA+ELV G+ESA+ Q+V T PGK+Y L FSVGD+NNSCEGS+ 
Sbjct  242   KAVKYIDSEHFFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNSCEGSLV  301

Query  138   VEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             VEAFAG+ TL+VPYQSKGKGGF RA   FTAV  RTRI F S+FY
Sbjct  302   VEAFAGKDTLKVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFY  346



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   474 bits (1220),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 277/349 (79%), Gaps = 9/349 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  ++ L+L +C       CR+   I DGL+PNGNFE GPKPS+MKG++V+ P  IP W 
Sbjct  1     MQTISLLLLLICAT-----CRIASSIKDGLLPNGNFEYGPKPSEMKGTKVVSPKAIPNWE  55

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS G VEYIKSG+KQG+M+L+VP+G+ AVRLG DA I  T++VIKG +YSL+F+  RTCA
Sbjct  56    IS-GVVEYIKSGQKQGDMLLIVPEGAFAVRLGNDALIKQTMKVIKGMFYSLTFSAARTCA  114

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSVSPN E ND+G+ P+QTMYSS G+D+Y+WAF A+   ++I +HNP  E+D +
Sbjct  115   QEERLNVSVSPNYEKNDYGLFPIQTMYSSNGWDSYAWAFQADEPLIEISIHNPGVEEDAA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVALK L  P+R   N+LKNG+FEEGPYI PNT+WGVLIPP+IEDDHSPLPGWI
Sbjct  175   CGPLIDSVALKTLYPPKRTPANLLKNGNFEEGPYIFPNTSWGVLIPPHIEDDHSPLPGWI  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKYIDS HF VP G RA+ELVAG+ESA+ Q+V+T  G+ Y L F+VGDANN+CE
Sbjct  235   IESLKAVKYIDSEHFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNACE  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++  YQSKGKGGF RA   F A S+RTRI F S+FY
Sbjct  295   GSMVVEAFAGKNTVKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFY  343



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   474 bits (1219),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 222/347 (64%), Positives = 277/347 (80%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M +++ L++ LC   HV L   +TDGL+PNGNFE GPK SQMKG+ V  P+ IP W IS 
Sbjct  1     MYRISVLLVLLCATCHVVLS--VTDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG KQG+M+L+VP+G+ AVRLG +ASI   ++V KG +YS++F+  RTCAQEE
Sbjct  58    GYVEYIKSGHKQGDMLLIVPEGAFAVRLGNEASIKQKIKVTKGRFYSMTFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPN E NDW ILP+QTMYS+ G+D+Y+WAF+A+++ V+I +HNP  E+DP+CGP
Sbjct  118   KLNVSVSPNLETNDWAILPMQTMYSNNGWDSYAWAFVADADEVEITVHNPGVEEDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALK+L  P+R   NMLKNG+FEEGPY+ PN +WGVLIPP IEDDHSPLPGWIIES
Sbjct  178   LIDSVALKVLYPPKRTGVNMLKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYID  HF VP G RAVELVAG+ESA+ Q+V+T   K Y L F+VGDA N C G++
Sbjct  238   LKAVKYIDLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTL  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GVEA+AGR  ++V Y SKGKGGF +A  RF AVS RTRI FLS+FY+
Sbjct  298   GVEAYAGRDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYN  344



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   473 bits (1218),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 280/346 (81%), Gaps = 3/346 (1%)
 Frame = -3

Query  1038  TKLTALVLFLCTI-FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
              KLT L+L LC   FHV L   +TDGL+PNGNFE GPK S++KG+ V +PH IP W IS 
Sbjct  3     NKLTVLLLLLCAANFHVTLS-FVTDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEIS-  60

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIKSG+KQG+M+LVVP+G  AVRLG +A I   ++V KGG+YS++F+  RTCAQEE
Sbjct  61    GFVEYIKSGQKQGDMLLVVPEGGFAVRLGNEALIKQKLKVKKGGFYSVTFSAARTCAQEE  120

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
              LNVS++PN E   WGI+P+QTMYSS G+D+Y+W F A+ + +++V+HNP  E+D +CGP
Sbjct  121   TLNVSITPNLEKRHWGIMPIQTMYSSIGWDSYAWGFNADFDEIELVIHNPGVEEDAACGP  180

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALKLL  P+R R N+LKNG+FEEGPY+ PNT+WGVLIPP+IEDDHSPLPGWIIES
Sbjct  181   LIDSVALKLLAFPKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIES  240

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G RA+ELVAG+ESA+ Q+V T+PGK+Y L F+VGD+NN+CEGS+
Sbjct  241   LKAVKYIDSKHFSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNACEGSL  300

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ TL+V YQSKG+GGF RA   FTAV  RTR+ F S FY
Sbjct  301   AVEAFAGKDTLKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFY  346


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 36/190 (19%)
 Frame = -3

Query  963  LVPNGNFERGPK--PSQMKGSRVIDPH------GIPKWVISS-GFVEYIKSGEKQGEMVL  811
            L+ NGNFE GP   P+   G  +I PH       +P W+I S   V+YI S         
Sbjct  200  LLKNGNFEEGPYVFPNTSWGV-LIPPHIEDDHSPLPGWIIESLKAVKYIDSKH------F  252

Query  810  VVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTC-AQEERLNVSVSPNSEPND  640
             VP+G  A+ L  G+++++   V  + G  Y+L+FT   +  A E  L V      +   
Sbjct  253  SVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLAVEAFAGKDT--  310

Query  639  WGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN-----PAREKDPSCGPIIDSVA  484
                 L+ +Y S G   F    + F A   R +++ ++      A      CGP+ID V 
Sbjct  311  -----LKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSGSLCGPVIDDV-  364

Query  483  LKLLNAPRRL  454
             KLL+  +R+
Sbjct  365  -KLLSVRKRV  373



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   472 bits (1215),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/343 (66%), Positives = 275/343 (80%), Gaps = 8/343 (2%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             L  + + LC    +G C  I DGLVPNGNFE  PKPS MKG+ VI  + IPKW IS GFV
Sbjct  6     LAVVAVLLCATCRLG-CAFI-DGLVPNGNFELAPKPSDMKGTVVIGKYAIPKWEIS-GFV  62

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EYIKSG+KQG+M+LVVP+G+ AVRLG +ASI   +RV KG YYS++F+  RTCAQEE+LN
Sbjct  63    EYIKSGQKQGDMLLVVPEGAFAVRLGNEASIKQRLRVQKGMYYSITFSAARTCAQEEKLN  122

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             +SV+P+S     G+LP+QT+YSS G+D+Y+WAF AE +  +IV+HNP  E+DP+CGP+ID
Sbjct  123   ISVAPDS-----GVLPMQTLYSSNGWDSYAWAFQAELDVAEIVIHNPGVEEDPACGPLID  177

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKA  313
             S+A++ L  PR    N+LKNG FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW++ESLKA
Sbjct  178   SIAIRALYPPRATNKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMVESLKA  237

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             VKYIDS HF VP G RA+ELVAG+ESA+ Q+ RTIPGK Y L F+VGDA+NSCEGSM VE
Sbjct  238   VKYIDSAHFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNSCEGSMIVE  297

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AFAGR T++VPY+SKGKGGF RA  RF AVSTRTRI F S+FY
Sbjct  298   AFAGRDTIKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFY  340



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   472 bits (1215),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 269/335 (80%), Gaps = 3/335 (1%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C   HV L   +TDGL+PNG+FE GPKP QMKG+ V   + IP W IS G+VEYIKSG+K
Sbjct  14    CATCHVALS--VTDGLLPNGDFEHGPKPWQMKGTVVTAKNAIPNWEIS-GYVEYIKSGQK  70

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             QG+M+LVVP G+ AVRLG +ASI   + V K  YYS++F   RTCAQEE+LNVSVSPN E
Sbjct  71    QGDMLLVVPGGAFAVRLGNEASIKQKISVTKDSYYSITFNVARTCAQEEKLNVSVSPNLE  130

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
             P DWGILP+QT+YSS G+D+YSWAF A+++ V+I +HNP  E+DP+CGP+IDSVA+K L+
Sbjct  131   PKDWGILPMQTVYSSNGWDSYSWAFQADASEVEISIHNPGVEEDPACGPLIDSVAVKFLS  190

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              P+R R N+LKNGDFEEGPY+ PNT WGVLIPP+IEDDHSPLPGWIIESLKAVKYI+S H
Sbjct  191   NPKRTRDNLLKNGDFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYINSEH  250

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G RA+ELVAG+ESA+ QIV+TIP K Y L F+VGDANNSCEGS+ VE +AG   +
Sbjct  251   FKVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANNSCEGSLVVEVYAGNDKI  310

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             ++PY SKGKGGF  A  +F AVST TR+ FLSSFY
Sbjct  311   EIPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFY  345



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   471 bits (1211),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 275/347 (79%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M +++ L++ LC   HV L   +TDGL+PNGNFE GPK SQMKG+ V  P+ IP W IS 
Sbjct  1     MYRISVLLVLLCATCHVVLS--VTDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG KQG+M+L+VP+G  AVRLG +ASI   ++V KG +YS++F+  RTCAQEE
Sbjct  58    GYVEYIKSGHKQGDMLLIVPEGVFAVRLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPN E NDW ILP+QTMYS+ G+D+Y+WAF+A++  V+I +HNP  E+DP+CGP
Sbjct  118   KLNVSVSPNLETNDWAILPMQTMYSNNGWDSYAWAFVADAEEVEITIHNPGVEEDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALK+L  P+R   N+LKNG+FEEGPY+ PN +WGVLIPP IEDDHSPLPGWIIES
Sbjct  178   LIDSVALKVLYPPKRTGVNILKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYID  HF VP G RA+ELVAG+ESA+ Q+V+T   K Y L F+VGDA N C G++
Sbjct  238   LKAVKYIDLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTL  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GVEA+AGR  ++V Y SKGKGGF +A  RF AVS RTRI FLS+FY+
Sbjct  298   GVEAYAGRENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYN  344



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   470 bits (1210),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 273/343 (80%), Gaps = 8/343 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLI---TDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             LVLFL     +  C  +   TDGL+PNGNFE+GPKPSQ+KGS V     IP W IS GFV
Sbjct  8     LVLFLS----ISTCHTVFSFTDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTIS-GFV  62

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EYIKSG+KQG+M+LVVP+G +AVRLG +ASI   +++IKG +YS++F+  RTCAQEE+LN
Sbjct  63    EYIKSGQKQGDMLLVVPEGDYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLN  122

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             VSV P +E  DWGI+P+QTMY S G+++++  F A+    QIV+HNP +E+DP+CGP+ID
Sbjct  123   VSVVPTTEKRDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVIHNPGKEEDPACGPLID  182

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKA  313
             SVALK+L  P+R R N+LKNG+ EEGPYI PN++WG LIPP+IED H PLPGWI+ESLKA
Sbjct  183   SVALKVLYPPKRTRANLLKNGNLEEGPYIFPNSSWGALIPPHIEDSHGPLPGWIVESLKA  242

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             VKYIDS+HF VP G RA+ELVAG+ESA+ Q+V T  GK Y+L F+VGDANN CE SM VE
Sbjct  243   VKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANNECEASMMVE  302

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AFAG  T+QVPYQSKGKGGF+R   RF AVSTRTR+RFLS+FY
Sbjct  303   AFAGANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFY  345



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   469 bits (1206),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 276/347 (80%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K+T L+L LC   +      + DGL+PNG+FE+GP+ SQ+KG+ V     IPKW IS 
Sbjct  1     MQKVTLLLLILCATSYNATS--LIDGLLPNGDFEKGPEQSQLKGTVVTSKTAIPKWGIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+KQG+M+LVVP+G  AVRLG +ASI   V+V KG +YS++F+  RTCAQEE
Sbjct  58    GYVEYIKSGQKQGDMLLVVPEGEFAVRLGNEASIKQKVKVEKGTFYSVTFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSV+PN E +DWGILP+QTMYSS G+D+Y W+F A++  ++I +HNP  ++DP+CGP
Sbjct  118   KLNVSVTPNHEAHDWGILPMQTMYSSNGWDSYCWSFRADAPEIEISIHNPGMDEDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALK L  P+R   N++KNG+FEEGPY+ P T+WGVLIPP+IEDDHSPLPGWIIES
Sbjct  178   LIDSVALKALYIPKRTNANLVKNGNFEEGPYVPPKTSWGVLIPPHIEDDHSPLPGWIIES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVK++DS+HF VP G RAVELVAG+ESA+ Q+V T  GKVY L F+VGDA NSCEGSM
Sbjct  238   LKAVKFVDSDHFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNSCEGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEA+AG  ++ VPY S GKGG++ A  RFTA S RTR+RFLSS+Y+
Sbjct  298   AVEAYAGTASVTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYN  344



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   468 bits (1205),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 216/325 (66%), Positives = 266/325 (82%), Gaps = 1/325 (0%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            L TDGL+PNGNFE GPK S +KG+ V  P+ IP W +S G+VEYIKSG+KQG+M+LVVP+
Sbjct  24   LDTDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVS-GYVEYIKSGQKQGDMLLVVPE  82

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G  AVRLG++ASI   ++V KG +YS++F+  RTC QEE LN+S++PN E NDWGI P+Q
Sbjct  83   GGFAVRLGKEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNLSINPNLEKNDWGIFPIQ  142

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            TMYSS G+D+Y+W F A+S+ ++  +HNP  E D +CGP+IDSVALK+L  P+R R N+L
Sbjct  143  TMYSSNGWDSYAWGFNADSDELEFRIHNPGAEDDAACGPLIDSVALKVLAPPKRTRANLL  202

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNGDFEEGPY+ PNT+WGVLIPP+IEDDHSPLPGWIIESLKAVKYIDSNHF VP G RA+
Sbjct  203  KNGDFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSNHFAVPEGQRAI  262

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG+ESA+ Q+V T PG++Y L FSVGD+ NSCEGS+ VEAFAG+ TL+VPY+S GKG
Sbjct  263  ELVAGKESALAQVVFTKPGRLYALTFSVGDSKNSCEGSLVVEAFAGKDTLKVPYESMGKG  322

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            GF RA   FTAV T TR+ FLSSFY
Sbjct  323  GFKRARLLFTAVETHTRVMFLSSFY  347



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   467 bits (1201),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/339 (65%), Positives = 272/339 (80%), Gaps = 9/339 (3%)
 Frame = -3

Query  1011  LCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIK  841
             L ++  +  C+    I DGLV NGNFE  PKPS MKG++VI  + IP+W IS GFVEYIK
Sbjct  6     LLSVLLLATCQFSLSIRDGLVKNGNFELAPKPSDMKGTQVIGKNAIPEWEIS-GFVEYIK  64

Query  840   SGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVS  661
             SG+KQG+M+LVVP+G++AVRLG +ASI   +RVIKG YYS++F+  RTCAQEE+LNVSVS
Sbjct  65    SGQKQGDMLLVVPEGAYAVRLGNEASIKQRMRVIKGMYYSITFSAARTCAQEEKLNVSVS  124

Query  660   PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVAL  481
             P     DWG+LP+QTMYSS G+D+Y+WAF AE   V +V+HNP  E+DP+CGP+IDSVA+
Sbjct  125   P-----DWGVLPMQTMYSSNGWDSYAWAFQAEFQYVDLVIHNPGVEEDPACGPLIDSVAI  179

Query  480   KLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYI  301
             + L  PR    N+LKNG FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW++ESLKAVKYI
Sbjct  180   RALYPPRPTNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYI  239

Query  300   DSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAG  121
             D +HF VP G RA+ELVAG+ESA+ Q+ RT+ GK Y L F+VGDA+NSCEGSM VEAFAG
Sbjct  240   DVDHFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAG  299

Query  120   RLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + TL+VPY+SKGKGGF RA  RF AV+ RTRI F S+FY
Sbjct  300   KDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFY  338



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   467 bits (1201),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 270/346 (78%), Gaps = 3/346 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M + T L++ LC    +     +TDGL+PNG+FE+GP+PS+MKG+ V   + IP W IS 
Sbjct  1     MYRATVLLVTLCITSQIA--SSVTDGLLPNGDFEQGPRPSEMKGTVVTAKNAIPNWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GF+EYIKSG KQG+MVLVVP G++AVRLG +ASI   V+V +G +YSL+F   RTCAQEE
Sbjct  58    GFIEYIKSGHKQGDMVLVVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSEP DWGILP+QTMYSS G+D Y+WAF A+   V+I +HNP  E+D +CGP
Sbjct  118   KLNVSVSPNSEPRDWGILPMQTMYSSNGWDAYAWAFQADGPEVEISIHNPGVEEDAACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALKLL+ P+R + N+LKNG+FEEGPY+ PN  WGVL+PPNIEDDH PLPGW+++S
Sbjct  178   LIDSVALKLLSNPKRPKDNLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCPLPGWMVDS  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+V+T   K+Y L FSVGD +NSC GSM
Sbjct  238   LKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VE +AG+   QVPY+S GKGGF  A   F A+S  TRI FLSSFY
Sbjct  298   VVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFY  343



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   467 bits (1201),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 216/331 (65%), Positives = 268/331 (81%), Gaps = 2/331 (1%)
 Frame = -3

Query  996  HVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEM  817
            H+ L  L+TDGL+PNGNFE GPK S +KG+ V  P+ IP W +S G+VEYIKSG+KQG+M
Sbjct  19   HITLS-LVTDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVS-GYVEYIKSGQKQGDM  76

Query  816  VLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDW  637
            +LVVP+G  AVRLG +ASI   ++V KG +YS++F+  RTC QEE LNVS+SPN E NDW
Sbjct  77   LLVVPEGGFAVRLGNEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNVSISPNLEKNDW  136

Query  636  GILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRR  457
            GI P+QTMYSS G+D+Y+W F A S+ ++  +HNP  E D +CGP+IDSVALK+L  P+R
Sbjct  137  GIFPIQTMYSSNGWDSYAWGFNANSDELEFRIHNPGAEDDAACGPLIDSVALKILAPPKR  196

Query  456  LRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVP  277
             R N+LKNG+FEEGP++ PNT+WGVLIPP+IEDDHSPLPGWIIESLKAVKYIDS HF VP
Sbjct  197  TRANLLKNGNFEEGPFVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSTHFAVP  256

Query  276  SGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPY  97
             G RA+ELVAG+ESA+ Q+V T PG++Y L FSVGD+ N+CEGS+ VEAFAG+ TL+VPY
Sbjct  257  EGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNACEGSLVVEAFAGKDTLKVPY  316

Query  96   QSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
            +SKGKGGF RA   FTAV T TR+ FLS+FY
Sbjct  317  ESKGKGGFKRARLLFTAVETHTRVMFLSTFY  347



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   467 bits (1202),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 270/346 (78%), Gaps = 3/346 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M + T L++ LC    V     +TDGL+PNG+FE+GPKPS+MKG+ V     IP W IS 
Sbjct  23    MYRATVLLVTLCITSQVA--SSVTDGLLPNGDFEQGPKPSEMKGTVVTAKSAIPNWEIS-  79

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GF+EYIKSG KQG+MVLVVP G++AVRLG +ASI   V+V +G +YSL+F   RTCAQEE
Sbjct  80    GFIEYIKSGHKQGDMVLVVPAGAYAVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEE  139

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSVSPNSEP DWGILP+QTMYSS G+D Y+WAF A+   V+I +HNP  E+D +CGP
Sbjct  140   KLNVSVSPNSEPRDWGILPMQTMYSSNGWDAYAWAFQADGPEVKISIHNPGVEEDAACGP  199

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALKLL+ P+R + N+LKNG+FEEGPY+ P+T WGVL+PPNIEDDH PLPGW+++S
Sbjct  200   LIDSVALKLLSNPKRPKDNLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCPLPGWMVDS  259

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+V+T   K+Y L FSVGD +NSC GSM
Sbjct  260   LKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSM  319

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VE +AG+   QVPY+S GKGGF  A   F A+S  TRI FLSSFY
Sbjct  320   VVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFY  365


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 83/192 (43%), Gaps = 36/192 (19%)
 Frame = -3

Query  969  DGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQGEMV  814
            D L+ NGNFE GP   PS   G      + D H  +P W++ S   V+YI S        
Sbjct  217  DNLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCPLPGWMVDSLKAVKYIDSDH------  270

Query  813  LVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRT---CAQEERLNVSVSPNSE  649
              VP+G  AV L  G++++I+  V+      Y+L+F+   T   C     + V    +  
Sbjct  271  FTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDK-  329

Query  648  PNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP--AREKDPS---CGPIID  493
                     Q  Y S G   F    + F A SN  +I   +   + + D S   CGP++D
Sbjct  330  --------TQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSGSLCGPVLD  381

Query  492  SVALKLLNAPRR  457
             V L  +  PRR
Sbjct  382  DVKLVSVRNPRR  393



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   466 bits (1199),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/341 (65%), Positives = 276/341 (81%), Gaps = 9/341 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             L + LC  FHV     ITDGLV NGNFE GPKPS +KG+ VI   H IP+W IS GFVEY
Sbjct  8     LSVLLCATFHVSFS--ITDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEIS-GFVEY  64

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
             V+P     DWG++P+QT+Y+S+G+D  ++ F AE+  V++++HNP +E+DP+CGP++DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAENETVEMLIHNPGKEEDPACGPLVDSV  179

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             AL+ L  PR    N+LKNG FEEGPY+ PN++WGV+IPPNIEDDHSPLPGW++ESLKAVK
Sbjct  180   ALRTLYPPRATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             YIDS HF VP G RAVEL+AG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAF
Sbjct  240   YIDSGHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AG+ T++VPY+SKGKGGF RA  +F AV+ RTRI FLS+FY
Sbjct  300   AGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFY  340



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   467 bits (1201),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 272/354 (77%), Gaps = 3/354 (1%)
 Frame = -3

Query  1065  LDPEYMKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHG  886
             L P  +  M + T L++ LC  + V L   +TDGL+PNG+FE GPKPS+MKG+ V   + 
Sbjct  9     LSPCKLNAMYRATVLLVSLCITWQVALS--VTDGLLPNGDFEYGPKPSEMKGTVVTAKNA  66

Query  885   IPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTF  706
             IP W IS GF+EYIKSG KQG+M+LVVP G++AVRLG +ASI   V+V +G +YSL+F  
Sbjct  67    IPNWEIS-GFIEYIKSGHKQGDMLLVVPVGAYAVRLGNEASIKQKVKVTQGEFYSLTFNV  125

Query  705   VRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAR  526
              RTCAQEE+LN+SVSPNSEP DWGILP+QTMYSS G+D Y+WAF A+   V+I +HNP  
Sbjct  126   ARTCAQEEKLNLSVSPNSEPRDWGILPMQTMYSSNGWDAYAWAFHADGPEVEISIHNPGV  185

Query  525   EKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSP  346
             E+D +CGP++DSVALKLL+ P+R R N+LKNG+FEEGPY+ PNT WGVLIPP+IEDD  P
Sbjct  186   EEDAACGPLVDSVALKLLSNPKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHIEDDQCP  245

Query  345   LPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDA  166
             LPGWI++SLKAVKYID  HF VP G RAVELVAG+ESA+ Q V+TI  K+Y L F VGD 
Sbjct  246   LPGWIVDSLKAVKYIDREHFTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDT  305

Query  165   NNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +NSC GSM VE +AG+   QVPY+S GKGGF RA   F AVS  TRI FLSSFY
Sbjct  306   SNSCVGSMVVEVYAGKDRTQVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFY  359


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 82/193 (42%), Gaps = 38/193 (20%)
 Frame = -3

Query  969  DGLVPNGNFERGPK--PSQMKGSRVIDPH------GIPKWVISS-GFVEYIKSGEKQGEM  817
            D L+ NGNFE GP   P+   G  +I PH       +P W++ S   V+YI         
Sbjct  211  DNLLKNGNFEEGPYMFPNTDWGV-LIPPHIEDDQCPLPGWIVDSLKAVKYIDREH-----  264

Query  816  VLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRT---CAQEERLNVSVSPNS  652
               VP+G  AV L  G++++I+ TV+ I    Y L+F    T   C     + V    + 
Sbjct  265  -FTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSNSCVGSMVVEVYAGKDR  323

Query  651  EPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP--AREKDPS---CGPII  496
                      Q  Y S G   F    + F A SN  +I   +     + D S   CGP++
Sbjct  324  T---------QVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVL  374

Query  495  DSVALKLLNAPRR  457
            D V L  +  PRR
Sbjct  375  DDVKLVSVRNPRR  387



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   465 bits (1197),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 218/340 (64%), Positives = 273/340 (80%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L + LC   H  L   I DG + NGNFE  PKPS ++G+ VI  + IPKW IS GFVEYI
Sbjct  8     LSVLLCATCHSALS--IIDGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEIS-GFVEYI  64

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP+G++AVRLG +ASI   ++V KG YYS++F+  RTCAQEERLN+SV
Sbjct  65    KSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISV  124

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G+LP+QT+YSS G+D+Y+WAF A+  +++++LHNP  E+DP+CGP+IDS+A
Sbjct  125   APDS-----GVLPIQTVYSSNGWDSYAWAFQADYEQIELLLHNPGVEEDPACGPLIDSIA  179

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             ++ L  PR    N+LKN  FEEGPY+ PN +WGVLIPPNIEDDHSPLPGW++ESLKAVKY
Sbjct  180   IRTLYPPRATNKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKY  239

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             IDSNHF VP G RAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAFA
Sbjct  240   IDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFA  299

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR T++VPY+SKGKGGF RA  +F AVSTRTR+ FLS++Y
Sbjct  300   GRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYY  339



>ref|XP_004302947.1| PREDICTED: uncharacterized protein LOC101306247 [Fragaria vesca 
subsp. vesca]
Length=373

 Score =   465 bits (1196),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 268/323 (83%), Gaps = 1/323 (0%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            TDGL+PNGNFE GPKPSQMKG+ V   + IP W  +SG+VEYIKSG KQG+M+LVVP+G 
Sbjct  23   TDGLLPNGNFEYGPKPSQMKGTVVTAHNAIPNWE-TSGYVEYIKSGHKQGDMLLVVPEGG  81

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
             A+RLG +ASI   ++V KGG+Y+++F+  RTCAQEE LN+SV+PN E  D+GILP+QTM
Sbjct  82   FAIRLGNEASIKQKIKVTKGGFYAITFSAARTCAQEEILNISVNPNVEKQDFGILPIQTM  141

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            YSSTG+D+Y+W F A+++ +++ +HNP  E+DP+CGP+IDSVALK+L  P+R R N+LKN
Sbjct  142  YSSTGWDSYAWGFNADADEIELTIHNPGVEEDPACGPLIDSVALKVLEIPKRTRANLLKN  201

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
            G+FEEGPY+ PNT+WGVLIPP+IEDDHSPLPGWIIESLKAVKYIDS HF VP G RA+EL
Sbjct  202  GNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHFAVPEGRRAIEL  261

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            +AG+ESA+ Q+V T PG+ Y L FSVGD NN CEGS+ +EAFAG+ T++VPY+SKGKGGF
Sbjct  262  IAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETVKVPYESKGKGGF  321

Query  72   IRANHRFTAVSTRTRIRFLSSFY  4
             +A   FTAVS RTR+ FLS+ Y
Sbjct  322  KKARLFFTAVSPRTRVMFLSTMY  344



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   464 bits (1193),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 270/346 (78%), Gaps = 3/346 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M + T L++ LC  + + L   +TDGL+PNG+FE GPKPS+MKG+ V   + IP W IS 
Sbjct  1     MYRATVLLVSLCITWQLALS--VTDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GF+EYIKSG KQG+M+LVVP G++AVRLG +ASI   V+V +G +YSL+F   RTCAQEE
Sbjct  58    GFIEYIKSGHKQGDMLLVVPVGAYAVRLGNEASIKQKVKVTQGKFYSLTFNVARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LN+SVS NSEP DWGILP+QTMYSS G+D Y+WAF AE   V+I +HNP  E+D +CGP
Sbjct  118   KLNLSVSSNSEPRDWGILPMQTMYSSNGWDAYAWAFHAEGPEVEISIHNPGVEEDAACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             ++DSVALKLL+ P+R R N+LKNG+FEEGPY+ PNT WGVLIPP+ EDD  PLPGWI++S
Sbjct  178   LVDSVALKLLSNPKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCPLPGWIVDS  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G RAVEL+AG+ESA+ QIV+TI  K+Y L F+VGD +NSC GSM
Sbjct  238   LKAVKYIDSEHFTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VE +AG+   QVPY+S GKGGF RA   F AVS  TRI FLSSFY
Sbjct  298   VVEVYAGKDRTQVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFY  343


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 82/193 (42%), Gaps = 38/193 (20%)
 Frame = -3

Query  969  DGLVPNGNFERGPK--PSQMKGSRVIDPHG------IPKWVISS-GFVEYIKSGEKQGEM  817
            D L+ NGNFE GP   P+   G  +I PH       +P W++ S   V+YI S       
Sbjct  195  DNLLKNGNFEEGPYMFPNTDWGV-LIPPHNEDDQCPLPGWIVDSLKAVKYIDSEH-----  248

Query  816  VLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRT---CAQEERLNVSVSPNS  652
               VP+G  AV L  G++++I+  V+ I    Y L+F    T   C     + V    + 
Sbjct  249  -FTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSMVVEVYAGKDR  307

Query  651  EPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP--AREKDPS---CGPII  496
                      Q  Y S G   F    + F A SN  +I   +     + D S   CGP++
Sbjct  308  T---------QVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVL  358

Query  495  DSVALKLLNAPRR  457
            D V L  +  PRR
Sbjct  359  DDVKLVSVRNPRR  371



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   464 bits (1193),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 274/347 (79%), Gaps = 2/347 (1%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             K+ K T +++ LC I H      + +GL+PNGNFE GPKPS+MKG+ V++   IP W IS
Sbjct  2     KVCKATVVLVLLCAISHTAFS-AVRNGLLPNGNFEYGPKPSEMKGTLVLNRKAIPNWEIS  60

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              G VEYIKSG  QG+M+LVVP+G+ AVRLG +ASI   VR+IK G+YSL+F+  RTCAQE
Sbjct  61    -GEVEYIKSGHTQGDMLLVVPEGAFAVRLGNEASIKQKVRMIKDGFYSLTFSAARTCAQE  119

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E+LNVSVS + EPNDWGILP+QTMYSS G+D+YS+ F A++++++I++HNP  E+DP+CG
Sbjct  120   EKLNVSVSRSLEPNDWGILPMQTMYSSNGWDSYSYGFKADASQIEIIIHNPGVEEDPACG  179

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+IDSVALKLL+ P+R R N+LKNG+FEEGPY+ PN  WGVLIPP+I+D HSPLPGWII+
Sbjct  180   PVIDSVALKLLSLPKRTRANLLKNGNFEEGPYVFPNAPWGVLIPPHIDDAHSPLPGWIID  239

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKYIDS+HF VP G RA+ELV G+ES++ QIVRT PGK Y L F+VGDA NSC GS
Sbjct  240   SLKAVKYIDSDHFHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNSCVGS  299

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +G+EAFAG  T +V Y S G GGF RA  RF A   RTR+ F S+FY
Sbjct  300   LGIEAFAGNGTTKVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFY  346



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   463 bits (1192),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 272/340 (80%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L + LC   H  L   + DG + NGNFE  PKPS ++G+ VI  + IPKW IS GFVEYI
Sbjct  8     LSVLLCATCHSALS--LIDGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEIS-GFVEYI  64

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG KQG+M+LVVP+G++AVRLG +ASI   ++V KG YYS++F+  RTCAQEERLN+SV
Sbjct  65    KSGHKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISV  124

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G+LP+QT+YSS G+D+Y+WAF ++  ++++VLHNP  E+DP+CGP+IDS+A
Sbjct  125   APDS-----GVLPIQTVYSSNGWDSYAWAFQSDYEQIELVLHNPGVEEDPACGPLIDSIA  179

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             ++ L  PR    N+LKN  FEEGPY+ PN +WGVLIPPNIEDDHSPLPGW++ESLKAVKY
Sbjct  180   IRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKY  239

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             IDSNHF VP G RAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAFA
Sbjct  240   IDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFA  299

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR T++VPY+SKGKGGF RA  +F AVSTRTR+ FLS++Y
Sbjct  300   GRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYY  339



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   463 bits (1191),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 219/350 (63%), Positives = 273/350 (78%), Gaps = 8/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKKM    A +L LC+   + L   ITDGL+PNGNFE  PK S + G++V+  + IP+W 
Sbjct  1     MKKMMHCAAAILLLCSAVPIALA--ITDGLLPNGNFEAKPKASDLNGTQVMSRYAIPQWE  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI+SG KQG+M+LVVP+G++AVRLG +ASI   ++V+KG YYS++F+  RTCA
Sbjct  59    IS-GFVEYIESGHKQGDMLLVVPEGAYAVRLGNEASIKQKLKVVKGMYYSITFSAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+S     G+LP+QT Y S G+D+Y+WAF A    V +V+HNP  E+DP+
Sbjct  118   QDERLNVSVTPDS-----GLLPIQTTYGSDGWDSYAWAFRATLEEVHLVIHNPGVEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA+K L  P+    N+LKN DFEEGPY+LPNTTWGVLIPPNIEDDHSPLPGW 
Sbjct  173   CGPLIDSVAIKTLYPPKLTGDNLLKNRDFEEGPYVLPNTTWGVLIPPNIEDDHSPLPGWT  232

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+ RT+PGKVY L FS+GDA N C 
Sbjct  233   VESLKAVKYIDSDHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGNGCV  292

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFAGR T ++PY+SKG GG+ R   RFTAV+ RTR+ F S+FYH
Sbjct  293   GSMVVEAFAGRGTAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYH  342



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   462 bits (1190),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 275/341 (81%), Gaps = 9/341 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             L + LC  FHV     I DGLV NGNFE GPKPS +KG+ VI   H IP+W IS GFVEY
Sbjct  8     LSVLLCATFHVSFS--IIDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEIS-GFVEY  64

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
             V+P     DWG++P+QT+Y+S+G+D  ++ F AES  V++++HNP +E+DP+CGP++DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPGKEEDPACGPLVDSV  179

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             AL+ L  P+    N+LKNG FEEGPY+ PN++WGV+IPPNIEDDHSPLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             YIDS+HF VP G RAVEL+AG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AG+ T++VPY+SKG GGF RA  +F AV+ RTR+ FLS+FY
Sbjct  300   AGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFY  340



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   462 bits (1189),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 273/347 (79%), Gaps = 4/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  +  +++ LC I  V L     DGLVPNG+FE GPKP QM G+ V+DPH +P W +S 
Sbjct  1     MKSVNVVLVLLCAILPVALS--FIDGLVPNGDFEEGPKPWQMHGTEVVDPHSVPHWELS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIKSG+KQG+M+L VP+G  A+RLG +ASI T V+V KG +YSLSF   RTCAQ+E
Sbjct  58    GFVEYIKSGQKQGDMILPVPKGHFALRLGNEASIKTKVQVAKGLFYSLSFGAARTCAQQE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LN+SVSPNSEP DWG+LP+QTMYS+ G+D++SW FLAESN V+++ H+P  ++D +CGP
Sbjct  118   QLNLSVSPNSEPKDWGMLPMQTMYSTEGWDSFSWGFLAESNEVEVIFHHPQTQEDRACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             IID VALK    P++ R ++L+NG+FEEGPY+LPNT+WG+LIPPN+EDDHSPL GW++ES
Sbjct  178   IIDLVALKSFTLPKKSR-DILQNGNFEEGPYVLPNTSWGILIPPNVEDDHSPLVGWMVES  236

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAV+YIDS+HF VP G RAVELVAGRES+V Q+V+T+PGK Y+L F VGDA N CEGSM
Sbjct  237   LKAVRYIDSDHFAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNMCEGSM  296

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VE  A   T  VPY+SKGKGG   A  RF A + RTRIRFLSS+YH
Sbjct  297   LVEVNASNSTFYVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYH  343



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   462 bits (1189),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 215/323 (67%), Positives = 266/323 (82%), Gaps = 1/323 (0%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            TDGL+PNG+FE GPK S++KGS V    GIP W IS GFVEYIKSG+KQG+M+L+VP+G+
Sbjct  22   TDGLLPNGDFEVGPKASELKGSVVTSHDGIPNWTIS-GFVEYIKSGQKQGDMLLIVPEGA  80

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
            +AVRLG +A I   V++ KG +YS++F+  RTCAQEE+LNVSV P +E  D+GI+P+QTM
Sbjct  81   YAVRLGNEAYIKQKVKLNKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDYGIIPIQTM  140

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            Y S G+++++  F A+  + +IV+HN   E DP+CGP+IDSVALK+LN PRR R N+LKN
Sbjct  141  YGSNGWESFACGFKADYEQGEIVIHNSGVEDDPACGPLIDSVALKVLNPPRRTRANLLKN  200

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
            G+FEEGPY+ PN +WGVLIPP+IED H PLPGWI+ESLKAVKYIDS HF VP G RA+EL
Sbjct  201  GNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSKHFYVPEGNRAIEL  260

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            VAG+ESA+ Q+V T  GKVY+L FSVGDANNSCEGSM VEAFAG  T+QVPY+SKGKGGF
Sbjct  261  VAGKESALAQVVITTIGKVYDLTFSVGDANNSCEGSMTVEAFAGGDTVQVPYESKGKGGF  320

Query  72   IRANHRFTAVSTRTRIRFLSSFY  4
            +R   RFTA+STRTRIRFLS+FY
Sbjct  321  VRGKLRFTALSTRTRIRFLSTFY  343



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 275/341 (81%), Gaps = 9/341 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             L + LC  FHV     I DGLV NGNFE GPKPS +KG+ V+   H IP+W IS GFVEY
Sbjct  8     LSVLLCATFHVSFS--IIDGLVANGNFELGPKPSALKGTVVVGGSHSIPEWEIS-GFVEY  64

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEERLN+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNIS  124

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
             V+P     DWG++P+QT+Y+S+G+D  ++ F AES  V++++HNP +E+DP+CGP++DSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPGKEEDPACGPLVDSV  179

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             AL+ L  P+    N+LKNG FEEGPY+ PN++WGV+IPPNIEDDHSPLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             YIDS+HF VP G RAVEL+AG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AG+ T++VPY+SKG GGF RA  +F AV+ RTR+ FLS+FY
Sbjct  300   AGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFY  340



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   464 bits (1193),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 222/354 (63%), Positives = 277/354 (78%), Gaps = 12/354 (3%)
 Frame = -3

Query  1053  YMKKMTKLTALVLFLCTI----FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHG  886
             Y +  T   A V+FL  +    FH  L   + DG +PNG+FERGPK S M G+ V  P+ 
Sbjct  49    YTELPTMHNAAVIFLSVLLSAAFHPALS--LVDGYLPNGDFERGPKASDMNGTVVKGPYA  106

Query  885   IPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTF  706
             IP+W IS GFVEYIKSG+KQG+M+LVVP+G+ AVRLG +ASI   ++V+KG YYS++F+ 
Sbjct  107   IPEWEIS-GFVEYIKSGQKQGDMLLVVPEGAFAVRLGNEASIKQKIKVVKGLYYSITFSA  165

Query  705   VRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAR  526
              RTCAQEERLN+SV+P     DWG+LP+QT+Y+S G+D Y+WAF AES+ V I++HNP  
Sbjct  166   ARTCAQEERLNISVAP-----DWGVLPMQTLYNSNGWDLYAWAFQAESDEVVILIHNPGE  220

Query  525   EKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSP  346
             E+DP+CGP+ID++A+K LN P+    N++KNGDFE GPY+ PN + GVL+PPNIEDDHSP
Sbjct  221   EEDPACGPLIDAIAIKTLNPPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSP  280

Query  345   LPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDA  166
             +PGW++ESLKAVKYIDS+HF VPSG RAVELVAG+ESA+ QIVRTIPGK Y L F VGDA
Sbjct  281   IPGWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDA  340

Query  165   NNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +NSCEGSM VEAFAG+ TL+VPYQSKG GG   A  +F A STRTRI FLS+FY
Sbjct  341   SNSCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFY  394


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 81/191 (42%), Gaps = 36/191 (19%)
 Frame = -3

Query  969  DGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQGEMV  814
            D LV NG+FE GP   P+   G      + D H  IP W++ S   V+YI S        
Sbjct  246  DNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSDH------  299

Query  813  LVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVSPNSE  649
              VP G  AV L  G++++I   VR I G  Y LSF       +C     +      N+ 
Sbjct  300  FSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNT-  358

Query  648  PNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGPIID  493
                    L+  Y S G       +  F AES R +I+  +     R  D S  CGP++D
Sbjct  359  --------LKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLD  410

Query  492  SVALKLLNAPR  460
             V L  +  P+
Sbjct  411  KVRLLSVRNPK  421



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   459 bits (1181),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 221/349 (63%), Positives = 277/349 (79%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ +  L +++LF     H      + DG + NGNFE  PKPS +KGS VI  + IPKW 
Sbjct  1     MRGVAVLLSVLLFATC--HSAFS--LIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIKSG+KQG+M+LVVP+G++AVRLG +ASI  +++V KG YYS++F+  RTCA
Sbjct  57    IS-GFVEYIKSGQKQGDMLLVVPZGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSV+P+S     G+LP+QT+YSS G+D+Y+WAF A+   V++VLHNP  E+DP+
Sbjct  116   QEERLNVSVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA++ L  PR    N+LKN  FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW+
Sbjct  171   CGPLIDSVAIRTLYPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+VRTIPGK Y L FSVGDA+NSCE
Sbjct  231   VESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCE  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFA + T++VPY+SKGKGGF RA  +F A STRTR+ FLS++Y
Sbjct  291   GSMIVEAFADKNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYY  339



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   459 bits (1182),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 269/323 (83%), Gaps = 1/323 (0%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            T+GL+PNGNFERGPK S+MKGS VI  + IP W I+ G VEYIKSG+KQG+M+LVVP+G 
Sbjct  26   TNGLLPNGNFERGPKASEMKGSVVIGQNAIPNWTIT-GLVEYIKSGQKQGDMLLVVPEGD  84

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
            +AVRLG++ASI   V++ +G +Y+++F   RTCAQEE+LNVSV P +E  DWGI+P+QTM
Sbjct  85   YAVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDWGIIPIQTM  144

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            Y S G+++++  F A+    +IV+HNP +E+DP+CGP+IDSVALK+L+ P+R R N+LKN
Sbjct  145  YGSNGWESFTCGFRADFPEAEIVIHNPGKEEDPACGPLIDSVALKVLDPPKRTRANLLKN  204

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
            G+FEEGPY+ PN++WG LIPP+IED HSPLPGWI+ESLKAVKYIDS+HF VP G RA+EL
Sbjct  205  GNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHFAVPEGKRAIEL  264

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            VAG+ESA+ Q+V T  G+VY+L F+VGDANN+CEGSM VEAFAG  T+Q+PYQSKGKGG 
Sbjct  265  VAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPYQSKGKGGS  324

Query  72   IRANHRFTAVSTRTRIRFLSSFY  4
            +R   RF AV+TRTR+RFLS+FY
Sbjct  325  VRGKLRFKAVATRTRLRFLSTFY  347



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   458 bits (1179),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/349 (63%), Positives = 274/349 (79%), Gaps = 9/349 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M K+   V  L ++     C     + DG + NGNFE  PKPS +KGS VI  + IPKW 
Sbjct  1     MIKIMRGVAVLLSVLLFATCHSAFSLIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIKSG+KQG+M+LVVP+G++AVRLG +ASI  +++V KG YYS++F+  RTCA
Sbjct  61    IS-GFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSV+P+S     G+LP+QT+YSS G+D+Y+WAF A+   V++VLHNP  E+DP+
Sbjct  120   QEERLNVSVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA++ L  PR    N+LKN  FEEGPY+ PN +WGVLIPPNIEDDHSPLPGW+
Sbjct  175   CGPLIDSVAIRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+VRTIPGK Y L FSVGDA+NSCE
Sbjct  235   VESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCE  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFA + T++VPY+SKGKGG+ RA  +F A STRTR+ FLS++Y
Sbjct  295   GSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYY  343


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 84/191 (44%), Gaps = 30/191 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     L+ N  FE GP   P+   G      + D H  +P W++ S   V+YI S    
Sbjct  191  RATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDH--  248

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VP+G  AV L  G++++I   VR I G  Y LSF+ V   +     ++ V   +
Sbjct  249  ----FSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFS-VGDASNSCEGSMIVEAFA  303

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL---HNPAREKDPS--CGPII  496
            + N      ++  Y S G   Y  A   F+A S R +++    +   R  D S  CGP++
Sbjct  304  DKNT-----VKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVV  358

Query  495  DSVALKLLNAP  463
            D V L  L  P
Sbjct  359  DDVKLLSLRKP  369



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   458 bits (1178),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 273/349 (78%), Gaps = 8/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ + ++   VL +    H       TDGL+PNG+FE+GPKPS MKGS V++ H IP W 
Sbjct  1     MRMVNEILVSVLLVFATCH--FVSAFTDGLLPNGDFEKGPKPSDMKGSEVLNRHAIPNWE  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYIKSG+KQG+M+LVVP+G+ AVRLG +ASI   V V KG  Y+++F   RTCA
Sbjct  59    LS-GFVEYIKSGQKQGDMLLVVPEGAFAVRLGNEASIKQRVSVTKGMNYAITFCAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE+LNVSV+P     +WG+LP+QT+YSS+G+D Y+W F+A S   +I++HNP  E+DP+
Sbjct  118   QEEQLNVSVTP-----EWGVLPMQTLYSSSGWDCYAWGFVALSKVAEIMIHNPGVEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA+++L  P+R   N+LKNG+FEEGPYI  NT+WG LIPPNIED HSPLPGW+
Sbjct  173   CGPLIDSVAMRVLYPPKRTGLNLLKNGNFEEGPYIFRNTSWGTLIPPNIEDAHSPLPGWM  232

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKY+DS+HF VPSG RA+ELVAG+ESA+ Q+VRT+PGK+Y L F+VGDANN+C 
Sbjct  233   IESLKAVKYLDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANNACS  292

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T +VPY SKGKGGF RA  RF A  TRTRI F S+FY
Sbjct  293   GSMVVEAFAGKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFY  341



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   457 bits (1177),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 269/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V LC   TDG++PNG+FE GPKPS MKG+RVI+ + IP W +S GFVEYI
Sbjct  11    FVLLIATITSV-LC--FTDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELS-GFVEYI  66

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  67    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  126

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  127   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  181

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPYILPN T GVLIPP IEDDHSPLP W+IESLKAVKY
Sbjct  182   IKALYPPRPTNKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSPLPAWMIESLKAVKY  241

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  242   VDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFA  301

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+S+GKGGF RA+ RF AVS RTRI F S+FY
Sbjct  302   GRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFY  341



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   457 bits (1177),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 276/349 (79%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ +  L ++VLF     H      + DG + NGNFE  PKPS +KGS VI  + IPKW 
Sbjct  1     MRGVAVLLSVVLFATC--HSAFS--LIDGYLENGNFELPPKPSDIKGSEVIGRYAIPKWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIKSG+KQG+M+LVVP+G++AVRLG +ASI  +++V KG YYS++F+  RTCA
Sbjct  57    IS-GFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQSIKVTKGLYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSV+P+S     G+LP+QT+YSS G+D+Y+WAF A+   V++VLHNP  E+DP+
Sbjct  116   QEERLNVSVAPDS-----GVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA++ L  PR    N+LKN  FEEGPY+ PN +WGVLIPPNIEDDHSPLPGW+
Sbjct  171   CGPLIDSVAIRTLYPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+VRTIPGK Y L FSVGDA+NSCE
Sbjct  231   VESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCE  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFA + T++VPY+SKGKGG+ RA  +F A STRTR+ FLS++Y
Sbjct  291   GSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYY  339


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 84/191 (44%), Gaps = 30/191 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     L+ N  FE GP   P+   G      + D H  +P W++ S   V+YI S    
Sbjct  187  RATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VP+G  AV L  G++++I   VR I G  Y LSF+ V   +     ++ V   +
Sbjct  245  ----FSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFS-VGDASNSCEGSMIVEAFA  299

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL---HNPAREKDPS--CGPII  496
            + N      ++  Y S G   Y  A   F+A S R +++    +   R  D S  CGP++
Sbjct  300  DKNT-----VKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVV  354

Query  495  DSVALKLLNAP  463
            D V L  L  P
Sbjct  355  DDVKLLSLRKP  365



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   457 bits (1177),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 269/340 (79%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L + L   FH  L   + DG +PNG+FERGP  S M G+ V  P+ IP+W IS GFVEYI
Sbjct  9     LSVLLSAAFHPALS--LVDGYLPNGDFERGPNASDMNGTVVKGPYAIPEWEIS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP+G+ AVRLG +ASI   ++V+KG YYS++F+  RTCAQEERLN+SV
Sbjct  66    KSGQKQGDMLLVVPEGAFAVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P     DWG+LP+QT+Y+S G+D Y+WAF AES+ V I++HNP  E+DP+CGP+ID++A
Sbjct  126   AP-----DWGVLPMQTLYNSNGWDLYAWAFQAESDEVVILIHNPGEEEDPACGPLIDAIA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  P+    N++KNGDFE GPY+ PN + GVL+PPNIEDDHSP+PGW++ESLKAVKY
Sbjct  181   IKTLYPPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             IDS+HF VPSG RAVELVAG+ESA+ QIVRTIPGK Y L F VGDA+NSCEGSM VEAFA
Sbjct  241   IDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+VPYQSKG GG   A  +F A STRTRI FLS+FY
Sbjct  301   GKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFY  340


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 84/186 (45%), Gaps = 24/186 (13%)
 Frame = -3

Query  972  TDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQGEM  817
             D LV NG+FE GP   P+   G      + D H  IP W++ S   V+YI S       
Sbjct  191  NDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSDH-----  245

Query  816  VLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPN  643
               VP G  AV L  G++++I   VR I G  Y LSF  V   +     ++ V   +  N
Sbjct  246  -FSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFV-VGDASNSCEGSMVVEAFAGKN  303

Query  642  DWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGPIIDSVALK  478
               + P Q+   + G    +  F AES R +I+  +     R  D S  CGP++D V L 
Sbjct  304  TLKV-PYQSK-GNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLL  361

Query  477  LLNAPR  460
             +  P+
Sbjct  362  SVRNPK  367



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 224/349 (64%), Positives = 273/349 (78%), Gaps = 11/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+    L+ L+L  C  F V     I DGL+ NGNFE GPK S + G++V+  + IP+W 
Sbjct  1     MRGAILLSVLLLAACQ-FSVS----IRDGLIENGNFELGPKQSDLNGTKVLGRYAIPRWE  55

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F+  RTCA
Sbjct  56    IS-GFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQKLKVIKGMYYSITFSAARTCA  114

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEE LNVSVSP+S     G+LP+QTMYSS G+D+Y+WAF AE   V +V+HNP  E+DP+
Sbjct  115   QEEALNVSVSPDS-----GVLPMQTMYSSNGWDSYAWAFQAEYPVVDLVIHNPGVEEDPA  169

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDSVA++ L  PR    N+LKNG FEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+
Sbjct  170   CGPLIDSVAIRALYPPRPTNKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWM  229

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKYIDS+HF VP   RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDA+NSCE
Sbjct  230   IESLKAVKYIDSDHFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNSCE  289

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+SKGKGGF RA  RF A S RTRI F S+FY
Sbjct  290   GSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFY  338



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   457 bits (1175),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 266/324 (82%), Gaps = 6/324 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            + DG + NGNFE  PKPS +KG+ VI  + IPKW IS GFVEYIKSG+KQG+M+LVVP+G
Sbjct  23   VLDGYLENGNFELAPKPSDLKGTEVIGRYAIPKWEIS-GFVEYIKSGQKQGDMLLVVPEG  81

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   + V KG YYS++F+  RTCAQEERLN+SV+P+S     G+LP+QT
Sbjct  82   AYAVRLGNEASIKQRINVTKGLYYSITFSAARTCAQEERLNISVAPDS-----GVLPIQT  136

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +YSS G+D+Y+WAF A+  ++++VLHNP  E+DP+CGP+IDS+A++ L  PR    N+LK
Sbjct  137  VYSSNGWDSYAWAFQADFPQIELVLHNPGVEEDPACGPLIDSIAIRTLYPPRATNKNLLK  196

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            N  FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW++ESLKAVKYIDS+HF VP G RAVE
Sbjct  197  NAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHFSVPEGKRAVE  256

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LVAG+ESA+ QIVRTIPGK Y L FSVGDA+NSCEGSM VEAFAGR T++VPY+SKGKGG
Sbjct  257  LVAGKESAIAQIVRTIPGKTYMLTFSVGDASNSCEGSMIVEAFAGRDTIKVPYESKGKGG  316

Query  75   FIRANHRFTAVSTRTRIRFLSSFY  4
            F RA  +F AV  RTRI FLS+FY
Sbjct  317  FKRAVLKFRAVGPRTRIMFLSTFY  340



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 274/341 (80%), Gaps = 9/341 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             L + LC+ FHV     I DGLV NGNFE GPK S +KG+ V+     IP+W IS GFVEY
Sbjct  8     LSVLLCSTFHVSFS--IIDGLVANGNFELGPKASDLKGTVVVGGSKSIPEWEIS-GFVEY  64

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQG+M+LVVP+G++AVRLG +ASI  T++V+KG YYS++F   RTCAQEER+N+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQTLKVMKGMYYSITFMVARTCAQEERINIS  124

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
             V+P     DWG++P+QT+Y+S+G+D  ++ F AES  V++++HNP +E+DP+CGP+IDSV
Sbjct  125   VTP-----DWGVIPIQTLYTSSGWDPIAFGFRAESETVEMLIHNPGKEEDPACGPLIDSV  179

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             AL+ L  P+    N+LKNG FEEGPY+ PN++WGV+IPPNIEDDHSPLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVK  239

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             YIDS+HF VP G RAVEL+AG+ESA+ Q+ RTIPGK Y L FSVGDA+N CEGSM VEAF
Sbjct  240   YIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNYCEGSMIVEAF  299

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AG+ T++VPY+SKGKGGF RA  +F AV  RTR+ FLS+FY
Sbjct  300   AGKDTIKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFY  340



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   454 bits (1169),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 213/321 (66%), Positives = 266/321 (83%), Gaps = 6/321 (2%)
 Frame = -3

Query  966  GLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHA  787
            G + NGNFE  PKPS +KGS VI  + IPKW IS GFVEYIKSG+KQG+M+LVVP+G++A
Sbjct  5    GYLENGNFELPPKPSDLKGSEVIGRYAIPKWEIS-GFVEYIKSGQKQGDMLLVVPEGAYA  63

Query  786  VRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYS  607
            VRLG +A I  +++VIKG YYS++F+  RTCAQEERLN+SV+P+S     G+LP+QT+YS
Sbjct  64   VRLGNEALIKQSIKVIKGLYYSITFSAARTCAQEERLNISVAPDS-----GVLPIQTVYS  118

Query  606  STGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGD  427
            S G+D+Y+WAF A+   +++VLHNP  E+DP+CGP+IDSVA + L  PR    N++KN  
Sbjct  119  SNGWDSYAWAFQADYETIELVLHNPGVEEDPACGPLIDSVAFRTLYPPRATNKNLIKNAG  178

Query  426  FEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVA  247
            FEEGPY+ PNT+WGVLIPPNIEDDHSPLPGW++ESLKAVKYIDS+HF VP G RAVELVA
Sbjct  179  FEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDHFSVPEGKRAVELVA  238

Query  246  GRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIR  67
            G+ESA+ Q+VRTIPGK Y L FSVGDA+NSCEGS+ VEAFAG+ T++VPY+SKGKGGF R
Sbjct  239  GKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSLIVEAFAGKNTVKVPYESKGKGGFKR  298

Query  66   ANHRFTAVSTRTRIRFLSSFY  4
            A  +F AVSTRTR+ FLS++Y
Sbjct  299  AVLKFVAVSTRTRVMFLSTYY  319



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   455 bits (1170),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 268/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V LC   TD ++PNG+FE GPKPS MKG+RVI+ + IP W +S GFVEYI
Sbjct  11    FVLLIATITSV-LC--FTDAMLPNGDFELGPKPSDMKGTRVINKNAIPSWELS-GFVEYI  66

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  67    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  126

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  127   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  181

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPYILPN T GVL+PP IEDDHSPLP W+IESLKAVKY
Sbjct  182   IKALYPPRPTNKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSPLPAWMIESLKAVKY  241

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  242   VDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFA  301

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+S+GKGGF RA+ RF AVS RTRI F S+FY
Sbjct  302   GRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFY  341



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   455 bits (1170),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 269/329 (82%), Gaps = 6/329 (2%)
 Frame = -3

Query  987  LCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLV  808
            L    TDGL+PNGNFE+GPKP Q+KG++V     IP+W I+ GFVEYI+ G+KQG+M+LV
Sbjct  17   LAAAFTDGLLPNGNFEQGPKPWQLKGTKVAGRDAIPRWQIT-GFVEYIQWGQKQGDMLLV  75

Query  807  VPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGIL  628
            VP+GS+AVRLG DASI  +V+V KG  YSL+F+  RTCAQEERLNVS SP S     G+L
Sbjct  76   VPEGSYAVRLGNDASIKQSVKVTKGVRYSLTFSAARTCAQEERLNVSASPES-----GVL  130

Query  627  PLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRG  448
            P+QTMYSS G+D+Y+WA+LA+S+ V++V+HN    +DP+CGP+IDSVA+K L  PRR   
Sbjct  131  PMQTMYSSNGWDSYAWAWLAKSDEVEVVIHNTGVSEDPACGPLIDSVAIKQLFPPRRTNT  190

Query  447  NMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGT  268
            N+LKNGDFEEGPYILPNTTWGVLIPP IEDDHSPLPGW++ESLKAVKY+D+ HF VP G 
Sbjct  191  NLLKNGDFEEGPYILPNTTWGVLIPPQIEDDHSPLPGWMVESLKAVKYLDAEHFSVPRGR  250

Query  267  RAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSK  88
            RAVEL+AG+ESA+ Q+VRT+PG+ Y L F+VGDA+N+CEGS+ VEAFAG  T++VPY+SK
Sbjct  251  RAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASNACEGSLLVEAFAGEHTIKVPYESK  310

Query  87   GKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            G+GG  RA  +FTA + RTR+ F SS+Y+
Sbjct  311  GRGGSKRAVLQFTATTARTRVVFWSSYYN  339



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   455 bits (1170),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 267/336 (79%), Gaps = 8/336 (2%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C+  H+     +TDGL+PNGNFE  PK S+M G++V+  + IP+W IS GFVEYI+SG K
Sbjct  13    CSAVHIAFA--MTDGLLPNGNFEATPKASEMNGTQVLGRYAIPQWEIS-GFVEYIESGHK  69

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             QG+M+LVVP+G++AVRLG +ASI   + V+KG YYS++F+  RTCAQ+ERLNVSV+P+S 
Sbjct  70    QGDMLLVVPEGAYAVRLGNEASIKQKLTVVKGMYYSITFSAARTCAQDERLNVSVTPDS-  128

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
                 G+LP+QTMY S G+D+Y+WAF A    V +V+HNP  E+DP+CGP+IDSVA+K L 
Sbjct  129   ----GMLPIQTMYGSVGWDSYAWAFRALFEVVHLVIHNPGVEEDPACGPLIDSVAIKTLY  184

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              PR  R N+LKN DFEEGPY+ PNTTWGVLIPPNIEDDHSPLPGW++ESLKAVKYIDS+H
Sbjct  185   PPRLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDH  244

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G RAVELVAG+ESA+ Q+ RTIPGKVY L FSVGDA N C GSM VEAFA R T+
Sbjct  245   FSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNGCVGSMVVEAFASRGTV  304

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             ++PY+SKG GG+ RA  RFTA   RTR+ FLS+FYH
Sbjct  305   KIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYH  340


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 83/196 (42%), Gaps = 34/196 (17%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            RL  D L+ N +FE GP   P+   G      + D H  +P W++ S   V+YI S    
Sbjct  187  RLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRT---CAQEERLNVSVS  661
                  VP G  AV L  G+++++    R I G  Y+L+F+       C     +    S
Sbjct  245  ----FSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNGCVGSMVVEAFAS  300

Query  660  PNSEPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVLHNP---AREKDPSCGPI  499
              +         ++  Y S G   Y  A   F A   R ++V  +     +     CGP+
Sbjct  301  RGT---------VKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDGSLCGPV  351

Query  498  IDSVALKLLNAPRRLR  451
            +D V+L  + +PR LR
Sbjct  352  VDDVSLLSVRSPRALR  367



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   455 bits (1170),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 271/349 (78%), Gaps = 9/349 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  L  L + LC  +H+ L      + +GL+ NGNFE+ P  S MKG+ V+  + IP WV
Sbjct  1     MQGLVLLSVLLCATYHIALSATNVTVAEGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWV  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
              + GFVEYIKSG+KQG+M+LVVP+G++AVRLG +ASI   ++V+KG YYS++F+  RTCA
Sbjct  61    -NEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQEIKVVKGMYYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNV+V+P+S     G++P+QT+YSS+G+D Y+WAF ++S+ V +++HNP  E+DP+
Sbjct  120   QEERLNVTVAPDS-----GVMPIQTVYSSSGWDNYAWAFKSQSDAVMLIIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID+VA+K L  PR    N++KNG FEEGPYI PNT WGVLIPPNIEDD+SPLP W+
Sbjct  175   CGPLIDAVAIKALYPPRPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWV  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS H+ VP G RAVELV G+ESA+ QI RTI GK Y L FSVGDANNSC 
Sbjct  235   VESLKAVKYIDSAHYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCA  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GS+ VEAFAG+ TL+VPY+SKG GGF RA  RF AVS RTRI FLS+FY
Sbjct  295   GSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFY  343


 Score = 51.2 bits (121),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 81/194 (42%), Gaps = 36/194 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKGSRV-----IDPHGIPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +      D   +P WV+ S   V+YI S    
Sbjct  191  RPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSAH--  248

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G++++I    R I G  Y LSF+      +CA    +     
Sbjct  249  ----YFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFA-  303

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP---AREKDPS--CG  505
                    G   L+  Y S G   F   +  F+A SNR +I+  +     R  D S  CG
Sbjct  304  --------GKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCG  355

Query  504  PIIDSVALKLLNAP  463
            P++D V L  +  P
Sbjct  356  PVVDDVKLLSIRNP  369



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   455 bits (1170),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 213/350 (61%), Positives = 273/350 (78%), Gaps = 13/350 (4%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLI---TDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M   T L +FLC    +  C L+    DGL+ NGNFE+ PK S++ G+ V+ P+ IPKW 
Sbjct  1     MEGFTLLSVFLC----LSTCHLVFALRDGLLDNGNFEQAPKASELNGTIVLKPNAIPKWR  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYIK+G+KQG+M+LVVP+G  AVRLG +ASI  ++ V KG YYSL+F+  RTCA
Sbjct  57    VS-GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASIKQSLNVSKGMYYSLTFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSV+P      +G+LP+QT+YSS G+D+Y+WAF A  +  +I++HNP  E+DP+
Sbjct  116   QEERLNVSVAPG-----FGVLPIQTLYSSNGWDSYAWAFQANHSVAEILIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A++ L  P+  R N+LKNGDFEEGPY+ PNT+WGVL+PPNIEDDHSPLP WI
Sbjct  171   CGPLIDSIAIRALYPPKATRDNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWI  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYID+ HF VP G RA+ELV G+ESA+ Q+ RTI GK YEL F++GDA+NSCE
Sbjct  231   VESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNSCE  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFAGR T++VPY+SKGKGG+ RA  RF A + RTRI F S++YH
Sbjct  291   GSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYH  340


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 36/193 (19%)
 Frame = -3

Query  969  DGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQGEMV  814
            D L+ NG+FE GP   P+   G      + D H  +P W++ S   V+YI +        
Sbjct  191  DNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWIVESLKAVKYIDAAH------  244

Query  813  LVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVSPNSE  649
              VP G  A+ L  G++++I    R I G  Y L+F       +C     +      ++ 
Sbjct  245  FSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNSCEGSMIVEAFAGRDT-  303

Query  648  PNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL-----HNPAREKDPSCGPIID  493
                    ++  Y S G   Y  A   F A + R +I+      H  + +    CGP++D
Sbjct  304  --------VKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFASLCGPVVD  355

Query  492  SVALKLLNAPRRL  454
             V L  ++ PRR+
Sbjct  356  DVKLLSVHKPRRM  368



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   455 bits (1170),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 273/346 (79%), Gaps = 11/346 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  L+ L+L  C   H      I DGLV NGNFE GPKPS +KG+ +I  + +PKW IS 
Sbjct  5     MLPLSVLLLATC---HFAFS--IKDGLVENGNFEVGPKPSDLKGTEMIGRYALPKWEIS-  58

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIK+G+KQG+M+LVVP+G++AVRLG +ASI   + V KG YYS++F+  RTCAQEE
Sbjct  59    GFVEYIKAGQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEE  118

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
              LN+S+SP     +WG+LP+QTMYSS G+D+Y+WAF A  + V++V+HNP  E+DP+CGP
Sbjct  119   ELNISISP-----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGP  173

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA+K L  PR    N++KNG FEEGPY+LPNT+WGVLIPPNIED HSPLPGW++ES
Sbjct  174   LIDSVAIKALYPPRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVES  233

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVK+ID  HF VP G RA+ELVAG+ESA+ Q+VRTI GK Y L F+VGDA+NSCEGSM
Sbjct  234   LKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSM  293

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ TL+VPY+SKGKGGF RA  +F AVS+RTR+ F S+FY
Sbjct  294   VVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFY  339



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   454 bits (1168),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 271/340 (80%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             LVL + TI  V LC   +DG+VPNG+FE GPKPS MKG++VI+ + IP W +S GFVEYI
Sbjct  10    LVLLIATITSV-LC--FSDGMVPNGDFELGPKPSDMKGTQVINKNAIPSWELS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  A+RLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN T GVL+PP IEDDHSPLP W+IESLKA+KY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMIESLKAIKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMIVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+VPY+S+GKGGF RA+ RF AVSTRTR+ F S+FY
Sbjct  301   GKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFY  340



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   454 bits (1169),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 212/348 (61%), Positives = 275/348 (79%), Gaps = 8/348 (2%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             +M  L  +++ +C IF++ L   +TDGL+ NGNFE       + G+ V+  + IP+W IS
Sbjct  5     RMKALLLVLVLMCAIFNISLS--LTDGLLKNGNFEMPLAKGNLNGTVVLKHNAIPEWSIS  62

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYIK+G+KQG+M+LVVP+G  AVRLG +ASI   + V KG YYSL+F+  RTCAQE
Sbjct  63    -GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQE  121

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ER+NVSV+P     D+G+LP+QT+YSS+G+D+Y+WAF AE ++V+++LHNP  E+DP+CG
Sbjct  122   ERINVSVTP-----DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGVEEDPACG  176

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+IDS+A++ L  PR    N+LKNGDFEEGPYI PNT+WGVL+PPNIEDDHSPLP W++E
Sbjct  177   PLIDSIAIRSLYPPRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVE  236

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+DS+HF VP G RA+ELVAG+ESA+ Q+ RT  GK+YEL F VGDA+NSCEGS
Sbjct  237   SLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGS  296

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             M VEAFAG  TL+VPY+SKGKGG+ RA  RF A + RTRI FLS++YH
Sbjct  297   MIVEAFAGMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYH  344


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 84/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     L+ NG+FE GP   P+   G      + D H  +P W++ S   V+Y+ S    
Sbjct  191  RATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDH--  248

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VPQG  A+ L  G++++I    R   G  Y LSF  V   +     ++ V   +
Sbjct  249  ----FSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFK-VGDASNSCEGSMIVEAFA  303

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL-----HNPAREKDPSCGPII  496
                 G+  L+  Y S G   Y  A   F A +NR +I+      H  + +    CGP++
Sbjct  304  -----GMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVSLCGPVV  358

Query  495  DSVALKLLNAPRRL  454
            D V L  +  PRR 
Sbjct  359  DDVKLLSVRNPRRF  372



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   454 bits (1169),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 217/347 (63%), Positives = 275/347 (79%), Gaps = 9/347 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVIS  865
             M     + L  C+ FHV L   + DGLV NGNFE GPKPS++KG+ V    + IP+W IS
Sbjct  11    MNVFLFMSLLFCSTFHVSLS--LIDGLVANGNFELGPKPSELKGTVVTGGKNSIPEWEIS  68

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              G VEYIKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQE
Sbjct  69    -GLVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQE  127

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ER+N+SV+P     D+G++P+QT+Y+S+G+D  ++ F AE + V++V+HNP  E+DP+CG
Sbjct  128   ERINISVAP-----DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACG  182

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+IDSVAL+ L  P+    N+LKNG FEEGPYI PNT++GV+IPPNIEDDHSPLPGW++E
Sbjct  183   PLIDSVALRTLYPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVE  242

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+DS HF VP GTRAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGS
Sbjct  243   SLKAVKYLDSGHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGS  302

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ T++VPY SKGKGGF RA  +F AV TRTR+ FLS+FY
Sbjct  303   MIVEAFAGKDTIKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFY  349



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   454 bits (1167),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 266/340 (78%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + T     LC   TDG++PNG+FE GPKPS +KG++VI  + IP W +S GFVEYI
Sbjct  10    FVLLIATTITSVLC--FTDGMLPNGDFELGPKPSDLKGTQVISKNAIPSWELS-GFVEYI  66

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  67    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  126

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  127   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  181

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPYILPN+T GVLIPP IEDDHSPLP W+IESLKAVKY
Sbjct  182   IKALYPPRPTNKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKY  241

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L FSVGDANN+C+GSM VEAFA
Sbjct  242   VDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNACQGSMVVEAFA  301

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+S+GKGGF RA  RF AVS RTRI F S+FY
Sbjct  302   GRDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFY  341



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   454 bits (1167),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 270/336 (80%), Gaps = 8/336 (2%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C IF++ L   +TDGL+ NGNFE     + + G+ V+  + IP+W IS GFVEYIK+G+K
Sbjct  17    CAIFNISLA--LTDGLLKNGNFEMPLAKADLNGTVVLKHNAIPEWSIS-GFVEYIKAGQK  73

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             QG+M+LVVP+G  AVRLG +ASI   + V KG YYSL+F+  RTCAQEER+NVSV+P   
Sbjct  74    QGDMLLVVPEGYAAVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTP---  130

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
               D+G+LP+QT+YSS+G+D+Y+WAF AE ++V+++LHNP  E+DP+CGP+IDSVA++ L 
Sbjct  131   --DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGVEEDPACGPLIDSVAIRTLY  188

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              PR    N+LKNGDFEEGPYI PNT+WGVL+PPNIEDDHSPLP W++ESLKAVKY+DS+H
Sbjct  189   PPRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDH  248

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G RA+ELVAG+ESA+ Q+ RT  GK+YEL F VGDA+NSCEGSM VEAFAGR TL
Sbjct  249   FSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGRDTL  308

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             +VPY+SKGKGGF RA  RF A + RTRI FLS++YH
Sbjct  309   KVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYH  344


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 83/194 (43%), Gaps = 30/194 (15%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     L+ NG+FE GP   P+   G      + D H  +P W++ S   V+Y+ S    
Sbjct  191  RATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSDH--  248

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VPQG  A+ L  G++++I    R   G  Y LSF  V   +     ++ V   +
Sbjct  249  ----FSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFK-VGDASNSCEGSMIVEAFA  303

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL-----HNPAREKDPSCGPII  496
                 G   L+  Y S G   +  A   F A +NR +I+      H  + +    CGP++
Sbjct  304  -----GRDTLKVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVSLCGPVV  358

Query  495  DSVALKLLNAPRRL  454
            D V L  +  PRR 
Sbjct  359  DDVKLLSVRNPRRF  372



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   452 bits (1164),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 220/349 (63%), Positives = 271/349 (78%), Gaps = 9/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK  T     VL + T+  +   R   DG++PNG+FE GPKPS MKG++VI+ + IP W 
Sbjct  1     MKGGTVSFLFVLLISTVTSIFCFR---DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWE  57

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYI+SG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCA
Sbjct  58    LT-GFVEYIQSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCA  116

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+
Sbjct  117   QDERLNISVAPDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPA  171

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA+K L  PR    N+LKNG FEEGPY+LPN+T GVLIPP IEDDHSPLP W+
Sbjct  172   CGPLIDGVAIKALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWM  231

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+CE
Sbjct  232   VESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACE  291

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAGR TL+VPYQSKGKGGF RA  RF AVSTRTR+ F S+FY
Sbjct  292   GSMIVEAFAGRDTLKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFY  340



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   452 bits (1162),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/340 (64%), Positives = 267/340 (79%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L + L + F    C    DG++PNG+FE GPKPS MKG++VI+ + IP W ++ GFVEYI
Sbjct  9     LFVLLISTFTSIFC--FRDGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELT-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN+T GVLIPP IEDDHSPLP W+IESLKAVKY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+CEGSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+SKGKGGF RA  RF AVSTRTR+ F S+FY
Sbjct  301   GRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFY  340



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   451 bits (1161),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/346 (62%), Positives = 273/346 (79%), Gaps = 11/346 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  L+ L+L  C   H      I DGLV NGNFE GPKPS++KG+ +I  + +PKW IS 
Sbjct  5     MLPLSVLLLATC---HFAFS--IRDGLVENGNFEVGPKPSELKGTEMIGRYALPKWEIS-  58

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIK+G+KQG+M+LVVP+G++AVRLG +ASI   + V KG YYS++F+  RTCAQEE
Sbjct  59    GFVEYIKAGQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEE  118

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
              LN+S+SP     +WG+LP+QTMYSS G+D+Y+WAF A  + V++V+HNP  E+DP+CGP
Sbjct  119   ELNISISP-----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGP  173

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA+K L  PR    N++KNG FEEGPY+LPNT+WGVLIPPNIED HSPLPGW++ES
Sbjct  174   LIDSVAIKALYPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVES  233

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVK+ID  HF VP G RA+ELVAG+ESA+ Q+VRTI GK Y L F+VGDA+NSC+GSM
Sbjct  234   LKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCQGSM  293

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ T++VPY+SKGKGGF RA  +F A S+RTRI F S+FY
Sbjct  294   VVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFY  339



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   451 bits (1161),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 267/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V  C   TDG++PNG+FE GPKPS MKG+RVI+ + IP W +S GFVEYI
Sbjct  11    FVLLIATITSV--C-CFTDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELS-GFVEYI  66

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  67    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  126

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID +A
Sbjct  127   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGIA  181

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPYIL N T GVLIPP IEDDHSPLP W+IESLKAVKY
Sbjct  182   IKALYPPRPTNKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSPLPAWMIESLKAVKY  241

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  242   VDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFA  301

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+S+GKGGF RA+ RF AVS RTRI F S+FY
Sbjct  302   GRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFY  341



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   450 bits (1158),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 217/340 (64%), Positives = 266/340 (78%), Gaps = 8/340 (2%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             L + L + F    C    DG++PNG+FE GPKP+ MKG++VI  + IP W ++ GFVEYI
Sbjct  9     LFVLLISTFTSIFC--FRDGMLPNGDFELGPKPADMKGTQVIKKNAIPSWELT-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN+T GVLIPP IEDDHSPLP W+IESLKAVKY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+CEGSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GR TL+VPY+SKGKGGF RA  RF AVSTRTR+ F S+FY
Sbjct  301   GRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFY  340



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   452 bits (1162),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/346 (63%), Positives = 273/346 (79%), Gaps = 11/346 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M  L+ L+L  C   H      I DGLV NGNFE GPKPS++KG+ +I  + +PKW IS 
Sbjct  55    MLPLSVLLLATC---HFAFS--IRDGLVENGNFEVGPKPSELKGTEMIGRYALPKWEIS-  108

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYIK+G+KQG+M+LVVP+G++AVRLG +ASI   + V KG YYS++F+  RTCAQEE
Sbjct  109   GFVEYIKAGQKQGDMLLVVPEGAYAVRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEE  168

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
              LN+S+SP     +WG+LP+QTMYSS G+D+Y+WAF A  + V++V+HNP  E+DP+CGP
Sbjct  169   ELNISISP-----EWGVLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGP  223

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA+K L  PR    N++KNG FEEGPY+LPNT+WGVLIPPNIED HSPLPGW++ES
Sbjct  224   LIDSVAIKALYPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVES  283

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVK+ID  HF VP G RA+ELVAG+ESA+ Q+VRTI GK Y L F+VGDA+NSCEGSM
Sbjct  284   LKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCEGSM  343

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAG+ T++VPY+SKGKGGF RA  +F A S+RTRI F S+FY
Sbjct  344   VVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFY  389



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   450 bits (1158),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 274/348 (79%), Gaps = 5/348 (1%)
 Frame = -3

Query  1041  MTKLTALVLFL-CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             M +L A+VLFL C      L   + DGL+PNGNFE GPKPS++KG++V+ P  IP W IS
Sbjct  1     MQRLIAVVLFLFCATSQ--LASSLNDGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEIS  58

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              G+VEYIKSG+KQG+M+L+VP+G  AVRLG +A I   ++VIKG +YSL+F+  RTCAQE
Sbjct  59    -GYVEYIKSGQKQGDMLLIVPEGGFAVRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQE  117

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E+LNVSVSPN E ND+G+ P+QTMYSS G+D+Y+WAF A  + ++I +HNP  E+D +CG
Sbjct  118   EKLNVSVSPNYEKNDFGLFPIQTMYSSNGWDSYAWAFQASESVIEISIHNPGVEEDAACG  177

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPN-TTWGVLIPPNIEDDHSPLPGWII  328
             P+IDSVALK L  P+R R N+LKNG+FEEGPYI     + GV+IPP+IEDDHSPLPGWII
Sbjct  178   PLIDSVALKTLYPPKRTRVNLLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSPLPGWII  237

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             +SLKAVKYIDS+HF VP G RA+EL+AG+ES++ Q+VRT  G+ Y L F++GDANN+CEG
Sbjct  238   DSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNACEG  297

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             SM VEAFA + T++V Y SKGKGGF +A  RF A STRTRI F S+FY
Sbjct  298   SMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFY  345


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 79/181 (44%), Gaps = 33/181 (18%)
 Frame = -3

Query  963  LVPNGNFERGPK--PSQMKGSRVIDPH------GIPKWVISS-GFVEYIKSGEKQGEMVL  811
            L+ NGNFE GP      +    +I PH       +P W+I S   V+YI S         
Sbjct  198  LLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSPLPGWIIDSLKAVKYIDSDH------F  251

Query  810  VVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF-VRTCAQEERLNVSVSPNSEPND  640
             VP+G  A+ L  G+++S++  VR   G  Y LSFT      A E  + V    N     
Sbjct  252  TVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNACEGSMVVEAFANKNT--  309

Query  639  WGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP--AREKDPS---CGPIIDSVA  484
                 ++  Y S G   F      F A+S R +I+ ++     + D S   CGP++D V 
Sbjct  310  -----VKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVK  364

Query  483  L  481
            L
Sbjct  365  L  365



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   450 bits (1157),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 271/349 (78%), Gaps = 9/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+ +     VL + T+  V LC    DG++PNG+FERGPKPS MKG++VI+   +P W 
Sbjct  1     MKRGSVSFLFVLLIATVTSV-LC--FRDGMLPNGDFERGPKPSDMKGTQVINKKALPSWE  57

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYIKSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCA
Sbjct  58    LS-GFVEYIKSGQKQGDMLLVVPAGKFAVRLGNEASIKQRLNVTKGMYYSLTFSAARTCA  116

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS G+D Y+WAF AES+  +IV+HNP  E+DP+
Sbjct  117   QDERLNISVAPDS-----GVIPIQTVYSSNGWDLYAWAFQAESDVAEIVIHNPGEEEDPA  171

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA+K L  PR    N+LKNG FEEGPY+LPN T GVLIPP IEDDHSPLP W+
Sbjct  172   CGPLIDGVAIKALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWM  231

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKA+KY+D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+
Sbjct  232   IESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQ  291

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+S+GKGGF RA+ RF AVS RTR+ F S+FY
Sbjct  292   GSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFY  340



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   449 bits (1156),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 269/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V +C   +DG++PNG+FE GPKPS MKG++VI+   IP W +S GFVEYI
Sbjct  10    FVLLIATITSV-IC--FSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  A+RLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN T GVL+PP IEDDHSPLP W++ESLKA+KY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+VPY+S+GKGGF RA+ RF AVSTRTR+ F S+FY
Sbjct  301   GKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFY  340



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   449 bits (1156),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 272/341 (80%), Gaps = 8/341 (2%)
 Frame = -3

Query  1026  ALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEY  847
             A+++ + +IFHV  C    DGL+PNG+FE GP  S MKG++V++   IP W IS GFVEY
Sbjct  5     AVLVLIQSIFHVTFC--FEDGLLPNGDFEHGPSRSDMKGTQVMNSKAIPNWEIS-GFVEY  61

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             I SG KQG+M+LVVP+GS AVRLG +ASI  +V+V KG YY+++F+  RTCAQ+ERLNVS
Sbjct  62    IPSGHKQGDMLLVVPKGSFAVRLGNEASIKQSVKVAKGSYYAITFSAARTCAQDERLNVS  121

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
              +P+      G+LP+QT+YSS+G+D YSWAF A++  V+IV+HNP  E+D +CGP+ID V
Sbjct  122   AAPHH-----GVLPIQTVYSSSGWDLYSWAFKAQAEYVEIVIHNPGVEEDSACGPLIDGV  176

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             A++ L  PR    N+LKNG FEEGP++LPN + GVLIPPNIEDDHSPLPGWI+ESLKAVK
Sbjct  177   AMRALFPPRPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSPLPGWIVESLKAVK  236

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             +IDS+HF VP G RAVELVAG+ESA+ Q+VRTIPGK Y L F+VGDA+N+C GSM VEAF
Sbjct  237   FIDSDHFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAF  296

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AG+ T++VPY+SKGKGGF RA+ RF A+S RTRI F S+FY
Sbjct  297   AGKDTVKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFY  337


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 82/193 (42%), Gaps = 38/193 (20%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPKPSQMKGSRVIDPHGI-------PKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP       S V+ P  I       P W++ S   V++I S    
Sbjct  185  RPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSPLPGWIVESLKAVKFIDSDH--  242

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G++++I   VR I G  Y LSF        C+    +     
Sbjct  243  ----FSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAFAG  298

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A SNR +I+  +     R  D S  CG
Sbjct  299  KDT---------VKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSSLCG  349

Query  504  PIIDSVALKLLNA  466
            P+ID V  KLL+A
Sbjct  350  PVIDDV--KLLSA  360



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 210/321 (65%), Positives = 263/321 (82%), Gaps = 6/321 (2%)
 Frame = -3

Query  966  GLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHA  787
            GLV NGNFE GPKPS +KG+ +I  + +PKW IS GFVEYIK+G+KQG+M+LVVP+G++A
Sbjct  3    GLVENGNFEVGPKPSDLKGTEMIGRYALPKWEIS-GFVEYIKAGQKQGDMLLVVPEGAYA  61

Query  786  VRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYS  607
            VRLG +ASI   + V KG YYS++F+  RTCAQEE LN+S+SP     +WG+LP+QTMYS
Sbjct  62   VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP-----EWGVLPMQTMYS  116

Query  606  STGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGD  427
            S G+D+Y+WAF A  + V++V+HNP  E+DP+CGP+IDSVA+K L  PR    N++KNG 
Sbjct  117  SNGWDSYAWAFKALLDIVELVVHNPGVEEDPACGPLIDSVAIKALYPPRPTNKNLIKNGG  176

Query  426  FEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVA  247
            FEEGPY+LPNT+WGVLIPPNIED HSPLPGW++ESLKAVK+ID  HF VP G RA+ELVA
Sbjct  177  FEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIEHFSVPQGRRAIELVA  236

Query  246  GRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIR  67
            G+ESA+ Q+VRTI GK Y L F+VGDA+NSCEGSM VEAFAG+ TL+VPY+SKGKGGF R
Sbjct  237  GKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDTLKVPYESKGKGGFKR  296

Query  66   ANHRFTAVSTRTRIRFLSSFY  4
            A  +F AVS+RTR+ F S+FY
Sbjct  297  AVLKFVAVSSRTRVMFYSTFY  317



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   449 bits (1156),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 269/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V +C   +DG++PNG+FE GPKPS MKG++VI+   IP W +S GFVEYI
Sbjct  10    FVLLIATITSV-IC--FSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  A+RLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN T GVL+PP IEDDHSPLP W++ESLKA+KY
Sbjct  181   IKALYPPRPTSKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+VPY+S+GKGGF RA+ RF AVSTRTR+ F S+FY
Sbjct  301   GKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFY  340



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   449 bits (1156),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/350 (62%), Positives = 271/350 (77%), Gaps = 6/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKK+     L+L LC    + L   + DGL+PNGNFE GPK S+++G++V+    IP W 
Sbjct  1     MKKVAMF--LLLLLCATSQIALS--VKDGLLPNGNFEYGPKASELEGTKVMSAKAIPNWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS G+VEYIKSG KQG+M+L+VP+G+ AVRLG +A I   V V+KG +YSL+F+  RTCA
Sbjct  57    IS-GYVEYIKSGHKQGDMLLIVPEGAFAVRLGNEALIKQKVEVVKGDFYSLTFSTARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSVSPN+E ND+G+ P+QTMYSS G+D+Y+WAF A+++ ++I +HNP  E+D +
Sbjct  116   QEERLNVSVSPNNEKNDFGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGVEEDAA  175

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPN-TTWGVLIPPNIEDDHSPLPGW  334
             CGP+IDSVALK L  P+R R N+LKNG+FEEGPYI P  T+ GV+IPP+IEDDHSPLPGW
Sbjct  176   CGPLIDSVALKTLYNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGW  235

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             IIESLKA+KYIDS HF VP G RA+EL+AG+ESAV QIV+T  G+ Y L F VGDANN C
Sbjct  236   IIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGC  295

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             EG M VEAFAG+ T++V Y SKGKGGF  A   F A STRTRI F S+FY
Sbjct  296   EGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFY  345



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 269/340 (79%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + TI  V +C   +DG++PNG+FE GPKPS MKG++VI+   IP W +S GFVEYI
Sbjct  10    FVLLIATITSV-IC--FSDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  A+RLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS+G+D Y+WAF AESN  +IV+HNP  E+DP+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPGEEEDPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPY+LPN T GVL+PP IEDDHSPLP W++ESLKA+KY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ +T+ GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNACQGSMVVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+VPY+S+GKGGF RA+ RF AVSTRTR+ F S+FY
Sbjct  301   GKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFY  340



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   449 bits (1154),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 276/350 (79%), Gaps = 8/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK  T +  L++ LC + ++     + DGL+ NGNFE  P  + + G+ V+  + IP+W 
Sbjct  1     MKSSTTVILLLVLLCAVSNISFA--VIDGLLKNGNFEIPPSKADLNGTEVLKHNAIPEWS  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIK+G+KQG+M+LVVP+G  AVRLG +ASI   + V KG YYSL+F+  RTCA
Sbjct  59    IS-GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASIKQILNVTKGMYYSLTFSAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEER+NVSV+P     D+G+LP+QT+YSS+G+D+Y+WAF AE ++V+I+LHNP  E+DP+
Sbjct  118   QEERINVSVTP-----DFGVLPIQTLYSSSGWDSYAWAFQAELHQVEILLHNPGVEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A++ L  PR    N+LKNGDFEEGPYI PNT+WGVL+PPNIEDDHSPLP W+
Sbjct  173   CGPLIDSIAIRTLYPPRATNQNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWM  232

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+DS+HF VP G RA+ELVAG+ESA+ Q+ RT  GK+Y+L F VGDA+N+CE
Sbjct  233   VESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACE  292

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFAGR TL+VPY+S GKGG+ RA  RF A ++RTRI FLS++YH
Sbjct  293   GSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYH  342



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   448 bits (1153),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 214/355 (60%), Positives = 269/355 (76%), Gaps = 15/355 (4%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRL---------ITDGLVPNGNFERGPKPSQMKGSRVIDPH  889
             M  +  + + LC   H+ L            + DGL+ NGNFER P  + MKG+ V+  +
Sbjct  1     MRGVILVSVLLCATCHLALSATNGTAERNGTVADGLLDNGNFERAPNATNMKGTVVVGRY  60

Query  888   GIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFT  709
              IP W I+ GFVEYIKSG+KQG+M+LVVP+G++AVRLG DASI   ++VI G YYS++F+
Sbjct  61    AIPGW-INEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNDASIKQAIKVIVGLYYSITFS  119

Query  708   FVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPA  529
               RTCAQEERLNV+V+P+S     G+LP+QT+YSS G+D+Y+WAF A +  +++++HN  
Sbjct  120   AARTCAQEERLNVTVAPDS-----GVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTG  174

Query  528   REKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHS  349
             +E+DP+CGP+ID+VA+K L  PR    N+LKN  FEEG YI PNT WGVLIPPNIEDDHS
Sbjct  175   KEEDPACGPLIDAVAIKALYPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHS  234

Query  348   PLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGD  169
             PLPGW++ESLKAVKYIDS+H+ VP G RAVELVAG+ESA+ Q+ RTI GK Y L FSVGD
Sbjct  235   PLPGWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGD  294

Query  168   ANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             ANNSC GSM VEAFAG+ TL+VPY+SKG GGF RA   F AVSTRTRI FLS+FY
Sbjct  295   ANNSCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFY  349



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   449 bits (1156),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 271/352 (77%), Gaps = 14/352 (4%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRL----ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPK  877
             +M   T L + LC    +  C L      DGL+ NGNFE+ PK S++ G+ V+ PH +PK
Sbjct  35    RMRVSTVLSVLLC----LATCHLPAFAFRDGLLDNGNFEQAPKSSELNGTIVLKPHAVPK  90

Query  876   WVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRT  697
             W IS GFVEYIK+G+KQG+M+LVVP+G  AVRLG +ASI   + V KG +YSL+F+  RT
Sbjct  91    WQIS-GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASIKQLINVTKGMFYSLTFSAART  149

Query  696   CAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKD  517
             CAQEER+NVSV+P     D+G+LP+QT+YSS G+D+Y+WAF    +  +I++HNP  E+D
Sbjct  150   CAQEERVNVSVAP-----DYGVLPIQTLYSSNGWDSYAWAFRTSYDVAEILIHNPGVEED  204

Query  516   PSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPG  337
             P+CGP+IDSVA++ L  P+    N+LKNGDFEEG YI PNT+WGVLIPPNIEDD+SPLP 
Sbjct  205   PACGPLIDSVAIRALYPPKPTNQNLLKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPA  264

Query  336   WIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNS  157
             W++ESLKAVKYID+ HF VP G RA+ELV G+ESA+ Q+ RTI GK Y+L F+VGDA+NS
Sbjct  265   WMVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASNS  324

Query  156   CEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             CEGSM VEAFAGR T++VPY+SKGKGG+ RA  RF A +TRTRI FLS+FYH
Sbjct  325   CEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYH  376



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   447 bits (1151),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 215/341 (63%), Positives = 271/341 (79%), Gaps = 9/341 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             L L  C  FHV L     DGLV NGNFE GPK S +KG+ +      IP+W IS GFVEY
Sbjct  8     LSLLFCATFHVSLS--FNDGLVANGNFELGPKASDLKGTVITGGKTAIPEWEIS-GFVEY  64

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQG+M+LVVP+G++AVRLG +ASI   ++VIKG +YS++F   RTCAQEER+N+S
Sbjct  65    IKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVIKGMHYSITFMVARTCAQEERINIS  124

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
             V+P     D+GI+P+QT+Y+S+G+D   + F A+ + V++V+HNP  E+DP+CGP+IDSV
Sbjct  125   VAP-----DFGIIPIQTLYTSSGWDPIGYGFKAQYDVVEMVIHNPGVEEDPACGPLIDSV  179

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVK  307
             AL+ L  P+    N+LKNG FEEGPYI PNT++GV+IPPNIED+HSPLPGW++ESLKAVK
Sbjct  180   ALRTLYPPKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKAVK  239

Query  306   YIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAF  127
             Y+DS+HF VP GTRA+ELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAF
Sbjct  240   YLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAF  299

Query  126   AGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             AGR T++VPYQSKGKGGF RA  +F AV +RTRI FLS+FY
Sbjct  300   AGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFY  340



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 275/350 (79%), Gaps = 8/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK   K+  L++ LC I  + +   + DGL+ NGNFE  P  + + G+ V+  + IP+W 
Sbjct  1     MKSSIKVLLLLVLLCAISSISIA--VIDGLLKNGNFEMPPSKADLNGTEVLKHNAIPEWS  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIK+G+KQG+M+LVVP+G  AVRLG +ASI   + V KG YYSL+F+  RTCA
Sbjct  59    IS-GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASIKQILNVTKGMYYSLTFSAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEER+NVSV+P     D+G+LP+QT+YSS+G+D+Y+WAF AE  +V+I+LHNP  E+DP+
Sbjct  118   QEERINVSVTP-----DFGVLPIQTLYSSSGWDSYAWAFQAEFPQVEILLHNPGVEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A++ L  PR    N+LKNGDFEEGPY+ PNT+WGVL+PPNIEDDHSPLP W+
Sbjct  173   CGPLIDSIAIRTLYPPRATNQNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWM  232

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+DS+HF VP G RA+ELVAG+ESA+ Q+ RT  GK+Y+L F VGDA+N+CE
Sbjct  233   VESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACE  292

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFAGR TL+VPY+S GKGG+ RA  RF A ++RTRI FLS++YH
Sbjct  293   GSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYH  342



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   448 bits (1153),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 266/347 (77%), Gaps = 15/347 (4%)
 Frame = -3

Query  1017  LFLCTIFHVGLCRL---------ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             + LC   H+ L            + DGL+ NGNFER P  + MKG+ V+  + IP W I+
Sbjct  46    VLLCATCHLALSATNGTAERNGTVADGLLDNGNFERAPNATNMKGTVVVGRYAIPGW-IN  104

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYIKSG+KQG+M+LVVP+G++AVRLG DASI   ++VI G YYS++F+  RTCAQE
Sbjct  105   EGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNDASIKQAIKVIVGLYYSITFSAARTCAQE  164

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLNV+V+P+S     G+LP+QT+YSS G+D+Y+WAF A +  +++++HN  +E+DP+CG
Sbjct  165   ERLNVTVAPDS-----GVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTGKEEDPACG  219

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID+VA+K L  PR    N+LKN  FEEG YI PNT WGVLIPPNIEDDHSPLPGW++E
Sbjct  220   PLIDAVAIKALYPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVE  279

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKYIDS+H+ VP G RAVELVAG+ESA+ Q+ RTI GK Y L FSVGDANNSC GS
Sbjct  280   SLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGS  339

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ TL+VPY+SKG GGF RA   F AVSTRTRI FLS+FY
Sbjct  340   MVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFY  386



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/328 (65%), Positives = 263/328 (80%), Gaps = 8/328 (2%)
 Frame = -3

Query  987  LCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLV  808
            LC   TDG++PNG+FE GPKPS +KG++V+  + IP W ++ GFVEYIKSG+KQG+M+LV
Sbjct  22   LC--FTDGMLPNGDFELGPKPSDIKGTKVLKKNAIPSWEVT-GFVEYIKSGQKQGDMLLV  78

Query  807  VPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGIL  628
            VP G  AVRLG +ASI  T+ V KG YYSL+F+  RTCAQ+ERLN+SV+P+S     G++
Sbjct  79   VPAGKFAVRLGNEASIKQTLNVTKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVI  133

Query  627  PLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRG  448
            P+QT+YSS+G+D Y+WAF AES+  +I++HNP  E+DP+CGP+ID VA+K L  PR    
Sbjct  134  PIQTVYSSSGWDLYAWAFQAESSVAEILIHNPGEEEDPACGPLIDGVAIKALYPPRPTNK  193

Query  447  NMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGT  268
            N+LKNG FEEGPY+LPN T GVLIPP IEDDHSPLP W+IESLKA+KY+D  HF VP G 
Sbjct  194  NILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHFSVPQGR  253

Query  267  RAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSK  88
            RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+CEGSM VEAFAGR TL+VPY+S 
Sbjct  254  RAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACEGSMIVEAFAGRDTLKVPYKSL  313

Query  87   GKGGFIRANHRFTAVSTRTRIRFLSSFY  4
            GKGGF RA+ RF AVSTRTRI F S+FY
Sbjct  314  GKGGFKRASLRFIAVSTRTRIMFYSTFY  341



>gb|KDO52908.1| hypothetical protein CISIN_1g0399092mg, partial [Citrus sinensis]
Length=315

 Score =   444 bits (1141),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 254/316 (80%), Gaps = 1/316 (0%)
 Frame = -3

Query  963  LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAV  784
            L+PNGNFE GPK SQMKG+ V  P+ IP W IS G+VEYIKSG KQG+M+L+VP+G  AV
Sbjct  1    LLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQIS-GYVEYIKSGHKQGDMLLIVPEGVFAV  59

Query  783  RLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSS  604
            RLG +ASI   ++V KG +YS++F+  RTCAQEE+LNVSVSPN E NDW ILP+QTMYS+
Sbjct  60   RLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMYSN  119

Query  603  TGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDF  424
             G+D+Y+WAF+A++  V+I +HNP  E+DP+CGP+IDSVALK+L  P+R   N+LKNG+F
Sbjct  120  NGWDSYAWAFVADAEEVEITIHNPGVEEDPACGPLIDSVALKVLYPPKRTGVNILKNGNF  179

Query  423  EEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAG  244
            EEGPY+ PN +WGVLIPP IEDDHSPLPGWIIESLKAVKYID  HF VP G RA+ELVAG
Sbjct  180  EEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLKHFFVPEGRRAIELVAG  239

Query  243  RESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRA  64
            +ESA+ Q+V+T   K Y L F+VGDA N C G++GVEA+AGR  ++V Y SKGKGGF +A
Sbjct  240  KESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGRDNVKVTYASKGKGGFKKA  299

Query  63   NHRFTAVSTRTRIRFL  16
              RF AVS RTRI FL
Sbjct  300  LLRFKAVSPRTRIMFL  315



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   446 bits (1146),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 213/346 (62%), Positives = 265/346 (77%), Gaps = 3/346 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K   L++   ++    L    TDGL+PNG+FE GPK S +KG+ V     IP W +S 
Sbjct  1     MQKFKVLLVLFLSVCQGALS--YTDGLLPNGDFEVGPKASNLKGTVVTTHDAIPNWTVS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+KQG+M+LVVP+G++AVRLG +A I   V++ KG  YS++F+  RTCAQEE
Sbjct  58    GYVEYIKSGQKQGDMLLVVPEGAYAVRLGNEAYIKQKVKLNKGSSYSITFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             +LNVSV P SE  D+GI+P+QTMY S G+++++  F A+    +IV+HN   E DP+CGP
Sbjct  118   KLNVSVVPTSEKRDYGIIPIQTMYGSNGWESFACGFRADYPEGEIVIHNSGVEDDPACGP  177

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVALK+LN P R R N+LKNG+FEEGPY+ PN +WGVLIPP+IED H PLPGWI+ES
Sbjct  178   LIDSVALKVLNPPIRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVES  237

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS HF VP G RA+ELVAG+ESA+ Q V T  GKVY L F+VGDANN+CEGSM
Sbjct  238   LKAVKYIDSEHFTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNACEGSM  297

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              VEAFAGR T+QVPYQSKGKGGF+R   RF A + RTRIRFLS+FY
Sbjct  298   TVEAFAGRDTVQVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFY  343



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   445 bits (1145),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 212/333 (64%), Positives = 270/333 (81%), Gaps = 9/333 (3%)
 Frame = -3

Query  999  FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEYIKSGEKQG  823
            FHV   + + DGLV NGNFE GPKP+++KG+ V    + IP+W IS G VEYIKSG+KQG
Sbjct  26   FHV--SQSLIDGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEIS-GLVEYIKSGQKQG  82

Query  822  EMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPN  643
            +M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEER+N+SV+P     
Sbjct  83   DMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP-----  137

Query  642  DWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAP  463
            D+G++P+QT+Y+S+G+D  ++ F AE + V++V+HNP  E+DP+CGP+IDSVAL+ L  P
Sbjct  138  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPP  197

Query  462  RRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFL  283
            +    N+LKNG FEEGPYI PNT++GV+IPPNIEDDHSPLPGW++ESLKAVKY+DS HF 
Sbjct  198  KASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFS  257

Query  282  VPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQV  103
            VP GTRAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAFAG+ T++V
Sbjct  258  VPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKV  317

Query  102  PYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
            PY SKGKGGF RA  +F AV TRTR+ FLS+FY
Sbjct  318  PYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFY  350



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   444 bits (1143),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/333 (63%), Positives = 270/333 (81%), Gaps = 9/333 (3%)
 Frame = -3

Query  999  FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEYIKSGEKQG  823
            FHV   + + DGLV NGNFE GPKP+++KG+ V    + IP+W IS G VEY+KSG+KQG
Sbjct  26   FHV--SQSLIDGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEIS-GLVEYVKSGQKQG  82

Query  822  EMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPN  643
            +M+LVVP+G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEER+N+SV+P     
Sbjct  83   DMLLVVPEGAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP-----  137

Query  642  DWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAP  463
            D+G++P+QT+Y+S+G+D  ++ F AE + V++V+HNP  E+DP+CGP+IDSVAL+ L  P
Sbjct  138  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPP  197

Query  462  RRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFL  283
            +    N+LKNG FEEGPYI PNT++GV+IPPNIEDDHSPLPGW++ESLKAVKY+DS HF 
Sbjct  198  KASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFS  257

Query  282  VPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQV  103
            VP GTRAVELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAFAG+ T++V
Sbjct  258  VPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKV  317

Query  102  PYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
            PY SKGKGGF RA  +F AV TRTR+ FLS+FY
Sbjct  318  PYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFY  350



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   444 bits (1142),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 260/324 (80%), Gaps = 6/324 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            + DGL+ NGNFE  P  + MKG+ V+  + IP WV + GFVEYIKSG+KQG+M+LVVP+G
Sbjct  31   VADGLLENGNFENAPNATNMKGTVVVGRYAIPGWV-NEGFVEYIKSGQKQGDMLLVVPEG  89

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   ++VIKG YYS++F+  RTCAQEERLNV+V+P+S     G+LP+QT
Sbjct  90   AYAVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDS-----GVLPIQT  144

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +YSS+G+D Y+WAF A     ++++HNP  E+DP+CGP+ID+VA+K L  PR    N +K
Sbjct  145  VYSSSGWDNYAWAFKAIYEVAELIIHNPGVEEDPACGPLIDAVAIKALYPPRPTNKNSVK  204

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY+ PNT WGVLIPPNIEDDHSPLP WI+ESLKAVKYIDS H+ VP G RAVE
Sbjct  205  NGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSAHYFVPQGRRAVE  264

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LVAG+ESA+ QIVRTI GK+Y L F+VGDANNSC GS+ VEAFAG+ TL+VPY+SKGKGG
Sbjct  265  LVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDTLKVPYESKGKGG  324

Query  75   FIRANHRFTAVSTRTRIRFLSSFY  4
            F RA  +F AVS RTRI FLS+FY
Sbjct  325  FKRAELKFKAVSNRTRIMFLSTFY  348



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   443 bits (1140),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/347 (62%), Positives = 273/347 (79%), Gaps = 9/347 (3%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             K T++  L+L + + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W +S
Sbjct  2     KETRVIVLLL-IHSFFYVAFC--FKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELS  58

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYI SG+KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCAQ+
Sbjct  59    -GFVEYIPSGQKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQD  117

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+CG
Sbjct  118   ERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACG  172

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID VA++ L  PR    N+LKNG FEEGP++LPNTT GVLIPPN  DDHSPLPGW++E
Sbjct  173   PLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVE  232

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L F+VGDA+N+C GS
Sbjct  233   SLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGS  292

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ T++VPY+SKGKGGF RA+ RF AVS RTR+ F S+FY
Sbjct  293   MIVEAFAGKDTIKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFY  339


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF        CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S R +++ ++     R  D S  CG
Sbjct  301  KDT---------IKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   443 bits (1140),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 268/349 (77%), Gaps = 9/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+++     +L + TI  V   R   DG++PNG FERGPKPS MKG+RVI+ + IP W 
Sbjct  1     MKRVSVSFLFILLISTITSVFCFR---DGMLPNGGFERGPKPSDMKGTRVINKNAIPNWE  57

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GF+EYIKSG+KQG+M+LVVP G  AVRLG +ASI   + V KG YYSL+F+  RTCA
Sbjct  58    LS-GFIEYIKSGQKQGDMLLVVPAGKFAVRLGNEASIKQRINVTKGMYYSLTFSAARTCA  116

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS G+D Y+WAF A+++  +IV+HNP  E+ P+
Sbjct  117   QDERLNISVAPDS-----GVIPIQTLYSSNGWDLYAWAFQAQNDVAEIVIHNPGEEEHPA  171

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA+K L  PR    N+LKNG FEEGPYI+PN T GVLIPP IEDDHSPLP WI
Sbjct  172   CGPLIDGVAIKALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWI  231

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKY+D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+
Sbjct  232   IESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACK  291

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+V Y+S GKGGF RA  RF AVS+RTR+ F S+FY
Sbjct  292   GSMIVEAFAGKDTLKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFY  340



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   444 bits (1141),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 262/339 (77%), Gaps = 8/339 (2%)
 Frame = -3

Query  1020  VLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIK  841
             VL   T  H        +GLV NGNFE  PK S MKG+++I  + +PKW IS GFVEYIK
Sbjct  42    VLLFATNCHFAFS--FIEGLVENGNFELSPKQSDMKGTQMIGRYALPKWEIS-GFVEYIK  98

Query  840   SGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVS  661
             +G+KQG+M+LVVP+G++A+RLG +ASI   + + KG YYS++F+  RTCAQEE LN+SVS
Sbjct  99    AGQKQGDMLLVVPEGAYAIRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVS  158

Query  660   PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVAL  481
             P     +WG+LP+QTMYSS G+D+Y+WAF A  + V+ V+HNP  E+DP+CGP+IDSVA 
Sbjct  159   P-----EWGVLPMQTMYSSNGWDSYAWAFKALISPVEFVIHNPGVEEDPACGPLIDSVAF  213

Query  480   KLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYI  301
               L  PR    N+LKNG FEEGPY+ PNTTWGVLIPPNIED HSPLPGW++ESLKAVKYI
Sbjct  214   TSLYPPRPTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSPLPGWMVESLKAVKYI  273

Query  300   DSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAG  121
             D  HF VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDA+NSCEGSM VEAFAG
Sbjct  274   DVEHFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAG  333

Query  120   RLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + TL+VPY+SKGKGGF RA  +F AVSTRTRI F S+FY
Sbjct  334   KDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFY  372



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   442 bits (1137),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 210/334 (63%), Positives = 260/334 (78%), Gaps = 8/334 (2%)
 Frame = -3

Query  1005  TIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQ  826
             T  +  LC  + DG +PNG+FE GPKPS MKG++V++   IP W +S GFVEYIKSG+KQ
Sbjct  14    TTAYTALC--LRDGQLPNGDFELGPKPSDMKGTQVVNKTAIPNWELS-GFVEYIKSGQKQ  70

Query  825   GEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEP  646
             G+M+LVVP G  AVRLG +ASI   +R++KG YYSL+F+  RTCAQ+ERLN+S SP    
Sbjct  71    GDMLLVVPAGKFAVRLGNEASIKQRLRLVKGMYYSLTFSAARTCAQDERLNISASP----  126

Query  645   NDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNA  466
              DWG++P+QT+YSS G+D Y+WAF AES  V +V+HNP  E+DP+CGP+ID+VA++ L  
Sbjct  127   -DWGVIPIQTVYSSYGWDLYAWAFQAESELVDVVIHNPGEEEDPACGPLIDAVAMRALYP  185

Query  465   PRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHF  286
             PR    N+LKNG FEEGP +LPN T GVLIPP IEDDHSPLPGW++ESLKAVKYID  HF
Sbjct  186   PRPTNKNILKNGGFEEGPLVLPNATTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDVEHF  245

Query  285   LVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQ  106
              VP G RAVELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GSM VEAFAGR T++
Sbjct  246   SVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMIVEAFAGRDTIK  305

Query  105   VPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             VPY+S+G GGF RA  RF A S RTRI F S+FY
Sbjct  306   VPYESRGTGGFKRAALRFVAASDRTRIMFYSTFY  339



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   442 bits (1136),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 273/347 (79%), Gaps = 9/347 (3%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             K T++  L+L + + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W +S
Sbjct  2     KETRVIVLLL-IHSFFYVAFC--FKDGLLPNGDFELGPRHSDMKGTQVINKTSIPNWELS  58

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYI SG+KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCAQ+
Sbjct  59    -GFVEYIPSGKKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCAQD  117

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+CG
Sbjct  118   ERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACG  172

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID VA++ L  PR    N+LKNG FEEGP++LPNTT GVLIPPN  DDHSPLPGW++E
Sbjct  173   PLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVE  232

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+DS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L F+VGDA+N+C GS
Sbjct  233   SLKAVKYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGS  292

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ T++VPY+SKGKGGF RA+ RF AVS RTR+ F S+FY
Sbjct  293   MIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFY  339


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 86/195 (44%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+Y+ S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYLDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF        CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S R +++ ++     R  D S  CG
Sbjct  301  KDT---------IKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   441 bits (1133),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 257/320 (80%), Gaps = 6/320 (2%)
 Frame = -3

Query  963  LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAV  784
            ++PNG+FERGPKPS MKG++VI+   +P W +S GFVEYIKSG+KQG+M+LVVP G  AV
Sbjct  1    MLPNGDFERGPKPSDMKGTQVINKKALPSWELS-GFVEYIKSGQKQGDMLLVVPAGKFAV  59

Query  783  RLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSS  604
            RLG +ASI   + V KG YYSL+F+  RTCAQ+ERLN+SV+P+S     G++P+QT+YSS
Sbjct  60   RLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPIQTVYSS  114

Query  603  TGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDF  424
             G+D Y+WAF AES+  +IV+HNP  E+DP+CGP+ID VA+K L  PR    N+LKNG F
Sbjct  115  NGWDLYAWAFQAESDVAEIVIHNPGEEEDPACGPLIDGVAIKALYPPRPTNKNILKNGGF  174

Query  423  EEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAG  244
            EEGPY+LPN T GVLIPP IEDDHSPLP W+IESLKA+KY+D  HF VP G RAVELVAG
Sbjct  175  EEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVEHFSVPQGRRAVELVAG  234

Query  243  RESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRA  64
            +ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFAG+ TL+VPY+S+GKGGF RA
Sbjct  235  KESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDTLKVPYESRGKGGFKRA  294

Query  63   NHRFTAVSTRTRIRFLSSFY  4
            + RF AVS RTR+ F S+FY
Sbjct  295  SMRFVAVSNRTRVMFYSTFY  314



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   441 bits (1135),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 273/349 (78%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKKM  +  + L L +IF+   C    DGL+PNG+FE GP  + MKG++V++   IP W 
Sbjct  1     MKKMGVI--VFLLLHSIFYTAFC--FKDGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+      G++P+QT+YSS+G+D YSWAF A+S+  ++V+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----GVMPIQTVYSSSGWDLYSWAFKAQSDYAEVVIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPNT+ GVLIPPN  DDHSPLPGW+
Sbjct  171   CGPLIDGVAMRALYPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRT PGK+Y L F+VGDA+N+C 
Sbjct  231   VESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VP++SKGKGGF RA+ +F AVS RTRI F S+FY
Sbjct  291   GSMIVEAFAGKDTLKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFY  339


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 86/195 (44%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    +D H  +P W++ S   V+YI S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR   G  Y LSF        CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         L+  + S G   F   S  F+A S+R +I+ ++     R  D S  CG
Sbjct  301  KDT---------LKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   441 bits (1135),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/349 (60%), Positives = 271/349 (78%), Gaps = 6/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ +T ++  +LF+ T           DG++PNG+FE GPKPS MKG+ +++   IP W 
Sbjct  1     MEGVTVVSFFLLFIATAMAAKSTVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AES+  ++V+HNP  E+DP+
Sbjct  120   QDERLNISVAPDS-----GVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP +T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ Q+VRT+ GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+SKG GGF RA+ RF AVSTR+RI F S+FY
Sbjct  295   GSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFY  343



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   441 bits (1133),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 273/349 (78%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+M  +  ++L L + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W 
Sbjct  1     MKEMGVI--VLLLLHSFFYVAFC--FNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPN + GVLIPPN  DDHSPLPGW+
Sbjct  171   CGPLIDGVAMRALFPPRTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L FSVGDA+N+C 
Sbjct  231   VESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF R++ RF AVS+RTR+ F S+FY
Sbjct  291   GSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFY  339


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 88/195 (45%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  187  RTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF+       CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S+R +++ ++     R  D S  CG
Sbjct  301  KDT---------IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   441 bits (1133),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 212/349 (61%), Positives = 272/349 (78%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MKKM  +  + L L +IF+   C    DGL+PNG+FE GP  + MKG++V++   IP W 
Sbjct  1     MKKMGVI--VFLLLHSIFYTAFC--FKDGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+      G++P+QT+YSS+G+D YSWAF A+ +  ++V+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----GVMPIQTVYSSSGWDLYSWAFKAQGDYAEVVIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPNT+ GVLIPPN  DDHSPLPGW+
Sbjct  171   CGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVEL+AG+ESAV Q+VRT PGK+Y L F+VGDA+N+C 
Sbjct  231   VESLKAVKYIDSDHFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+SKGKGGF RA+ +F AVS RTRI F S+FY
Sbjct  291   GSMIVEAFAGKDTLKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFY  339


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    +D H  +P W++ S   V+YI S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR   G  Y LSF        CA    +     
Sbjct  245  ----FSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         L+  Y S G   F   S  F+A S+R +I+ ++     R  D S  CG
Sbjct  301  KDT---------LKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   440 bits (1131),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 273/349 (78%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+M  +  ++L L + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W 
Sbjct  1     MKEMGVI--VLLLLHSFFYVAFC--FNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPN + GVLIPPN  DDHSPLPGW+
Sbjct  171   CGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L FSVGDA+N+C 
Sbjct  231   VESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF R++ RF AVS+RTR+ F S+FY
Sbjct  291   GSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFY  339


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 88/195 (45%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF+       CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S+R +++ ++     R  D S  CG
Sbjct  301  KDT---------IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   439 bits (1130),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 265/349 (76%), Gaps = 9/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK  +     VL + T+  V   R   DG++PNG FERGPKPS +KG+RVI+ + IP W 
Sbjct  1     MKGGSVAFLFVLLISTVTSVFCFR---DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWE  57

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GF+EYIKSG+KQG+M+LVVP G  AVRLG +ASI   V V KG YYSL+F+  RTCA
Sbjct  58    LS-GFIEYIKSGQKQGDMLLVVPAGKFAVRLGNEASIKQRVNVTKGMYYSLTFSAARTCA  116

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS G+D Y+WA  A+S+  +IV+HNP  E+ P+
Sbjct  117   QDERLNISVAPDS-----GVIPIQTLYSSNGWDLYAWALQAQSDVAEIVIHNPGEEEHPA  171

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA+K L  PR    N+LKNG FEEGPYI+PN T GVLIPP IEDDHSPLP WI
Sbjct  172   CGPLIDGVAIKALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWI  231

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKY+D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+
Sbjct  232   IESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACK  291

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+V Y+SKGKGGF RA  RF AVS RTR+ F S+FY
Sbjct  292   GSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFY  340



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   439 bits (1130),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 273/349 (78%), Gaps = 10/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+M  +  ++L L + F+V LC    DGL+PNG+FE GP+ S MKG++VI+   IP W 
Sbjct  1     MKEMGVI--VLLLLHSFFYVSLC--FNDGLLPNGDFELGPRHSDMKGTQVINITAIPNWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPA  170

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPN + GVLIPPN  DDHSPLPGW+
Sbjct  171   CGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWM  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L F+VGDA+N+C 
Sbjct  231   VESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACA  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF R++ RF AVS RTR+ F S+FY
Sbjct  291   GSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFY  339


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 87/195 (45%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  187  RPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  244

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF        CA    +     
Sbjct  245  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAG  300

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S+R +++ ++     R  D S  CG
Sbjct  301  KDT---------IKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSSLCG  351

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  352  PVIDDV--KLLSARR  364



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   439 bits (1130),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 267/347 (77%), Gaps = 8/347 (2%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M    A +L LC I  + +    TDGL+PNGNFE GP  SQ++G+ VI  + IP+W IS 
Sbjct  1     MLNFVASLLLLCAISPMAVA--FTDGLLPNGNFELGPASSQLRGTEVIGRNAIPRWEIS-  57

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G VEYI  G KQG+M+LVVP+GS+AVRLG +ASI   ++V +G  YSL+F+  RTCAQEE
Sbjct  58    GTVEYIPWGHKQGDMLLVVPEGSYAVRLGNEASIKQRIKVTRGMRYSLTFSAARTCAQEE  117

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLNVSV+P S     G+LP+QTMYSS G+D+Y+WA+ A S+  +IV+HNP  E+DP+CGP
Sbjct  118   RLNVSVAPES-----GVLPMQTMYSSNGWDSYAWAWNARSDVAEIVVHNPGVEEDPACGP  172

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA+K L+ PRR   N+LKNGDFEEGPYILPNTTWGVLIPP  EDDHSPLPGW+++S
Sbjct  173   LIDSVAVKELHPPRRSNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDS  232

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
              KAVKY+DS HF VP G+RAVEL+AG+ESA+ Q VRT+PG+ Y L FSVGDA+N+C+G+M
Sbjct  233   PKAVKYLDSTHFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACQGTM  292

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEAFAG  T++VPY+SKG GG  RA  RF A   RTRI F SS Y+
Sbjct  293   IVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYN  339



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/349 (59%), Positives = 271/349 (78%), Gaps = 6/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ +T ++  +LF+ T           DG++PNG+FE GPKPS MKG+ +++   IP W 
Sbjct  1     MEGVTVVSFFLLFIATAMAAKSTVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AES+  ++V+HNP  E+DP+
Sbjct  120   QDERLNISVAPDS-----GVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP +T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ Q+VRT+ GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VE+FAG+ TL+VPY+SKG GGF RA+ RF AVSTR+R+ F S+FY
Sbjct  295   GSMVVESFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFY  343



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   439 bits (1128),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 270/349 (77%), Gaps = 6/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M+ +T ++  +LF+ T           DG++PNG+FE GPKPS MKG+ +++   IP W 
Sbjct  1     MEGVTVVSFFLLFIATAMAAKSTVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AES+  ++V+HNP  E+DP+
Sbjct  120   QDERLNISVAPDS-----GVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP +T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ Q+VRT+ GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+SKG GGF RA+ RF AV TR+RI F S+FY
Sbjct  295   GSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFY  343



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 208/349 (60%), Positives = 268/349 (77%), Gaps = 8/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  +T ++  +L + T    G+     DG++PNG+FE GPKPS MKG+ V++   IP W 
Sbjct  1     MGGVTVVSLFLLLITTANSAGVS--FRDGMLPNGDFELGPKPSDMKGTEVLNKMAIPNWE  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYI SG  QG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCA
Sbjct  59    VT-GFVEYISSGHTQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D YSWAF AES   +IV+HNP  E+DP+
Sbjct  118   QDERLNISVAPDS-----GVIPVQTVYSSSGWDLYSWAFQAESEIAEIVIHNPGEEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID +A+K L  PR    N+LKNG FEEGP +LP +T GVLIPP IEDDHSPLPGW+
Sbjct  173   CGPLIDGIAMKALYPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWM  232

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D+ HF +P G RA+ELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+
Sbjct  233   VESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACK  292

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAGR TL+VPY+S+G GGF RA+ RF AVSTRTR+ F S+FY
Sbjct  293   GSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFY  341



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 262/321 (82%), Gaps = 5/321 (2%)
 Frame = -3

Query  966  GLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHA  787
            GL+PNGNFE GPK S++KG+ V +PH IP W IS GFVEYIKSG+KQG+M+LVVP+G  A
Sbjct  19   GLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEIS-GFVEYIKSGQKQGDMLLVVPEGGFA  77

Query  786  VRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYS  607
            VRLG +ASI   ++V KG +YS++F+  RTCAQEE LNVS++PN E    GI+P+QTMYS
Sbjct  78   VRLGNEASIKQKLKVKKGEFYSITFSAARTCAQEETLNVSITPNLEKRHRGIMPIQTMYS  137

Query  606  STGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGD  427
            S G+D+Y+W F A+ + +++V+HNP  E+D +CGP+IDSVALKLL +P+    N+LKNG+
Sbjct  138  SNGWDSYAWGFNADFDEIELVIHNPGVEEDAACGPLIDSVALKLLASPKP---NLLKNGN  194

Query  426  FEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVA  247
            +EEGPY+ PNT+WGVLIPP+IED+HSPLPGWIIESLKAVKYIDS HF VP G RA+ELV 
Sbjct  195  YEEGPYVFPNTSWGVLIPPHIEDNHSPLPGWIIESLKAVKYIDSKHFSVPEGWRAIELV-  253

Query  246  GRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIR  67
            G+ESA+ Q+V T+PGK+Y L F+VGD+NN+CEGS+ VEAFAG+  L+VPYQSKG+GGF R
Sbjct  254  GKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLVVEAFAGKDILKVPYQSKGRGGFKR  313

Query  66   ANHRFTAVSTRTRIRFLSSFY  4
                FTAV  RTRI F S+FY
Sbjct  314  XRFLFTAVGPRTRIMFYSTFY  334



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   438 bits (1126),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 257/325 (79%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            ITDGL+PNGNFE+GP  SQ+ G++V   + IP+W IS G VEYI+SG KQG+M+L VP+G
Sbjct  22   ITDGLLPNGNFEKGPSRSQLNGTQVTSRYAIPEWEIS-GVVEYIESGHKQGDMLLPVPEG  80

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
             +AVRLG +AS+   ++V KG YYS++F   RTCAQEERLNVSV+P+S     G+LP+QT
Sbjct  81   VYAVRLGNEASVKQNLKVTKGMYYSITFCAARTCAQEERLNVSVTPDS-----GVLPMQT  135

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            MYSS+G+D Y+WAF A   +V++V+HNP  E+DP+CGP+IDSVA+K L  PR    N+LK
Sbjct  136  MYSSSGWDCYAWAFKALFAQVELVIHNPGVEEDPACGPLIDSVAIKTLYPPRLTNKNLLK  195

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            N DFEEGPYILPNTTWG L+PPNIEDDHSPLPGW++ESLKAV YIDS HF VP G RAVE
Sbjct  196  NADFEEGPYILPNTTWGALVPPNIEDDHSPLPGWMVESLKAVNYIDSAHFKVPQGKRAVE  255

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+ Q+ RT+ G+VY L F VGDA N+C G M VEAFA R T++VPY SKG GG
Sbjct  256  LVGGKESALAQVARTVVGRVYTLSFLVGDAGNACTGPMVVEAFAARSTVKVPYDSKGTGG  315

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F RA  RFTAV+ RTR+ FLS++Y+
Sbjct  316  FKRAVLRFTAVAERTRVVFLSTYYN  340


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 82/194 (42%), Gaps = 29/194 (15%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKGS----RVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            RL    L+ N +FE GP   P+   G+     + D H  +P W++ S   V YI S   +
Sbjct  187  RLTNKNLLKNADFEEGPYILPNTTWGALVPPNIEDDHSPLPGWMVESLKAVNYIDSAHFK  246

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VPQG  AV L  G+++++    R + G  Y+LSF         +  N    P  
Sbjct  247  ------VPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLV------GDAGNACTGPMV  294

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL---HNPAREKDPSCGPIIDS  490
                     ++  Y S G   +  A   F A + R ++V    +   R     CGP++D 
Sbjct  295  VEAFAARSTVKVPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDGSLCGPVVDD  354

Query  489  VA-LKLLNAPRRLR  451
            V  L + N  RRLR
Sbjct  355  VTLLSVRNPSRRLR  368



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   437 bits (1125),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 266/347 (77%), Gaps = 7/347 (2%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRL-ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             M  +T + +FL  I       +   DG++PNG+FE GPKPS MKG+ V++   IPKW ++
Sbjct  1     MGGITVVSIFLLIIATANSAAVYFRDGMLPNGDFELGPKPSDMKGTEVLNKMAIPKWEVT  60

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYI SG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCAQ+
Sbjct  61    -GFVEYISSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQD  119

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLN+SVSP+S     G++P+QT+YSS+G+D Y+WAF AES    IV+HNP  E+DP+CG
Sbjct  120   ERLNISVSPDS-----GVIPVQTVYSSSGWDLYAWAFQAESEIADIVIHNPGVEEDPACG  174

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW++E
Sbjct  175   PLIDGVAMRALYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVE  234

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+D+ HF VP G RA+ELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C+GS
Sbjct  235   SLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGS  294

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+ TL+VPY+S+G GGF RA+ RF AVSTRTR+ F S+FY
Sbjct  295   MVVEAFAGKDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFY  341



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   437 bits (1125),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 267/345 (77%), Gaps = 8/345 (2%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCRLIT--DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSG  859
             +T + LFL  I       +++  DG++PNG+FE GPK S MKG+ V++   IP W +S G
Sbjct  6     VTVVSLFLLLIATANSAAVVSFRDGMLPNGDFELGPKQSDMKGTEVLNKLAIPNWEVS-G  64

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER  679
             FVEYI SG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCAQ+ER
Sbjct  65    FVEYISSGHKQGDMILVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDER  124

Query  678   LNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPI  499
             LN+SVSP+S     G++P+QT+YSS+G+D Y+WAF AES+  ++V+HNP  E+DP+CGP+
Sbjct  125   LNISVSPDS-----GVIPVQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGEEEDPACGPL  179

Query  498   IDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESL  319
             ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW++ESL
Sbjct  180   IDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESL  239

Query  318   KAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMG  139
             KAVKY+D+ HF VP G RA+ELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM 
Sbjct  240   KAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMV  299

Query  138   VEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             VEAFAG+ TL+VPY+S+G GGF RA+ RF AVSTRTR+ F S+FY
Sbjct  300   VEAFAGKETLKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFY  344



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   437 bits (1124),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 261/339 (77%), Gaps = 8/339 (2%)
 Frame = -3

Query  1020  VLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIK  841
             VL   T  H     +  +GLV NGNFE  P+ S MKG+++I  + +P W IS GFVEYIK
Sbjct  10    VLLFATNCHFAFSFI--EGLVENGNFENSPRQSDMKGTQMIGRYALPNWEIS-GFVEYIK  66

Query  840   SGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVS  661
             +G+KQG+M+LVVP+G++AVRLG +ASI   + + KG YYS++F+  RTCAQEE LN+SVS
Sbjct  67    AGQKQGDMLLVVPEGAYAVRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVS  126

Query  660   PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVAL  481
             P     +WG+LP+QT+YSS G+D+Y+WAF A  + V+ V+HNP  E+DP+CGP+IDSVA+
Sbjct  127   P-----EWGVLPMQTLYSSNGWDSYAWAFKALISPVEFVIHNPGVEEDPACGPLIDSVAI  181

Query  480   KLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYI  301
               L  PR    N+LKNG FEEGPY+ PNTTWGVLIPPNIED HS LPGW++ESLKAVKYI
Sbjct  182   TSLYPPRLTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSTLPGWMVESLKAVKYI  241

Query  300   DSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAG  121
             D  HF VP G RAVELVAG+ES + Q+ RT+ GK Y L F+VGDA+NSCEGSM VEAFAG
Sbjct  242   DVEHFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAG  301

Query  120   RLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + TL+VPY+SKGKGGF RA  +F AVSTRTRI F S+FY
Sbjct  302   KDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFY  340



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   437 bits (1123),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 264/349 (76%), Gaps = 13/349 (4%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVIS  865
             M  L+ L++F C  FHV      TDG + N  FE GPKP  MKG+ V   PH IP W IS
Sbjct  1     MGMLSFLLVFCC--FHVTFS--FTDGSIANAEFEFGPKPQDMKGTVVTGGPHAIPGWEIS  56

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GF+EY+KSG+KQG+M+LVVP G++AVRLG  ASI   ++V+KG YYS++F   RTCAQE
Sbjct  57    -GFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVVKGMYYSITFMVARTCAQE  115

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E+LNVSV+P     DW +LP+QT+YS  G+D Y+W+F A+ + V +  H+P +E+DP+CG
Sbjct  116   EKLNVSVAP-----DWVVLPMQTLYSGNGWDAYAWSFQADYSLVDMAFHHPGKEEDPACG  170

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIED--DHSPLPGWI  331
             PIIDS+ALK L  PR    N+LKNG FEEGPY+ PNTT GVLIPPNI D  DHSPLPGWI
Sbjct  171   PIIDSIALKALYPPRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWI  230

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G  AVEL+ G+ESA+ Q+ RTIPGK Y L F+VGDA NSCE
Sbjct  231   VESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCE  290

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GS+ VEA+ G+ +++VPY+SKGKGGF RA  +F AVSTRTRI FLS+FY
Sbjct  291   GSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFY  339



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   437 bits (1124),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 257/321 (80%), Gaps = 6/321 (2%)
 Frame = -3

Query  963  LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAV  784
            L+PNGNFE+GP  SQ+ G++VI  + IP+W I+ GFVEYI+SG KQG+M+L VP+G HAV
Sbjct  32   LLPNGNFEKGPSRSQLNGTQVIGRYAIPEWEIT-GFVEYIESGHKQGDMLLPVPEGVHAV  90

Query  783  RLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSS  604
            RLG +ASI   ++V KG YYS++F   RTCAQEERLNVSV+P+S     G+LP+QTMYSS
Sbjct  91   RLGNEASIKQKLKVTKGMYYSITFCAARTCAQEERLNVSVTPDS-----GVLPMQTMYSS  145

Query  603  TGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDF  424
            +G+D Y+WAF A   +V++V+HNP  E+DP+CGP+IDSVA+K L  PR    N+LKN DF
Sbjct  146  SGWDCYAWAFQALFPQVELVIHNPGVEEDPACGPLIDSVAIKTLYPPRLTNKNLLKNADF  205

Query  423  EEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAG  244
            EEGPYILPNTTWGVL+PPNIEDDHSPLP W++ESLKAV YIDS HF VP G RAVELV G
Sbjct  206  EEGPYILPNTTWGVLVPPNIEDDHSPLPSWMVESLKAVNYIDSAHFKVPQGKRAVELVGG  265

Query  243  RESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRA  64
            +ESA+ Q+VRT+ G+VY L FSVGDA N+C G+M VEAFA R T++VPY SKG GGF RA
Sbjct  266  KESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAARSTVKVPYDSKGTGGFKRA  325

Query  63   NHRFTAVSTRTRIRFLSSFYH  1
              RFTA + RTR+ FLS++Y+
Sbjct  326  VLRFTAEAERTRVVFLSTYYN  346


 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 87/197 (44%), Gaps = 35/197 (18%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            RL    L+ N +FE GP   P+   G      + D H  +P W++ S   V YI S   +
Sbjct  193  RLTNKNLLKNADFEEGPYILPNTTWGVLVPPNIEDDHSPLPSWMVESLKAVNYIDSAHFK  252

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFV---RTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR + G  Y+LSF+       CA    +    +
Sbjct  253  ------VPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAA  306

Query  660  PNSEPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL---HNPAREKDPSCGPI  499
             ++         ++  Y S G   +  A   F AE+ R ++V    +   R     CGP+
Sbjct  307  RST---------VKVPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDGSLCGPV  357

Query  498  IDSVALKLLNAP-RRLR  451
            +D V L  +  P RRLR
Sbjct  358  VDDVTLLSVRKPSRRLR  374



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   436 bits (1122),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 258/322 (80%), Gaps = 6/322 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG++PNG+FE GPKPS MKG+ VI+   IP W ++ GFVEYI SG KQG+M+LVVP G  
Sbjct  26   DGILPNGDFELGPKPSDMKGTEVINKMAIPNWEVT-GFVEYISSGHKQGDMLLVVPAGKF  84

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI   ++V+KG YYSL+F+  RTCAQ+ERLN+SV+P+S     G++P+QT+Y
Sbjct  85   AVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVY  139

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS+G+D Y+WAF AES   +IV+HNP  E+DP+CGP+ID VA++ L  PR    N+LKNG
Sbjct  140  SSSGWDLYAWAFQAESEVAEIVIHNPGEEEDPACGPLIDGVAMRALYPPRPTNKNILKNG  199

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP +LP +T GVLIPP IEDDHSPLPGW++ESLKAVKY+D+ HF +P G RA+ELV
Sbjct  200  GFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHFSIPQGRRAIELV  259

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AG+ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFAGR TL+VPY+S+G GGF 
Sbjct  260  AGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPYESRGTGGFK  319

Query  69   RANHRFTAVSTRTRIRFLSSFY  4
            RA+ RF AVSTRTR+ F S+FY
Sbjct  320  RASIRFVAVSTRTRVMFYSTFY  341



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   436 bits (1120),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 266/345 (77%), Gaps = 10/345 (3%)
 Frame = -3

Query  1029  TALVLFLCTI--FHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGF  856
             TA  +F+  +  FH+ +   I DGL+ NGNFE  PK S + G+ V+  + +P W I+SGF
Sbjct  6     TAATIFMVVLGTFHIAIA--IKDGLMENGNFEIAPKDSDLNGTVVLRQNAVPGW-ITSGF  62

Query  855   VEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERL  676
             VEYIK+G+KQG+M+LVVP+G  A+RLG +ASI   + V KG YYS++F+  RTCAQEE+L
Sbjct  63    VEYIKAGQKQGDMILVVPEGHAAIRLGNEASIKQKINVTKGMYYSITFSAARTCAQEEQL  122

Query  675   NVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPII  496
             NVSV+P     D+G+LP+QT+YSS+G+D+Y+WAF A    V I++HNP  E+DP+CGP+I
Sbjct  123   NVSVAP-----DFGVLPMQTLYSSSGWDSYAWAFQAMYTVVYIIIHNPGVEEDPACGPLI  177

Query  495   DSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLK  316
             DS+A++ L  P+    N++KNGDFEEGPYI PNT+WGVLIPPNIEDDHSPLPGW+IESLK
Sbjct  178   DSIAIRTLYPPKATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLK  237

Query  315   AVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGV  136
             AVKYID+ HF VP  +RAVELVAG+ESA+ Q+ RTI GK Y L F VGDA+NSCEGSM V
Sbjct  238   AVKYIDAAHFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNSCEGSMIV  297

Query  135   EAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             EA+AG +T+++PY S+GKGG+  A   F A + RTRI F S++YH
Sbjct  298   EAYAGIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYH  342


 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 91/194 (47%), Gaps = 30/194 (15%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            +  ++ LV NG+FE GP   P+   G      + D H  +P W+I S   V+YI +    
Sbjct  189  KATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAH--  246

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VP  S AV L  G++++I    R I G  Y+L+F  V   +     ++ V   +
Sbjct  247  ----FSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTF-LVGDASNSCEGSMIVEAYA  301

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVL-----HNPAREKDPSCGPII  496
                 GI+ ++  Y+S G   Y  A   F+A +NR +I+      H  + +    CGP+I
Sbjct  302  -----GIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNASLCGPVI  356

Query  495  DSVALKLLNAPRRL  454
            D V L  +  PR+L
Sbjct  357  DDVKLLSVRNPRKL  370



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   434 bits (1117),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 268/349 (77%), Gaps = 6/349 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  +T ++  +LF+ T           DG++PNG+FE GPKPS MKG+ +++   IP W 
Sbjct  1     MGGVTVVSFFLLFIATATASKSTVSFRDGMLPNGDFELGPKPSDMKGTEILNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AES   ++V+HNP  E+DP+
Sbjct  120   QDERLNISVAPDS-----GVIPVQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ Q+VRTI GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+S+G GGF RA+ RF AVS+R+RI F S+FY
Sbjct  295   GSMVVEAFAGKETLKVPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFY  343



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   434 bits (1117),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 266/349 (76%), Gaps = 9/349 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCR---LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  +T +  FL  I      +      DG++PNG+FE GPKPS MKG+ V++   IP W 
Sbjct  1     MGGVTVVFFFLLLIATATAAKPGFSFRDGILPNGDFELGPKPSDMKGTEVVNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   +RV+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLRVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SVSP+S     G++P+QT+YSS+G+D Y+WAF AES+  ++V+HNP  E+DP+
Sbjct  120   QDERLNISVSPDS-----GVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ QIVRT+ GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+S+G GGF RA+ RF AVS R+R+ F S+FY
Sbjct  295   GSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFY  343



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   434 bits (1116),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 256/322 (80%), Gaps = 6/322 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG++PNG+FE GPKPS MKG++VI+   IP W +S GFVEYIKSG+KQG+M+LVVP G  
Sbjct  23   DGMLPNGDFELGPKPSDMKGTQVINRSAIPNWELS-GFVEYIKSGQKQGDMLLVVPAGKF  81

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            A+RLG +ASI   +R+IKG YYSL+F+  RTCAQ+ERLN+S +P     DWG++P+QT+Y
Sbjct  82   AIRLGNEASIKQRLRLIKGMYYSLTFSAARTCAQDERLNISAAP-----DWGVIPIQTVY  136

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G+D Y+WAF AE+  V++V+HNP  E+DP+CGP+ID+VA++ L  PR    N+LKNG
Sbjct  137  SSYGWDLYAWAFQAETEVVEVVIHNPGVEEDPACGPLIDAVAMRALYPPRPTNKNVLKNG  196

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP +LPN+T GVLIPP IEDDHSPLPGW++ESLKAVKYID  HF VP G RA+ELV
Sbjct  197  GFEEGPLVLPNSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDIEHFSVPQGRRAIELV  256

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AG+ESA+ Q+   I GK Y L F+VGDA+N+C+GSM VEAFAGR TL+VPY+S+G GGF 
Sbjct  257  AGKESAIAQVAPAIAGKTYVLSFAVGDASNACKGSMIVEAFAGRDTLKVPYESRGTGGFK  316

Query  69   RANHRFTAVSTRTRIRFLSSFY  4
            RA  RF A S RTR+ F S+FY
Sbjct  317  RAAMRFVATSNRTRVMFYSTFY  338



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/349 (60%), Positives = 265/349 (76%), Gaps = 9/349 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCR---LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M  +T +  FL  I      +      DG++PNG+FE GPKPS MKG+ V++   IP W 
Sbjct  1     MGGVTVVFFFLLLIATATAAKPGFSFRDGILPNGDFELGPKPSDMKGTEVVNKLAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             ++ GFVEYIKSG KQG+M+LVVP G  AVRLG +ASI   +RV+KG YYSL+F+  RTCA
Sbjct  61    VT-GFVEYIKSGHKQGDMLLVVPAGKFAVRLGNEASIKQRLRVVKGMYYSLTFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLN+SVSP+S     G++P+QT+YSS+G+D Y+WAF AES   ++V+HNP  E+DP+
Sbjct  120   QDERLNISVSPDS-----GVIPIQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGVEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW+
Sbjct  175   CGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKY+D  HF VP G RA+ELVAG+ESA+ QIVRT+ GK Y L F+VGDANN+C+
Sbjct  235   VESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACK  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ TL+VPY+S+G GGF RA+ RF AVS R+R+ F S+FY
Sbjct  295   GSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFY  343



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   434 bits (1115),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/322 (63%), Positives = 258/322 (80%), Gaps = 6/322 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG++PNG+FE GPKPS MKG+ V++   IP W +S GFVEYIKSG KQG+M+LVVP G  
Sbjct  29   DGMLPNGDFELGPKPSDMKGTEVLNKLAIPNWEVS-GFVEYIKSGHKQGDMLLVVPAGKF  87

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI   ++V+KG YYSL+F+  RTCAQ+ERLN+SV+P+S     G++P+QT+Y
Sbjct  88   AVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVY  142

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS+G+D Y+WAF AES+  ++V+HNP  E+DP+CGP+ID VA++ L  PR    N+LKNG
Sbjct  143  SSSGWDLYAWAFQAESDVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNG  202

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP +LP  T GVLIPP IEDDHSPLPGW++ESLKAVKY+D  HF VP G RA+ELV
Sbjct  203  GFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELV  262

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AG+ESA+ QIVRT+ GK Y L F+VGDANN+C+GSM VEAFAG+ TL+VPY+S+G GGF 
Sbjct  263  AGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESRGTGGFK  322

Query  69   RANHRFTAVSTRTRIRFLSSFY  4
            RA+ RF AVS R+RI F S+FY
Sbjct  323  RASIRFVAVSNRSRIMFYSTFY  344



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   431 bits (1109),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 202/305 (66%), Positives = 250/305 (82%), Gaps = 6/305 (2%)
 Frame = -3

Query  918  MKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVI  739
            M+G+ V+  + +PKW IS GFVEYIKSG+KQG+M+LVVP G+ AVRLG +ASI   + V 
Sbjct  1    MRGTVVVGRYAVPKWEIS-GFVEYIKSGQKQGDMLLVVPAGAFAVRLGNEASIKQRLPVA  59

Query  738  KGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESN  559
            +G YYSL+F+  RTCAQEE+LNVSV+P     DWG+LP+QT+YSS G+D+Y+WAF A+ +
Sbjct  60   RGMYYSLTFSAARTCAQEEKLNVSVAP-----DWGVLPMQTLYSSNGWDSYAWAFRADQD  114

Query  558  RVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVL  379
              +IV+HNP  E+DP+CGP+IDSVA++ L  P+    N+LKNGDFEEGPY+ PNT+WGVL
Sbjct  115  VAEIVIHNPGVEEDPACGPLIDSVAIRALYPPKASNRNLLKNGDFEEGPYVFPNTSWGVL  174

Query  378  IPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGK  199
            IPPNIEDDHSPLPGW++ESLKAVKYIDS HF VP G RAVELVAG+ESA+ Q+ RTIPGK
Sbjct  175  IPPNIEDDHSPLPGWMVESLKAVKYIDSGHFSVPEGKRAVELVAGKESAIAQVARTIPGK  234

Query  198  VYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRF  19
             Y L F+VGDA+NSCEGSM VEAFAG+ T++VPY+SKGKGG+ RA  RF AVS RTRI F
Sbjct  235  TYVLSFAVGDASNSCEGSMVVEAFAGKDTVKVPYESKGKGGYKRAVLRFKAVSVRTRIMF  294

Query  18   LSSFY  4
             S+FY
Sbjct  295  YSTFY  299



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   432 bits (1111),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 206/350 (59%), Positives = 269/350 (77%), Gaps = 10/350 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLIT--DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVI  868
             M  +T + LFL  I       +++  DG++PNG+FE GPKPS +KG+ V++   IP W +
Sbjct  1     MVGVTVVSLFLLLITTAANSAVVSFRDGILPNGDFELGPKPSDIKGTEVLNKMAIPNWEV  60

Query  867   SSGFVEYIKS--GEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTC  694
             + GFVEYI S  G KQG+M+LVVP G  AVRLG +ASI   ++V+KG YYSL+F+  RTC
Sbjct  61    T-GFVEYISSASGHKQGDMLLVVPAGKFAVRLGNEASIKQRLKVVKGMYYSLTFSAARTC  119

Query  693   AQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDP  514
             AQ+ERLN+SV+P+S     G++P+QT+YSS+G+D Y+WAF AES   ++V+HNP +E+DP
Sbjct  120   AQDERLNISVAPDS-----GVIPVQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGQEEDP  174

Query  513   SCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW  334
             +CGP+ID VA++ L  PR    N+LKNG FEEGP +LP  T GVLIPP IEDDHSPLPGW
Sbjct  175   ACGPLIDGVAMRSLYPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGW  234

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             ++ESLKAVKY+D+ HF +P G RA+ELVAG+ESA+ Q+ RT+ GK Y L F+VGDANN+C
Sbjct  235   MVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNAC  294

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +GSM VEAFAGR TL+VPY+S+G GGF RA+ RF AVSTRTR+ F S+FY
Sbjct  295   KGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFY  344



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   432 bits (1111),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 263/339 (78%), Gaps = 8/339 (2%)
 Frame = -3

Query  1020  VLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIK  841
             +  LC I  + +    TDGL+PNGNFE GP  S+++G+ VI  + IP+W IS G VEYI 
Sbjct  9     LFLLCAISPMAVA--FTDGLLPNGNFELGPASSKLRGTEVIGRNAIPRWEIS-GTVEYIP  65

Query  840   SGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVS  661
              G KQG+M+LVVP+GS+AVRLG +ASI   ++V +G  YSL+F+  RTCAQ+ERLNVSV+
Sbjct  66    WGHKQGDMLLVVPEGSYAVRLGNEASIKQRIKVTRGVRYSLTFSAARTCAQDERLNVSVA  125

Query  660   PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVAL  481
             P S     G++P+QTMYSS G+D+Y+WA+ A+S+  ++V+HNP  E+DP+CGP+IDSVA+
Sbjct  126   PES-----GVVPMQTMYSSNGWDSYAWAWNAKSDVAEVVIHNPGVEEDPACGPLIDSVAV  180

Query  480   KLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYI  301
             K L+ P R   N+LKNGDFEEGPYILPNTTWGVLIPP  EDDHSPLPGW+++S KAVKY+
Sbjct  181   KALHPPSRTNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYL  240

Query  300   DSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAG  121
             DS HF VP G RAVEL+AG+ESA+ Q VRT+PG+ Y L FSVGDA+N+CEGSM VEAFAG
Sbjct  241   DSAHFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACEGSMIVEAFAG  300

Query  120   RLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
               T++VPY+SKG GG  RA  RF A   RTRI FLSS Y
Sbjct  301   EHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNY  339



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   430 bits (1106),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 255/320 (80%), Gaps = 6/320 (2%)
 Frame = -3

Query  963  LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAV  784
            ++PNG+FE GPKPS MKG+ V++   IP W I+ GFVEYI SG  QG+M+LVVP G  AV
Sbjct  1    MLPNGDFELGPKPSDMKGTEVLNRMAIPNWEIT-GFVEYISSGHTQGDMLLVVPAGKFAV  59

Query  783  RLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSS  604
            RLG +ASI   ++V+KG YYSL+F+  RTCAQ+ERLN+SV+P+S     G++P+QT+YSS
Sbjct  60   RLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDS-----GVIPVQTVYSS  114

Query  603  TGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDF  424
            +G+D YSWAF AES   +IV+HNP  E+DP+CGP+ID +A+K L  PR    N+LKNG F
Sbjct  115  SGWDLYSWAFQAESEIAEIVIHNPGEEEDPACGPLIDGIAMKALYPPRPTNKNILKNGGF  174

Query  423  EEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAG  244
            EEGP +LP +T GVLIPP IEDDHSPLPGW++ESLKAVKY+D+ HF +P G RA+ELVAG
Sbjct  175  EEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTEHFSIPQGRRAIELVAG  234

Query  243  RESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRA  64
            +ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFAGR TL+VPY+S+G GGF RA
Sbjct  235  KESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDTLKVPYESRGTGGFKRA  294

Query  63   NHRFTAVSTRTRIRFLSSFY  4
            + RF AVSTRTR+ F S+FY
Sbjct  295  SIRFVAVSTRTRVMFYSTFY  314



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   431 bits (1108),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 256/322 (80%), Gaps = 6/322 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG++PNG+FE GPKPS MKG+ V++   IP W ++ GFVEYIKSG KQG+M+LVVP G  
Sbjct  29   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVT-GFVEYIKSGHKQGDMLLVVPAGKF  87

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI   +RV+KG YYSL+F+  RTCAQ+E LN+SVSP+S     G++P+QT+Y
Sbjct  88   AVRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDEMLNISVSPDS-----GVIPIQTVY  142

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS+G+D Y+WAF AES   ++V+HNP  E+DP+CGP+ID VA++ L  PR    N+LKNG
Sbjct  143  SSSGWDLYAWAFQAESEVAEVVIHNPGVEEDPACGPLIDGVAMRSLYPPRPTNKNILKNG  202

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP +LP  T GVLIPP IEDDHSPLPGW++ESLKAVKY+D  HF VP G RA+ELV
Sbjct  203  GFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVEHFSVPQGRRAIELV  262

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AG+ESA+ QIVRT+ GK Y L F+VGDANN+C+GSM VEAFAG+ TL+VPY+S+G GGF 
Sbjct  263  AGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKETLKVPYESRGTGGFK  322

Query  69   RANHRFTAVSTRTRIRFLSSFY  4
            RA+ RF AVS R+R+ F S+FY
Sbjct  323  RASIRFVAVSNRSRVMFYSTFY  344



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   430 bits (1106),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 261/347 (75%), Gaps = 3/347 (1%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K+   VL L       +   + DGL+PNGNFE+GPK S++KG++V+    IP W I  
Sbjct  1     MKKVAVFVLLLVGTTS-QIASSVKDGLLPNGNFEQGPKASELKGTKVMSGKSIPNWEIC-  58

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIKSG+KQ +M+L+VPQG+ AVRLG  A I   +RVIK  +YSL+F+  RTCAQEE
Sbjct  59    GYVEYIKSGQKQDDMLLIVPQGAFAVRLGNGALIKQKIRVIKDMFYSLTFSASRTCAQEE  118

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLNVSVSPN+E ND G+ P+QTMYSS G+D+Y+WAF A+++ ++I +HNP+ E+D  CGP
Sbjct  119   RLNVSVSPNNEQNDSGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPSVEEDAVCGP  178

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILP-NTTWGVLIPPNIEDDHSPLPGWIIE  325
             IIDS+ALK L  P+R R N+LKNG+FEEGPYI P  T+ GV+IPP IEDDHSPLPGWIIE
Sbjct  179   IIDSIALKTLYYPKRTRANLLKNGNFEEGPYIFPIPTSEGVIIPPEIEDDHSPLPGWIIE  238

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKA+K+IDS HF VP G RA+EL+AG+ES VVQIV+T  G+ Y L F VGDANN CEG 
Sbjct  239   SLKAIKHIDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANNGCEGP  298

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             M VEAFAG+  + V Y SKGKGGF  A   F A STRTRI F S+ Y
Sbjct  299   MMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIY  345



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   429 bits (1104),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/344 (61%), Positives = 261/344 (76%), Gaps = 13/344 (4%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             LVLF C  FHV      T G V NG FE GPKP  MKG+ V   PH IP W IS GF+EY
Sbjct  8     LVLFCC--FHVAFS--FTHGAVINGEFELGPKPQDMKGTVVTGGPHSIPGWEIS-GFIEY  62

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQ +M+LVVP G++AVRLG +ASI   ++V+KG YYS++F   RTCAQEE+LNVS
Sbjct  63    IKSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVS  122

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
              +P     DW +LP+QT+Y   G+D Y+W+F A+   V +V HNP +E+DP+CGPIIDS+
Sbjct  123   AAP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSI  177

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIED--DHSPLPGWIIESLKA  313
             A++ L  PR    N+LKNG FEEGPY+ PNT+ GVLIPPNI D  +HSPLPGW++ESLKA
Sbjct  178   AIQPLYPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKA  237

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             V+YIDS+HF VP G RAVEL+ G+ESA+ Q+ RTIPGK Y L F+VGDA NSCEGS+ VE
Sbjct  238   VRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVE  297

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             A+ G+ +++VPY+SKGKGGF RA  +F AVSTRTRI FLS+FY+
Sbjct  298   AYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYN  341


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 79/198 (40%), Gaps = 38/198 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPKPSQMKGSRVIDPHGI---------PKWVISS-GFVEYIKSGE  832
            RL    ++ NG FE GP       S V+ P  I         P W++ S   V YI S  
Sbjct  186  RLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYIDSDH  245

Query  831  KQGEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFV---RTCAQEERLNVS  667
                    VP+G  AV L  G++++I    R I G  Y+L F       +C     +   
Sbjct  246  ------FSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEAY  299

Query  666  VSPNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHNP---AREKDPS--  511
            V   S         ++  Y S G   F   +  F+A S R +I+  +     R  D +  
Sbjct  300  VGKES---------VKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASL  350

Query  510  CGPIIDSVALKLLNAPRR  457
            CGP+ID V L  L  P R
Sbjct  351  CGPVIDDVTLISLRKPHR  368



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   424 bits (1089),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/346 (60%), Positives = 263/346 (76%), Gaps = 16/346 (5%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             ++L LC       CRL   ITDGL+ NGNFERGP+PSQ++G++V+    IP W  +SGFV
Sbjct  10    VLLLLCAT-----CRLALGITDGLLANGNFERGPQPSQLRGTQVVGASSIPSWR-TSGFV  63

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVR-VIKGGYYSLSFTFVRTCAQEERL  676
             EYI SG+KQG+MVLVVP+G++AVRLG +ASI   +R  + G  YSL+F+  RTCAQ ERL
Sbjct  64    EYIPSGQKQGDMVLVVPEGAYAVRLGNEASIAQRLRGAVPGARYSLTFSAARTCAQAERL  123

Query  675   NVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPII  496
             NVS S  S     G+L +QTMYSS G+D+YSWA+ A ++ V++V+HNP   +DP+CGP+I
Sbjct  124   NVSASGQS-----GVLVMQTMYSSNGWDSYSWAWDASADEVEVVVHNPGVTEDPACGPLI  178

Query  495   DSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLK  316
             DSVA+K L  PRR   N++KNGDFEEGPYI+P T WGVLIP    D+HSPLPGW++ESLK
Sbjct  179   DSVAIKTLTPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSPLPGWMVESLK  238

Query  315   AVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGV  136
             AVKYIDS+HF VP G RAVEL+AGRESA+ Q++RT+PGK Y L FSVGDA+N+C GS+ V
Sbjct  239   AVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMV  298

Query  135   EAFAGRLTLQVPYQSKGKGGFI-RANHRFTAVSTRTRIRFLSSFYH  1
             EA+AGR + +VPY+S G+GG   RA   F A S RTR+ F SSFY+
Sbjct  299   EAYAGRESAKVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYN  344


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 31/195 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     LV NG+FE GP   P    G    SR +D H  +P W++ S   V+YI S    
Sbjct  190  RRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSPLPGWMVESLKAVKYIDSDH--  247

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VP+G  AV L  G +++I   +R + G  Y+LSF+      TC     L V   
Sbjct  248  ----FAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTC--RGSLMVEAY  301

Query  660  PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGPII  496
               E      +P ++             F A S R ++V  +     R  D S  CGP+I
Sbjct  302  AGRESAK---VPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVI  358

Query  495  DSVALKLLNA--PRR  457
            D VA+  + A  P+R
Sbjct  359  DDVAVVSVRARHPKR  373



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   422 bits (1085),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 208/347 (60%), Positives = 256/347 (74%), Gaps = 9/347 (3%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M K   L+ FL   F   +   I DGL+PNGNFE GPK SQ+KG  V D   IPKW IS 
Sbjct  1     MYKTLVLLAFL---FSNAVSVPIRDGLLPNGNFELGPKSSQLKGVLVTDRAAIPKWEIS-  56

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             G+VEYIK+G+ QG+M+LVVP+GS AVRLG +ASI   + V  G +YS++F+  RTCAQEE
Sbjct  57    GYVEYIKAGQTQGDMLLVVPEGSSAVRLGNEASIRQKISVRTGQFYSITFSAARTCAQEE  116

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLN+SV+  S     GI+P+QTMYSS G+D+Y+WAF A    +++ +HNP  E+DP+CGP
Sbjct  117   RLNISVTHES-----GIIPIQTMYSSNGWDSYAWAFKAGGPDIEVRIHNPGLEEDPACGP  171

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDS+A+K L+ PR LR NM+KNG+FEEGPY+ PN  WGVLIPP IEDD+S LPGWI+ES
Sbjct  172   LIDSLAIKALSPPRFLRNNMIKNGNFEEGPYVFPNVKWGVLIPPFIEDDNSALPGWIVES  231

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKY+D  HF VP G RA+ELV G+ES+V QIVRT P K Y+L F+VGDA NSCEG M
Sbjct  232   LKAVKYVDKAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGNSCEGPM  291

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              VEAFAGR  + V Y S GKGG   A   F A+S RTR+ FLS+FYH
Sbjct  292   AVEAFAGRGRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYH  338



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   422 bits (1085),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 260/344 (76%), Gaps = 18/344 (5%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             ++L LC       CRL   ITDGL+PNGNFERGP PSQ++G+RV+    IP W  +SGFV
Sbjct  6     MLLLLCAT-----CRLALGITDGLLPNGNFERGPAPSQLRGTRVMGSSAIPAWQ-TSGFV  59

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVR-VIKGGYYSLSFTFVRTCAQEERL  676
             EYI SG KQG+MVLVVP+G++AVRLG +ASI   +    +G  YSL+F+  RTCAQ E+L
Sbjct  60    EYIPSGRKQGDMVLVVPEGAYAVRLGNEASIRQRLHGAARGARYSLTFSAARTCAQAEQL  119

Query  675   NVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPII  496
             NVS S  S     G+L +QTMYSS G+D+Y+WA++A+++ V +V+HNP    DP+CGP+I
Sbjct  120   NVSASGQS-----GLLAMQTMYSSNGWDSYAWAWVADADEVDVVIHNPG---DPACGPLI  171

Query  495   DSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLK  316
             DSVA+K LN PRR   N++KNGDFEEGPYI+P T WGVLIP  + DDHSPLPGW++ESLK
Sbjct  172   DSVAIKTLNPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLPGWMVESLK  231

Query  315   AVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGV  136
             A+KYIDS+ F VP G RAVEL+AGRESA+ Q++RT+PG+ Y L F+VGDA+N+C GS+ V
Sbjct  232   AIKYIDSDSFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNACRGSLMV  291

Query  135   EAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             EA+AGR + +V Y+S GKGG  RA   F A S RTR+ F SSFY
Sbjct  292   EAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFY  335


 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 87/193 (45%), Gaps = 30/193 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     LV NG+FE GP   P    G    SRV+D H  +P W++ S   ++YI S    
Sbjct  183  RRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLPGWMVESLKAIKYIDSDS--  240

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VP+G  AV L  G +++I   +R + G  Y+LSFT V   +   R ++ V   +
Sbjct  241  ----FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFT-VGDASNACRGSLMVEAYA  295

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVLHNP---AREKDPS--CGPII  496
                 G    +  Y S G      A   F A S R ++V  +     R  D S  CGP++
Sbjct  296  -----GRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGPVL  350

Query  495  DSVALKLLNAPRR  457
            D VA+  +   +R
Sbjct  351  DDVAVVSVRTTKR  363



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   420 bits (1080),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 261/332 (79%), Gaps = 9/332 (3%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             K T++  L+L + + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W +S
Sbjct  2     KETRVIVLLL-IHSFFYVAFC--FKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELS  58

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYI SG+KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCAQ+
Sbjct  59    -GFVEYIPSGQKQGDMILVVPKGAFAVRLGNEASIKQKIIVKKGSYYSITFSAARTCAQD  117

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+   IV+HNP  E+DP+CG
Sbjct  118   ERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGVEEDPACG  172

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID VA++ L  PR    N+LKNG FEEGP++LPNTT GVLIPPN  DDHSPLPGW++E
Sbjct  173   PLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVE  232

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+DS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L F+VGDA+N+C GS
Sbjct  233   SLKAVKYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGS  292

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFT  49
             M VEAFAG+ T++VPY+SKGKGGF RA+ RF 
Sbjct  293   MIVEAFAGKDTIKVPYESKGKGGFKRASLRFV  324



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   421 bits (1083),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 251/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP K + + G+ V   + IP W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  22   TDGLLPNGNFEEGPPKSALVNGTVVRGANAIPLWE-TSGFVEYIESGHKQGDMLLVVPQG  80

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ ERLNVSVSP     +WG+LP+QT
Sbjct  81   AHAVRLGNEASIRQRLAVTRGAYYAITFSAARTCAQAERLNVSVSP-----EWGVLPMQT  135

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P  +RGNMLK
Sbjct  136  IYGSNGWDSYAWAFKAKFDTVTLVIHNPGVEEDPACGPLIDGVAIRALYPPTLVRGNMLK  195

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  196  NGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFKVPQGARAVE  255

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV GRESA+VQ VRT+PG  Y L F+VGDA + C GSM  EAFA R T++VPY+SKG GG
Sbjct  256  LVGGRESALVQEVRTVPGWSYRLSFAVGDAGDGCTGSMVAEAFAARATVKVPYESKGTGG  315

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   FTA++ RTR+ F S+FYH
Sbjct  316  YKRAVLDFTAIANRTRVVFQSTFYH  340



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   422 bits (1084),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 251/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP K + + G+ V   + IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  22   TDGLLPNGNFEDGPPKSALVNGTVVSGANAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  80

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ E LNVSVSP     +WG+LP+QT
Sbjct  81   AHAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAEALNVSVSP-----EWGVLPMQT  135

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   RGNMLK
Sbjct  136  IYGSNGWDSYAWAFKAKLSTVTLVIHNPGVEEDPACGPLIDGVAIRALYPPTLARGNMLK  195

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVL+PPNIEDDHSPLPGW+I S KAVKY+D+ HF VP G RAVE
Sbjct  196  NGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPGWMIASSKAVKYVDAAHFAVPQGARAVE  255

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV GRESA+VQ VRT+PG  Y L F+VGD+ + C GSM  EA+A R T++VPY+SKG GG
Sbjct  256  LVGGRESALVQEVRTVPGWSYRLAFAVGDSGDGCTGSMVAEAYAARATVKVPYESKGTGG  315

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   FTAV+ RTR+ F S+FYH
Sbjct  316  YKRAVLDFTAVANRTRVVFQSTFYH  340



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   420 bits (1079),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 248/312 (79%), Gaps = 6/312 (2%)
 Frame = -3

Query  936  GPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASIT  757
             P  S + G+ V+ PH IPKW IS GFVEYIK+G+KQG+M+LVVP+G  AVRLG +AS+ 
Sbjct  2    APAKSDLNGTIVLKPHAIPKWQIS-GFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASVK  60

Query  756  TTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWA  577
              V V KG YYS++F+  RTCAQEE +NVSV+P     D+G+LP+QT+YSS G+D+Y+WA
Sbjct  61   QYVNVTKGMYYSITFSAARTCAQEEMVNVSVAP-----DFGVLPIQTLYSSNGWDSYAWA  115

Query  576  FLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPN  397
            F   S+  +I++HNP  E+DP+CGP+ID++A++ L  PR  R N+LKNGDFEEG YILP 
Sbjct  116  FRTSSSVAEILIHNPGVEEDPACGPLIDAIAIRALYPPRPTRDNLLKNGDFEEGAYILPK  175

Query  396  TTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIV  217
            T+WGVLIPPNIEDD+SPLP W++ESLKAVKYID  HF VP G RA+ELV G+ESA+ Q+ 
Sbjct  176  TSWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVA  235

Query  216  RTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVST  37
            RTI GK Y+L F+VGDA+NSCEGSM VEAFAGR T++VPY+S+GKGG+ RA  RF A + 
Sbjct  236  RTIAGKTYQLTFAVGDASNSCEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTN  295

Query  36   RTRIRFLSSFYH  1
            RTRI FLS++YH
Sbjct  296  RTRIMFLSTYYH  307



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   419 bits (1078),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/349 (60%), Positives = 265/349 (76%), Gaps = 21/349 (6%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+M  +  ++L L + F+V  C    DGL+PNG+FE GP+ S MKG++VI+   IP W 
Sbjct  1     MKEMGVI--VLLLLHSFFYVAFC--FKDGLLPNGDFELGPRHSDMKGTQVINKAAIPNWE  56

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI SG+KQG+M+LVVP+G+ AVRLG +ASI   + V KG YYS++F+  RTCA
Sbjct  57    LS-GFVEYIPSGQKQGDMILVVPKGAFAVRLGNEASIKQKISVKKGSYYSITFSAARTCA  115

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+ERLNVSV+P+       ++P+QT+YSS+G+D           R+  V+HNP  E+DP+
Sbjct  116   QDERLNVSVAPHH-----AVMPIQTVYSSSGWD-----------RIGAVIHNPGVEEDPA  159

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID VA++ L  PR    N+LKNG FEEGP++LPNTT GVLIPPN  DDHSPLPGW+
Sbjct  160   CGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWM  219

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK Y L F+VGDA+N+C 
Sbjct  220   VESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACA  279

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAG+ T++VPY+SKGKGGF RA+ RF A S RTR+ F S+FY
Sbjct  280   GSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFY  328


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  176  RPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  233

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF        CA    +     
Sbjct  234  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAG  289

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S R +++ ++     R  D S  CG
Sbjct  290  KDT---------IKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSSLCG  340

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  341  PVIDDV--KLLSARR  353



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   427 bits (1097),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 263/349 (75%), Gaps = 12/349 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MK+   L+ L+L  C   H   C  + DGL+ NGNFE  PK S + G+ V   + IP+W 
Sbjct  1     MKRFALLSVLLLATC---HFSFC--VKDGLLENGNFELAPKASDLNGTEVKGRYAIPEWE  55

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYIK+G+KQG+M+LVVP+G+ AVRLG +ASI   + V KG +Y+L+F   RTCA
Sbjct  56    IS-GFVEYIKAGQKQGDMLLVVPEGACAVRLGNEASIKQRLNVTKGMFYALTFCAARTCA  114

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             QEERLNVSV P+S     G+LP+QT+Y S G+D YSWAFLA  + V+I++HNP  E+DP+
Sbjct  115   QEERLNVSVPPDS-----GLLPIQTLYGSNGWDCYSWAFLAPLSLVEIIIHNPGVEEDPA  169

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A+K L  P+    N+++N  FE GPY+  NTT GVLIPPNIEDDHSPLP W+
Sbjct  170   CGPLIDSIAIKELVNPKPTSENLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWM  228

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             +ESLKAVKYIDS+HF VP G RAVELVAG+ESA+ Q+VRTI GK Y L FSVGDA+NSCE
Sbjct  229   VESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCE  288

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             GSM VEAFAGR T++VPY+SKGKGGF R    F A  TRTRI FLS+FY
Sbjct  289   GSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFY  337



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   418 bits (1074),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 249/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP  S +  G+ V   + IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ E+LNVSVSP     +WG+LP+QT
Sbjct  83   AHAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP-----EWGVLPMQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   +GNMLK
Sbjct  138  IYGSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPACGPLIDGVAIRALYPPTLAKGNMLK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  198  NGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVE  257

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+VQ VRT+PG  Y L F+VGDA + C GSM  EA+A R +++VPY+SKG GG
Sbjct  258  LVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGG  317

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   F A++ RTR+ F S+FYH
Sbjct  318  YKRAVLEFAAIANRTRVVFQSTFYH  342



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   444 bits (1143),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 263/340 (77%), Gaps = 9/340 (3%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
              VL + T+  V   R   DG++PNG FERGPKPS +KG+RVI+ + IP W +S GF+EYI
Sbjct  10    FVLLISTVTSVFCFR---DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELS-GFIEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP G  AVRLG +ASI   V V KG YYSL+F+  RTCAQ+ERLN+SV
Sbjct  66    KSGQKQGDMLLVVPAGKFAVRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P+S     G++P+QT+YSS G+D Y+WAF A+S+  +IV+HNP  E+ P+CGP+ID VA
Sbjct  126   APDS-----GVIPIQTLYSSNGWDLYAWAFQAQSDVAEIVIHNPGEEEHPACGPLIDGVA  180

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             +K L  PR    N+LKNG FEEGPYI+PN T GVLIPP IEDDHSPLP WIIESLKAVKY
Sbjct  181   IKALYPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKY  240

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D  HF VP G RAVELVAG+ESA+ Q+ RTI GK Y L F+VGDANN+C+GSM VEAFA
Sbjct  241   VDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFA  300

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G+ TL+V Y+SKGKGGF RA  RF AVS RTR+ F S+FY
Sbjct  301   GKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFY  340



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   418 bits (1074),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 249/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP  S +  G+ V   + IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  50   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  108

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ E+LNVSVSP     +WG+LP+QT
Sbjct  109  AHAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP-----EWGVLPMQT  163

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   +GNMLK
Sbjct  164  IYGSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPACGPLIDGVAIRALYPPTLAKGNMLK  223

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  224  NGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVE  283

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+VQ VRT+PG  Y L F+VGDA + C GSM  EA+A R +++VPY+SKG GG
Sbjct  284  LVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGG  343

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   F A++ RTR+ F S+FYH
Sbjct  344  YKRAVLEFAAIANRTRVVFQSTFYH  368



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   417 bits (1071),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 255/346 (74%), Gaps = 9/346 (3%)
 Frame = -3

Query  1035  KLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSG  859
             +   L+L +CT        ++TDGL+PNGNFE GP K   + G+ V   + IP W  +SG
Sbjct  2     RFAVLLLLVCTAARA--AAVVTDGLLPNGNFEAGPPKTDLVNGTVVKGGNAIPNWE-TSG  58

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER  679
             FVEYI+SG KQG+M+LVVPQG+HAVRLG +ASI   + V +G YY+++F+  RTCAQ ER
Sbjct  59    FVEYIESGHKQGDMLLVVPQGAHAVRLGNEASIRQKLAVARGSYYAITFSAARTCAQAER  118

Query  678   LNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPI  499
             +N+SVSP S     G+LP+QT+Y S G+D+Y+WAF A+ + VQ+VLHN   E+DP+CGP+
Sbjct  119   INISVSPES-----GVLPMQTIYGSNGWDSYAWAFKAKLDVVQLVLHNVGIEEDPACGPL  173

Query  498   IDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESL  319
             +D+VA++ L  P   +GNMLKNG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S 
Sbjct  174   VDAVAIRTLYPPTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSS  233

Query  318   KAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMG  139
             KAVKY+DS HF VP GTRAVELV G+ESA+VQ VRT+PG  Y L F+VGDA + C GSM 
Sbjct  234   KAVKYVDSAHFRVPEGTRAVELVGGKESALVQEVRTVPGWTYRLTFAVGDAADGCTGSMV  293

Query  138   VEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              EA+A R  ++VPY SKG GGF RA   F AV  RTRI F S+FYH
Sbjct  294   AEAYAARAIVKVPYDSKGAGGFKRAVLDFAAVGNRTRIVFQSTFYH  339



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   416 bits (1070),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 251/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            ITDGL+PNGNFER P PSQ++G+RV+    IP W  +SGFVEYI SG+KQG+MVLVVP+G
Sbjct  25   ITDGLLPNGNFERSPLPSQLRGTRVVGASAIPSWQ-TSGFVEYISSGQKQGDMVLVVPEG  83

Query  795  SHAVRLGEDASITTTVR-VIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            ++AVRLG +ASI   +R   +G  YSL+F+  RTCAQ E+LNVS S  S     G+L +Q
Sbjct  84   AYAVRLGNEASIRQRLRGAARGARYSLTFSAARTCAQAEQLNVSASGQS-----GLLAMQ  138

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            TMYSS G+D+Y+WA++A ++ V IV+HNP   +DP+CGP+IDSVA+K LN PRR   N++
Sbjct  139  TMYSSNGWDSYAWAWVANADEVDIVIHNPGVTEDPACGPLIDSVAIKTLNPPRRTNKNLV  198

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNGDFEEGPYI+P T WGVLIP  + +DHSPLPGW++ESLKA+KYID   F VP G RAV
Sbjct  199  KNGDFEEGPYIIPGTKWGVLIPSRVVEDHSPLPGWMVESLKAIKYIDGESFAVPRGRRAV  258

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            EL+AGRESA+ Q++RT+PG+ Y L F++GDA+N+C GS+ VEA+AGR + +V Y+S GKG
Sbjct  259  ELLAGRESAIAQVIRTVPGRQYVLSFTIGDASNACRGSLMVEAYAGRESTKVAYESAGKG  318

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            G  RA   F A S RTR+ F SSFY
Sbjct  319  GVKRAVLPFRAASARTRLVFFSSFY  343



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   415 bits (1066),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 204/347 (59%), Positives = 258/347 (74%), Gaps = 18/347 (5%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             ++L LCT     +CRL   ITDGL+PNGNFERGP PSQ++G+RV+    IP W  +SGFV
Sbjct  11    ILLLLCT-----MCRLALGITDGLLPNGNFERGPLPSQLRGTRVLGSSSIPSWQ-TSGFV  64

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVR-VIKGGYYSLSFTFVRTCAQEERL  676
             EYI SG+KQG+M+LVVP+G++AVRLG +ASI   +R    G  YSL+F+  RTCAQ ERL
Sbjct  65    EYIPSGQKQGDMLLVVPEGAYAVRLGNEASIRQRLRGAAPGARYSLTFSAARTCAQAERL  124

Query  675   NVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLA---ESNRVQIVLHNPAREKDPSCG  505
             N+S S  S     G+L +QT YSS G+D+Y+WA++A    S  V++ +HNP    DP+CG
Sbjct  125   NISASGQS-----GLLAIQTTYSSNGWDSYAWAWVAAVDSSGEVEVSIHNPGVADDPACG  179

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+IDSVA+K LN PRR   N++KNGDFEEGPYILP T WGVLIP  + DDHSPLPGW++E
Sbjct  180   PLIDSVAVKALNPPRRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLPGWMVE  239

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAV+Y+D   F VP G RAVEL+AGRE AV Q+VRT+PG+ Y L F+VGDA N+C GS
Sbjct  240   SLKAVRYVDGGSFAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNACRGS  299

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + VEA+AGR +++V Y+S+GKGG  RA   F A + RTRI F SSFY
Sbjct  300   LVVEAYAGRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFY  346


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 85/192 (44%), Gaps = 30/192 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     LV NG+FE GP   P    G    SRV+D H  +P W++ S   V Y+  G   
Sbjct  194  RRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLPGWMVESLKAVRYVDGGS--  251

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
                  VP+G  AV L  G + ++   VR + G  Y+LSFT V       R ++ V   +
Sbjct  252  ----FAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFT-VGDAGNACRGSLVVEAYA  306

Query  651  EPNDWGILPLQTMYSSTGFDTYSWA---FLAESNRVQIVLHNP---AREKDPS--CGPII  496
                 G   ++  Y S G      A   F A + R +IV  +     R  D S  CGP++
Sbjct  307  -----GRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSSLCGPVL  361

Query  495  DSVALKLLNAPR  460
            D VA+  + A R
Sbjct  362  DDVAVVSVRAKR  373



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/344 (59%), Positives = 257/344 (75%), Gaps = 15/344 (4%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEY  847
             LVLF C  FHV      +   V NG FE GPKP  MKG+ V   PH IP W IS GF+EY
Sbjct  8     LVLFCC--FHVAF----SFTHVINGEFELGPKPQDMKGTVVTGGPHSIPGWEIS-GFIEY  60

Query  846   IKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVS  667
             IKSG+KQ +M+LVVP G++AVRLG +ASI   ++V+KG YYS++F   RTCAQEE+LNVS
Sbjct  61    IKSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVS  120

Query  666   VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSV  487
              +P     DW +LP+QT+Y   G+D Y+W+F A+   V +V HNP +E+DP+CGPIIDS+
Sbjct  121   AAP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSI  175

Query  486   ALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIED--DHSPLPGWIIESLKA  313
             A++ L  PR    N+LKNG FEEG Y+ PNT+ GVLIPPNI D  +HSPLPGW++ESLKA
Sbjct  176   AIQPLYPPRLTNKNVLKNGGFEEGLYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKA  235

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             V+YIDS+HF VP G RAVEL+ G+ESA+ Q+ RTIPGK Y L F+VGDA NS EGS+ VE
Sbjct  236   VRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSSEGSLSVE  295

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             A+ G+ +++VPY+SKGKGGF RA  +F AVSTRT I FLS+FY+
Sbjct  296   AYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYN  339



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   414 bits (1063),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 258/348 (74%), Gaps = 7/348 (2%)
 Frame = -3

Query  1041  MTKLTALVL-FLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             M +  A++L  LC   +V +   I DGL+PNGNFE GPKPSQ+KGS +     +P W I+
Sbjct  1     MYQEAAIILALLCLSSNVVVSAPIRDGLLPNGNFEMGPKPSQLKGSIIKGRTAVPNWDIT  60

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              GFVEYIK+G++Q +MVLVVP+G+ AVRLG +ASI+  + V  G  YS++F+  RTCAQ+
Sbjct  61    -GFVEYIKAGQRQEDMVLVVPEGASAVRLGNEASISQKITVQSGRLYSITFSAARTCAQD  119

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             ERLN+SV+  S     G++P+QTMY S G+D+YSWAF A    ++I +HNP  E+DP+CG
Sbjct  120   ERLNISVTHES-----GVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRVHNPGHEEDPACG  174

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID+VA+K L  PR +  N++KNG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIE
Sbjct  175   PLIDAVAIKALFPPRFIGNNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIE  234

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKY+D  HF VP G RA+ELVAG+ESA+ QIVRT   + Y L F+VGDA ++CEG 
Sbjct  235   SLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDTCEGP  294

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             M VEAFAGR  + V Y SKGKGGF +    F AVSTRTR+ FLS+FYH
Sbjct  295   MIVEAFAGRSKIMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYH  342



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   413 bits (1062),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 249/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP  S++  G+ V     IPKW  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  21   TDGLLPNGNFESGPAKSELVNGTVVKGGKAIPKWE-TSGFVEYIESGHKQGDMLLVVPQG  79

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG DASI   + V +G YY+++F+  RTCAQ ERLNVSVSP S     G+LP+QT
Sbjct  80   AYAVRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPES-----GVLPMQT  134

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V++V+HNP  E+DP+CGP+ID+VA++ L  P   +GNMLK
Sbjct  135  IYGSNGWDSYAWAFKAKLDVVELVIHNPGVEEDPACGPLIDAVAIRTLYPPTLSKGNMLK  194

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  195  NGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFKVPEGARAVE  254

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+VQ VRT+PG  Y L F+VGD+ + C+GSM  EA+A R TL+VPY+S G GG
Sbjct  255  LVGGKESALVQEVRTVPGWAYRLSFAVGDSADGCKGSMVAEAYAARSTLKVPYESNGAGG  314

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   F AV  RTR+ F S+FYH
Sbjct  315  YKRAVLDFVAVRDRTRVVFQSAFYH  339



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   412 bits (1059),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 249/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE  P  S++  G+ V     IPKW  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  22   TDGLLPNGNFELDPAKSELVNGTVVKGGKAIPKWE-TSGFVEYIESGHKQGDMLLVVPQG  80

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG DASI   + V +G YY+++F+  RTCAQ ERLNVSVSP S     G+LP+QT
Sbjct  81   AYAVRLGNDASILQRIPVARGSYYAVTFSAARTCAQAERLNVSVSPES-----GVLPMQT  135

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V++V+HNP  E+DP+CGP+ID+VA++ L  P   +GNMLK
Sbjct  136  IYGSNGWDSYAWAFKAKLDVVELVIHNPGVEEDPACGPLIDAVAIRTLYPPTLSKGNMLK  195

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY LPN +WGVLIPPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  196  NGGFEEGPYFLPNASWGVLIPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFSVPEGARAVE  255

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+VQ VRT+PG  Y L F+VGD+ + C+GSM  EA+A R TL+VPY+SKG GG
Sbjct  256  LVGGKESALVQEVRTVPGWAYRLSFAVGDSGHDCKGSMVAEAYAARSTLKVPYESKGAGG  315

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   F AV  RTR+ F S+FYH
Sbjct  316  YKRAVLDFVAVRDRTRVVFQSAFYH  340



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 242/308 (79%), Gaps = 9/308 (3%)
 Frame = -3

Query  918  MKGSRVID-PHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRV  742
            MKG+ V   PH IP W IS GF+EY+KSG+KQG+M+LVVP G++AVRLG  ASI   ++V
Sbjct  1    MKGTVVTGGPHAIPGWEIS-GFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKV  59

Query  741  IKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAES  562
            +KG YYS++F   RTCAQEE+LNVSV+P     DW +LP+QT+YS  G+D Y+W+F A+ 
Sbjct  60   VKGMYYSITFMVARTCAQEEKLNVSVAP-----DWVVLPMQTLYSGNGWDAYAWSFQADY  114

Query  561  NRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGV  382
            + V +  H+P +E+DP+CGPIIDS+ALK L  PR    N+LKNG FEEGPY+ PNTT GV
Sbjct  115  SLVDMAFHHPGKEEDPACGPIIDSIALKALYPPRPTNKNVLKNGGFEEGPYVFPNTTSGV  174

Query  381  LIPPNIED--DHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTI  208
            LIPPNI D  DHSPLPGWI+ESLKAVKYIDS+HF VP G  AVEL+ G+ESA+ Q+ RTI
Sbjct  175  LIPPNIVDLSDHSPLPGWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTI  234

Query  207  PGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTR  28
            PGK Y L F+VGDA NSCEGS+ VEA+ G+ +++VPY+SKGKGGF RA  +F AVSTRTR
Sbjct  235  PGKTYTLSFAVGDAGNSCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTR  294

Query  27   IRFLSSFY  4
            I FLS+FY
Sbjct  295  ILFLSTFY  302



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   408 bits (1049),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 246/305 (81%), Gaps = 6/305 (2%)
 Frame = -3

Query  918  MKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVI  739
            MKG++V++   IPKW +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V 
Sbjct  1    MKGTQVMNKTAIPKWELS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVK  59

Query  738  KGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESN  559
            KG YY+++F+  RTCAQ+E+LNVSV+P       G++P+QT+YSS+G+D YSWAF A ++
Sbjct  60   KGSYYAITFSAARTCAQDEQLNVSVAPRH-----GVMPIQTVYSSSGWDLYSWAFKAHND  114

Query  558  RVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVL  379
              +IV+HNP  E+DP+CGP+ID VA++ L  PR    N+LKNG FEEGP++LPN++ GVL
Sbjct  115  YAEIVIHNPGVEEDPACGPLIDGVAIRALYPPRPTNKNILKNGGFEEGPWVLPNSSSGVL  174

Query  378  IPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGK  199
            IPPN  DDHSPLPGW++ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK
Sbjct  175  IPPNSIDDHSPLPGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGK  234

Query  198  VYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRF  19
             Y L F+VGDA+N+C GSM VEAFAG+ T++VPY+SKGKGGF RA+ RF AVS RTR+ F
Sbjct  235  TYVLSFAVGDASNACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMF  294

Query  18   LSSFY  4
             S+FY
Sbjct  295  YSTFY  299


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 87/195 (45%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  147  RPTNKNILKNGGFEEGPWVLPNSSSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  204

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF        CA    +     
Sbjct  205  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAG  260

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S R +++ ++     RE D S  CG
Sbjct  261  KDT---------IKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSSLCG  311

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  312  PVIDDV--KLLSARR  324



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   409 bits (1051),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 192/326 (59%), Positives = 248/326 (76%), Gaps = 6/326 (2%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
             +  G + NGNFE+ P P  + GS +   + IPKW IS GFVEYIK+G+KQG+M+LVVP+
Sbjct  1    FVAAGPLDNGNFEQPPDPKDLNGSVIKTRYAIPKWEIS-GFVEYIKAGQKQGDMLLVVPE  59

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G  A+RLG +ASI  ++ V  G YYSL+F+  RTCAQEE+LN+SV+P     D G+LP+Q
Sbjct  60   GYAAIRLGNEASIKQSLNVTPGLYYSLTFSAARTCAQEEKLNISVAP-----DNGVLPVQ  114

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            T+YSS G+D+Y+WAF A      +++HNP  E+DP+CGP+IDSVA++ L  P+    N+L
Sbjct  115  TLYSSNGWDSYAWAFRAVYGVADVLIHNPGVEEDPACGPLIDSVAIRALYPPKPTNQNIL  174

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNGDFEEG YI PNT+WGVLIPPNIEDD+SPLP W++ESLKAV+YIDS HF VP G RA+
Sbjct  175  KNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVRYIDSAHFSVPRGRRAI  234

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELV GRESA+ Q+ RT  GK Y L F+VGDA+NSCEGSM VEAFAG  ++++PY+S G+G
Sbjct  235  ELVGGRESAIAQVARTAAGKFYRLTFAVGDASNSCEGSMVVEAFAGGSSVRIPYESSGRG  294

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            G+ RA  +F A S RTRI F S++YH
Sbjct  295  GYKRAILQFVAASDRTRIMFTSTYYH  320



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   408 bits (1048),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 245/305 (80%), Gaps = 6/305 (2%)
 Frame = -3

Query  918  MKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVI  739
            MKG++VI+   IP W +S GFVEYI SG KQG+M+LVVP+G+ AVRLG +ASI   + V 
Sbjct  1    MKGTQVINITAIPNWELS-GFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVK  59

Query  738  KGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESN  559
            KG YYS++F+  RTCAQ+ERLNVSV+P+       ++P+QT+YSS+G+D YSWAF A+S+
Sbjct  60   KGSYYSITFSAARTCAQDERLNVSVAPHH-----AVMPIQTVYSSSGWDLYSWAFKAQSD  114

Query  558  RVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVL  379
               IV+HNP  E+DP+CGP+ID VA++ L  PR    N+LKNG FEEGP++LPN + GVL
Sbjct  115  YADIVIHNPGVEEDPACGPLIDGVAMRALFPPRPTNKNILKNGGFEEGPWVLPNISSGVL  174

Query  378  IPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGK  199
            IPPN  DDHSPLPGW++ESLKAVKYIDS+HF VP G RAVELVAG+ESAV Q+VRTIPGK
Sbjct  175  IPPNSIDDHSPLPGWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGK  234

Query  198  VYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRF  19
             Y L FSVGDA+N+C GSM VEAFAG+ T++VPY+SKGKGGF R++ RF AVS+RTR+ F
Sbjct  235  TYVLSFSVGDASNACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMF  294

Query  18   LSSFY  4
             S+FY
Sbjct  295  YSTFY  299


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 88/195 (45%), Gaps = 38/195 (19%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGP--KPSQMKGSRV----IDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     ++ NG FE GP   P+   G  +    ID H  +P W++ S   V+YI S    
Sbjct  147  RPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSDH--  204

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VPQG  AV L  G+++++   VR I G  Y LSF+       CA    +     
Sbjct  205  ----FSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAG  260

Query  660  PNSEPNDWGILPLQTMYSSTG---FDTYSWAFLAESNRVQIVLHN---PAREKDPS--CG  505
             ++         ++  Y S G   F   S  F+A S+R +++ ++     R  D S  CG
Sbjct  261  KDT---------IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCG  311

Query  504  PIIDSVALKLLNAPR  460
            P+ID V  KLL+A R
Sbjct  312  PVIDDV--KLLSARR  324



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   408 bits (1048),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 242/325 (74%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE GPKPSQ+KGS V +   +P W I+ GFVEYIKSG+KQ +MVLVVPQG
Sbjct  33   IHDGLLPNGNFEMGPKPSQLKGSVVKERSAVPNWDIT-GFVEYIKSGQKQDDMVLVVPQG  91

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            S AVRLG +AS++  + VI G  YS++F+  RTCAQEERLN+SV+  S     G++P+QT
Sbjct  92   SSAVRLGNEASVSQKISVIPGRLYSITFSAARTCAQEERLNISVTHES-----GVIPIQT  146

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            MY S G+D+YSWAF A   +++I  HNP  E+ P+CGP+ID+VA+K L  PR    N++K
Sbjct  147  MYGSDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIK  206

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  HF VP G RA+E
Sbjct  207  NGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFYVPEGQRAIE  266

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+ QIVRT    +Y L F+VGDA + CEG M VEAFAG   + V Y SKGKGG
Sbjct  267  LVGGKESAISQIVRTSVNNLYSLTFNVGDARDGCEGPMMVEAFAGGRKIMVDYASKGKGG  326

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F R    F A S RTR+ FLS+FYH
Sbjct  327  FKRGRLVFKAASARTRVTFLSTFYH  351



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   405 bits (1042),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 246/325 (76%), Gaps = 29/325 (9%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            I  GLV NGNFE GPKP+++KG+ V    + IP+W IS G VEYIKSG+KQG+M+LVVP+
Sbjct  4    IYTGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEIS-GLVEYIKSGQKQGDMLLVVPE  62

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G++AVRLG +ASI   ++VIKG YYS++F   RTCAQEER+N+SV+P+            
Sbjct  63   GAYAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPD------------  110

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
                            AE + V++V+HNP  E+DP+CGP+IDSVAL+ L  P+    N+L
Sbjct  111  ---------------FAEYDVVEMVIHNPGVEEDPACGPLIDSVALRTLYPPKASNKNIL  155

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNG FEEGPYI PNT++GV+IPPNIEDDHSPLPGW++ESLKAVKY+DS HF VP GTRAV
Sbjct  156  KNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSAHFSVPQGTRAV  215

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG+ESA+ Q+ RTIPGK Y L FSVGDA+NSCEGSM VEAFAG+ T++VPY SKGKG
Sbjct  216  ELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDTIKVPYTSKGKG  275

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            GF RA  +F AV TRTR+ FLS+FY
Sbjct  276  GFKRAALKFVAVGTRTRVMFLSTFY  300



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 240/305 (79%), Gaps = 6/305 (2%)
 Frame = -3

Query  918  MKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVI  739
            M G+ V D + IP W I  GFVEYI +G KQG+M+LVVP+G+ AVRLG +A I  +V V 
Sbjct  1    MNGTVVRDHYAIPGWEIG-GFVEYITAGHKQGDMLLVVPEGACAVRLGNEAYIRQSVAVA  59

Query  738  KGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESN  559
             G YY+++F+  RTCAQEER+N++V P ++     + P+QT+YSS+G+D+YSWAF A S 
Sbjct  60   TGMYYAITFSAARTCAQEERINITVPPETD-----VFPVQTLYSSSGWDSYSWAFKATSA  114

Query  558  RVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVL  379
               I +HNP  E+D +CGP+IDSVA+K L  PR    N+LKNG+FEEGPYI PN +WGVL
Sbjct  115  VAHIFIHNPGVEEDAACGPLIDSVAIKALYPPRATNKNLLKNGNFEEGPYIFPNASWGVL  174

Query  378  IPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGK  199
            +PPNIED++SPLPGW++ESLKAVKYIDSNHF VP G RAVELVAG+ESA+ Q+ RTIPGK
Sbjct  175  VPPNIEDENSPLPGWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGK  234

Query  198  VYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRF  19
            +Y L F+VGDA+N+C GSM VEAFAGR TL+VPY+SKG GGF RA  RFTAVS RTR+ F
Sbjct  235  LYALTFAVGDASNACTGSMVVEAFAGRDTLKVPYESKGTGGFKRAVLRFTAVSERTRVVF  294

Query  18   LSSFY  4
            LS+FY
Sbjct  295  LSTFY  299



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   407 bits (1047),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/336 (60%), Positives = 246/336 (73%), Gaps = 6/336 (2%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEK  829
             C   +V +   I DGL+PNGNFE GPKPSQ+KGS V + + +  W ++ GFVEYIK+G+K
Sbjct  13    CVSSNVAVSAPIRDGLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMT-GFVEYIKAGQK  71

Query  828   QGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSE  649
             Q +MVLVVP+GS AVRLG +ASI+  + V  G  YS++F+  RTCAQ+ERLN+SV+  S 
Sbjct  72    QDDMVLVVPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-  130

Query  648   PNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLN  469
                 G++P+QTMY S G+D+YSWAF A    + I +HNP RE+ P+CGP+ID+VA+K L 
Sbjct  131   ----GVIPIQTMYGSDGWDSYSWAFKAGGPEIVIRIHNPGREEQPACGPLIDAVAIKALF  186

Query  468   APRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNH  289
              PR    N++KNG+FEEGPY+     WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  H
Sbjct  187   PPRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAH  246

Query  288   FLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTL  109
             F VP G RA+ELV G+ESAV QIVRT P K Y L F+VGDA + CEG M VEAFAGR   
Sbjct  247   FFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDGCEGPMAVEAFAGRGKT  306

Query  108   QVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              V Y SKGKGGF R    F AVS RTR+ FLS+FYH
Sbjct  307   LVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYH  342



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   405 bits (1042),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 241/325 (74%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE GPK SQ+KGS + +   +P W I+ GFVEYIKSG+KQ +MVLVVPQG
Sbjct  24   IRDGLLPNGNFELGPKLSQLKGSMIKERTAVPNWDIT-GFVEYIKSGQKQDDMVLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            S AVRLG +ASI+  + VI G  YS++F+  RTCAQ+ERLN+SV+  S     G++P+QT
Sbjct  83   SSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            MY S G+D+YSWAF A   +++I  HNP  E+ P+CGP+ID+VA+K L  PR    N++K
Sbjct  138  MYGSDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSSNNLIK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  HF VP G RA+E
Sbjct  198  NGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIE  257

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LVAG+ESA+ QIVRT   K Y L F+VGDA + CEG M VEA AGR    V Y SKGKGG
Sbjct  258  LVAGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMTVEALAGRGKAMVDYASKGKGG  317

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F R    F A S RTR+ FLS+FYH
Sbjct  318  FKRGRLVFKAASARTRVTFLSTFYH  342



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 241/325 (74%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE GP+PSQ+KGS V +   +P W I+ GFVEYIKSG+KQ +MVLVVPQG
Sbjct  24   IRDGLLPNGNFELGPRPSQLKGSLVKERTAVPDWDIT-GFVEYIKSGQKQDDMVLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            S AVRLG +ASI+  + VI G  YS++F+  RTCAQ+ERLN+SV+  S     G++P+QT
Sbjct  83   SSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            MY S G+D+YSWAF A   +++I  HNP  E+ P+CGP+ID+VA+K L  PR    N++K
Sbjct  138  MYGSDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  HF VP G RA+E
Sbjct  198  NGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIE  257

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+ QIVRT   K Y L F+VGDA + CEG M VEA AGR    V Y SKGKGG
Sbjct  258  LVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTMVDYASKGKGG  317

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F R    F A S RTR+ FLS+FYH
Sbjct  318  FKRGRLVFKAASARTRVTFLSTFYH  342



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   404 bits (1039),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 241/325 (74%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE GP+PSQ+KGS V +   +P W I+ GFVEYIKSG+KQ +MVLVVPQG
Sbjct  24   IRDGLLPNGNFELGPRPSQLKGSLVKERTAVPNWDIT-GFVEYIKSGQKQDDMVLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            S AVRLG +ASI+  + VI G  YS++F+  RTCAQ+ERLN+SV+  S     G++P+QT
Sbjct  83   SSAVRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            MY S G+D+YSWAF A   +++I  HNP  E+ P+CGP+ID+VA+K L  PR    N++K
Sbjct  138  MYGSDGWDSYSWAFKAGGPKIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRFSGNNLIK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  HF VP G RA+E
Sbjct  198  NGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKAHFAVPEGHRAIE  257

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+ QIVRT   K Y L F+VGDA + CEG M VEA AGR    V Y SKGKGG
Sbjct  258  LVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGKTMVDYASKGKGG  317

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F R    F A S RTR+ FLS+FYH
Sbjct  318  FKRGRLVFKAASARTRVTFLSTFYH  342



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/332 (60%), Positives = 245/332 (74%), Gaps = 6/332 (2%)
 Frame = -3

Query  996  HVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEM  817
            +V L   + DGL+PNGNFE GPKPSQMKGS V +   +P W I  GFVE+IKSG+KQ +M
Sbjct  18   NVVLSAPVRDGLLPNGNFELGPKPSQMKGSVVKERTAVPNWNII-GFVEFIKSGQKQDDM  76

Query  816  VLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDW  637
            VLVVPQGS AVRLG +ASI+  + V+ G  YS++F+  RTCAQ+ERLN+SV+  S     
Sbjct  77   VLVVPQGSSAVRLGNEASISQKISVLPGRLYSITFSAARTCAQDERLNISVTHES-----  131

Query  636  GILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRR  457
            G++P+QTMY S G+D+YSWAF A    ++I  HNP  E+ P+CGP+ID+VA+K L  PR 
Sbjct  132  GVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRFHNPGVEEHPACGPLIDAVAIKALFPPRF  191

Query  456  LRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVP  277
               N++KNG+FEEGPY+ P   WGVLIPP IEDD+SPLPGW+IESLKAVKY+D  HF VP
Sbjct  192  SGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHFAVP  251

Query  276  SGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPY  97
             G RA+ELV G+ESA+ QIVRT   K Y L F+VGDA + CEG M VEAFAG+  + V Y
Sbjct  252  EGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARDGCEGPMIVEAFAGQGKVMVDY  311

Query  96   QSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SKGKGGF R    F AVS RTR+ FLS+FYH
Sbjct  312  ASKGKGGFRRGRLVFKAVSARTRVTFLSTFYH  343



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 247/337 (73%), Gaps = 7/337 (2%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDG-LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGE  832
             C   +V +   I DG L+PNGNFE GPKPSQ+KGS V + + +  W ++ GFVEYIK+G+
Sbjct  13    CVSSNVAVSAPIRDGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMT-GFVEYIKAGQ  71

Query  831   KQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
             KQ +MVLVVP+GS AVRLG +ASI+  + V  G  YS++F+  RTCAQ+ERLN+SV+  S
Sbjct  72    KQDDMVLVVPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES  131

Query  651   EPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLL  472
                  G++P+QTMY S G+D+YSWAF A    + I +HNP RE+ P+CGP+ID+VA+K L
Sbjct  132   -----GVIPIQTMYGSDGWDSYSWAFKAGGPEIVIRIHNPGREEHPACGPLIDAVAIKAL  186

Query  471   NAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSN  292
               PR    N++KNG+FEEGPY+     WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  
Sbjct  187   FPPRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  246

Query  291   HFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLT  112
             HF VP G RA+ELV G+ESAV QIVRT P K Y L F+VGDA ++CEG M VEAFAGR  
Sbjct  247   HFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGK  306

Query  111   LQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
               V Y SKGKGGF R    F AVS RTR+ FLS+FYH
Sbjct  307   TLVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYH  343



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   402 bits (1033),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 248/337 (74%), Gaps = 7/337 (2%)
 Frame = -3

Query  1008  CTIFHVGLCRLITDG-LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGE  832
             C   +V +   I DG L+PNGNFE GPKPSQ+KGS V + + +  W ++ GFVEYIK+G+
Sbjct  13    CVSSNVAVSAPIRDGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMT-GFVEYIKAGQ  71

Query  831   KQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNS  652
             KQ +MVLVVP+GS AVRLG +ASI+  + V  G  YS++F+  RTCAQ+ERLN+SV+  S
Sbjct  72    KQDDMVLVVPEGSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES  131

Query  651   EPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLL  472
                  G++P+QTMY S G+D+YSWAF A   ++ I +HNP  E+ P+CGP+ID+VA+K L
Sbjct  132   -----GVIPIQTMYGSDGWDSYSWAFKAGGPQIVIRIHNPGHEEHPACGPLIDAVAIKAL  186

Query  471   NAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSN  292
               PR    N++KNG+FEEGPY+ P   WGVLIPP IEDD+SPLPGWIIESLKAVKY+D  
Sbjct  187   FPPRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  246

Query  291   HFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLT  112
             HF VP G RA+ELV G+ESAV QIVRT P K Y L F+VGDA ++CEG M VEAFAGR  
Sbjct  247   HFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGN  306

Query  111   LQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
               V Y SKGKGGF +    F AVS RTR+ FLS+FYH
Sbjct  307   TLVDYMSKGKGGFKQGRLVFKAVSARTRVTFLSTFYH  343



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 249/343 (73%), Gaps = 24/343 (7%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             LVLF C  FHV      T G    G    G             PH IP W IS GF+EYI
Sbjct  8     LVLFCC--FHVAFS--FTHGHERQGTVVTG------------GPHSIPGWEIS-GFIEYI  50

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQ +M+LVVP G++AVRLG +ASI   ++V+KG YYS++F   RTCAQEE+LNVS 
Sbjct  51    KSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSA  110

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
             +P     DW +LP+QT+Y   G+D Y+W+F A+   V +V HNP +E+DP+CGPIIDS+A
Sbjct  111   AP-----DWVVLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPGKEEDPACGPIIDSIA  165

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIED--DHSPLPGWIIESLKAV  310
             ++ L  PR    N+LKNG FEEGPY+ PNT+ GVLIPPNI D  +HSPLPGW++ESLKAV
Sbjct  166   IQPLYPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAV  225

Query  309   KYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEA  130
             +YIDS+HF VP G RAVEL+ G+ESA+ Q+ RTIPGK Y L F+VGDA NSCEGS+ VEA
Sbjct  226   RYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEA  285

Query  129   FAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             + G+ +++VPY+SKGKGGF RA  +F AVSTRTRI FLS+FY+
Sbjct  286   YVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYN  328


 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 81/195 (42%), Gaps = 32/195 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPKPSQMKGSRVIDPHGI---------PKWVISS-GFVEYIKSGE  832
            RL    ++ NG FE GP       S V+ P  I         P W++ S   V YI S  
Sbjct  173  RLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYIDSDH  232

Query  831  KQGEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFV---RTCAQEERLNVS  667
                    VP+G  AV L  G++++I    R I G  Y+L F       +C  E  L+V 
Sbjct  233  ------FSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSC--EGSLSVE  284

Query  666  VSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGP  502
                 E      +P ++     GF   +  F+A S R +I+  +     R  D +  CGP
Sbjct  285  AYVGKESVK---VPYESK-GKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGP  340

Query  501  IIDSVALKLLNAPRR  457
            +ID V L  L  P R
Sbjct  341  VIDDVTLISLRKPHR  355



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/350 (57%), Positives = 249/350 (71%), Gaps = 6/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M    +   LV  L    +V +   I DGL+PNGNFE GPKPSQ+KGS V +   +P W 
Sbjct  1     MYHYQEAALLVALLFVSSNVVVSAPIRDGLLPNGNFELGPKPSQLKGSVVKERTAVPNWD  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             I+ GFVEYIKSG+KQ +MVLVVPQGS AVRLG +ASI+  + V+ G  YS++F+  RTCA
Sbjct  61    IT-GFVEYIKSGQKQDDMVLVVPQGSSAVRLGNEASISQKISVLPGRLYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+E+LN+SV+  S     G++P+QTMY S G+D+Y+WAF A    + I  HNP  E+ P+
Sbjct  120   QDEKLNISVTHES-----GVIPIQTMYGSDGWDSYAWAFKAGGPEIHIRFHNPGVEEHPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID+VA+K L  PR    N++KNG+FEEGPY+ P    GVLIPP IEDD+SPLPGW+
Sbjct  175   CGPLIDAVAIKALFPPRFSGYNLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVKY+D  HF VP G RA+ELV G+ESA+ QIVRT   K Y L FSVGDA + CE
Sbjct  235   IESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDGCE  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             G M VEAFAG+  + V Y SKGKGGF R    F AVS RTR+ FLS+FYH
Sbjct  295   GPMTVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYH  344



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   399 bits (1026),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 253/347 (73%), Gaps = 8/347 (2%)
 Frame = -3

Query  1038  TKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSG  859
               L  L++ LC          ITDGL+ NGNFERGP PSQ++G+RV+    IP W  +SG
Sbjct  6     ASLLLLMVVLCATSSGTALAAITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWR-TSG  64

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYS-LSFTFVRTCAQEE  682
             FVEYI SG KQG+MVLVVP+GSHAVRLG +ASI   +     G    L+F+  RTCAQ E
Sbjct  65    FVEYIPSGRKQGDMVLVVPEGSHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAE  124

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLNVS S       W +LP+QTMYSS G+D+Y+WA+ A ++   +V+HNP   +DP+CGP
Sbjct  125   RLNVSAS-----GQWAVLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGP  179

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA++ LN PRR   N++KNGDFEEGPYI+P T WGVLIP  + D+HSPLPGW++ES
Sbjct  180   LIDSVAIRTLNPPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVES  239

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS+HF VP G RAVEL+AGRESA+ Q++RT+PG+ Y L F+VGDA+N CEGS+
Sbjct  240   LKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSL  299

Query  141   GVEAFAGRLTLQVPYQSKGKGGFI-RANHRFTAVSTRTRIRFLSSFY  4
              VEA+AGR + +V ++S G+GG   RA   F A + RTR+ F SSFY
Sbjct  300   VVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFY  346



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 253/347 (73%), Gaps = 8/347 (2%)
 Frame = -3

Query  1038  TKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSG  859
               L  L++ LC          ITDGL+ NGNFERGP PSQ++G+RV+    IP W  +SG
Sbjct  6     ASLLLLMVVLCAAASGTALAAITDGLLANGNFERGPAPSQLRGTRVVGASAIPSWR-TSG  64

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYS-LSFTFVRTCAQEE  682
             FVEYI SG KQG+MVLVVP+GSHAVRLG +ASI   +     G    L+F+  RTCAQ E
Sbjct  65    FVEYIPSGRKQGDMVLVVPEGSHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAE  124

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGP  502
             RLNVS S       W +LP+QTMYSS G+D+Y+WA+ A ++   +V+HNP   +DP+CGP
Sbjct  125   RLNVSAS-----GQWAVLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGP  179

Query  501   IIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES  322
             +IDSVA++ LN PRR   N++KNGDFEEGPYI+P T WGVLIP  + D+HSPLPGW++ES
Sbjct  180   LIDSVAIRTLNPPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVES  239

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
             LKAVKYIDS+HF VP G RAVEL+AGRESA+ Q++RT+PG+ Y L F+VGDA+N CEGS+
Sbjct  240   LKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSL  299

Query  141   GVEAFAGRLTLQVPYQSKGKGGFI-RANHRFTAVSTRTRIRFLSSFY  4
              VEA+AGR + +V ++S G+GG   RA   F A + RTR+ F SSFY
Sbjct  300   VVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFY  346



>ref|XP_008672703.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84649.1| unknown [Zea mays]
 gb|ACF87605.1| unknown [Zea mays]
 gb|ACF87824.1| unknown [Zea mays]
 tpg|DAA58942.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=381

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 198/331 (60%), Positives = 251/331 (76%), Gaps = 13/331 (4%)
 Frame = -3

Query  972  TDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP K + + G+ V   H IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER--LNVSVSPNSEPNDWGILPL  622
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ ER  LNVSVSP     +WG+LP+
Sbjct  83   AHAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP-----EWGVLPM  137

Query  621  QTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAP---RRLR  451
            QT+Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   RR  
Sbjct  138  QTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALARRAG  197

Query  450  GN-MLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPS  274
            GN +LKNG FEEGPY LP  +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP 
Sbjct  198  GNNLLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFAVPQ  257

Query  273  GTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQ  94
            G RAVELV GRESA+VQ VRT+PG  Y L F+VGD+ + C GSM  EA+A R T++VPYQ
Sbjct  258  GARAVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVKVPYQ  317

Query  93   SKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            S+G GG+ RA   FTA++ RTR+ F S+FYH
Sbjct  318  SRGTGGYKRAVLDFTAIANRTRVVFQSTFYH  348



>gb|ACG40327.1| hypothetical protein [Zea mays]
Length=381

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 198/331 (60%), Positives = 251/331 (76%), Gaps = 13/331 (4%)
 Frame = -3

Query  972  TDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP K + + G+ V   H IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER--LNVSVSPNSEPNDWGILPL  622
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ ER  LNVSVSP     +WG+LP+
Sbjct  83   AHAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERXRLNVSVSP-----EWGVLPM  137

Query  621  QTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAP---RRLR  451
            QT+Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   RR  
Sbjct  138  QTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALARRAG  197

Query  450  GN-MLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPS  274
            GN +LKNG FEEGPY LP  +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP 
Sbjct  198  GNNLLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHFAVPQ  257

Query  273  GTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQ  94
            G RAVELV GRESA+VQ VRT+PG  Y L F+VGD+ + C GSM  EA+A R T++VPYQ
Sbjct  258  GARAVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVKVPYQ  317

Query  93   SKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            S+G GG+ RA   FTA++ RTR+ F S+FYH
Sbjct  318  SRGTGGYKRAVLDFTAIANRTRVVFQSTFYH  348



>emb|CAH67378.1| OSIGBa0159F11.2 [Oryza sativa Indica Group]
 emb|CAH67294.1| OSIGBa0103O01.12 [Oryza sativa Indica Group]
 gb|EAY94678.1| hypothetical protein OsI_16457 [Oryza sativa Indica Group]
Length=372

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 251/351 (72%), Gaps = 7/351 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M    +    +LFL           +TDGL+PNGNFE GP  SQ+ G+ V   + IP W 
Sbjct  1     MTGSARSVVALLFLLVGSAARADSTVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAIPNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI+SG ++ +M+L VP+G+ AVRLG DA+I   + V +  YYS++F+  RTCA
Sbjct  61    IS-GFVEYIESGHREQDMILAVPEGARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+E+LNVSV+P     ++G+LP+QT+Y+S+G+D+YSWAF A+ + V + +HNP  E+DP+
Sbjct  120   QKEKLNVSVTP-----EFGVLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPGEEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A+K L  PRR +GNML+NGD EEGPYI P+ TWGVL+PP  ED+HSPLPGW+
Sbjct  175   CGPLIDSIAIKNLYPPRRTKGNMLRNGDLEEGPYIFPDATWGVLVPPIFEDEHSPLPGWM  234

Query  330   IES-LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I S  K +KY+DS H  VP G RAVELVAGRE+A+VQ V T+PG+ Y L FSVGDA N C
Sbjct  235   IMSDTKVIKYVDSPHHRVPQGARAVELVAGRETALVQEVATVPGRSYRLSFSVGDAGNGC  294

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             + S+ VEA+A R T +VPY+S+G GG  RA   F AV+  TR+ F S  YH
Sbjct  295   KDSLAVEAYAARATAKVPYESQGTGGHKRAQLEFAAVANLTRVVFQSFNYH  345



>ref|XP_010691193.1| PREDICTED: uncharacterized protein LOC104904598 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   393 bits (1009),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 250/347 (72%), Gaps = 7/347 (2%)
 Frame = -3

Query  1041  MTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISS  862
             M KLT  V+ L       LC +    L+PNG+FE  P  +Q+ G++V   + IP+W  SS
Sbjct  1     MLKLTGFVVLL---LASNLC-VSLGALLPNGDFELSPSSTQLSGTKVEGKYSIPQWE-SS  55

Query  861   GFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEE  682
             GFVEYI SG KQ +MVLVVPQG HAVRLG +ASI   V    G +Y+L+F+F RTC+QEE
Sbjct  56    GFVEYITSGTKQQDMVLVVPQGKHAVRLGTNASIRQKVAAQSGKFYALTFSFARTCSQEE  115

Query  681   RLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPARE-KDPSCG  505
              LNV+++P+S+ +  GILPLQT+YSS GFD+Y+W F AE+N ++I LHNP +  +D +CG
Sbjct  116   VLNVTITPSSKGHS-GILPLQTVYSSVGFDSYAWGFRAEANVIEISLHNPGQPGEDHACG  174

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P+ID++AL +L++ +   GN++KNGDF EGPY+  +++WGVL+PPN+ED HSPLP W IE
Sbjct  175   PLIDTIALTILDSVKPTGGNLVKNGDFGEGPYVFHSSSWGVLLPPNVEDSHSPLPAWRIE  234

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVKYIDS HF VP G RAVE+V G+ES + Q +RT PGK+Y L F VGDANN C G 
Sbjct  235   SLKAVKYIDSLHFFVPEGQRAVEIVGGKESVIAQTIRTQPGKLYALTFIVGDANNGCVGP  294

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + +EA+A + T++V Y SKGKGGF R    F A    T IRFLSS Y
Sbjct  295   LAIEAYAAKATIRVTYNSKGKGGFTRGKLVFRAEKRTTSIRFLSSLY  341



>ref|NP_001145978.1| hypothetical protein [Zea mays]
 gb|ACL52972.1| unknown [Zea mays]
 tpg|DAA58943.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=428

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 197/335 (59%), Positives = 250/335 (75%), Gaps = 13/335 (4%)
 Frame = -3

Query  984  CRLITDGLVPNGNFERGP-KPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLV  808
            C     GL+PNGNFE GP K + + G+ V   H IP+W  +SGFVEYI+SG KQG+M+LV
Sbjct  67   CNANGAGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWE-TSGFVEYIESGHKQGDMLLV  125

Query  807  VPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER--LNVSVSPNSEPNDWG  634
            VPQG+HAVRLG +ASI   + V +G YY+++F+  RTCAQ ER  LNVSVSP     +WG
Sbjct  126  VPQGAHAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP-----EWG  180

Query  633  ILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAP---  463
            +LP+QT+Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P   
Sbjct  181  VLPMQTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGVEEDPACGPLIDGVAIRALYPPALA  240

Query  462  RRLRGN-MLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHF  286
            RR  GN +LKNG FEEGPY LP  +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF
Sbjct  241  RRAGGNNLLKNGGFEEGPYFLPGASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAAHF  300

Query  285  LVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQ  106
             VP G RAVELV GRESA+VQ VRT+PG  Y L F+VGD+ + C GSM  EA+A R T++
Sbjct  301  AVPQGARAVELVGGRESALVQEVRTVPGWTYRLAFAVGDSGDGCAGSMAAEAYAARATVK  360

Query  105  VPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            VPYQS+G GG+ RA   FTA++ RTR+ F S+FYH
Sbjct  361  VPYQSRGTGGYKRAVLDFTAIANRTRVVFQSTFYH  395



>emb|CAE01677.2| OSJNBb0091E11.19 [Oryza sativa Japonica Group]
Length=372

 Score =   388 bits (997),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/351 (53%), Positives = 249/351 (71%), Gaps = 7/351 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M    +    +LFL           +TDGL+PNGNFE GP  SQ+ G+ V   + I  W 
Sbjct  1     MTGSARSVVALLFLLVGSAARADSAVTDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI+SG ++ +M+L VP+G+ AVRLG DA+I   + V +  YYS++F+  RTCA
Sbjct  61    IS-GFVEYIESGHREQDMILAVPEGARAVRLGNDATIRQRLSVTRRAYYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+E+LN+SV+P     ++G+LP+QT+Y+S+G+D+YSWAF A+ + V + +HNP  E+DP+
Sbjct  120   QKEKLNMSVTP-----EFGVLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPGEEEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A+K L  P R +GNML+NGD EEGPYI P+ TWGVL+PP  ED+HSPLPGW+
Sbjct  175   CGPLIDSIAIKNLYPPPRTKGNMLRNGDLEEGPYIFPDATWGVLVPPIFEDEHSPLPGWM  234

Query  330   IES-LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I S  K +KY+DS H  VP G RAVELVAGRE+A+VQ V T+PG+ Y L FSVGDA N C
Sbjct  235   IMSDTKVIKYVDSPHHRVPQGARAVELVAGRETALVQEVATVPGRSYRLSFSVGDAGNGC  294

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             + S+ VEA+A R T +VPY+S+G GG  RA   F AV+  TR+ F S  YH
Sbjct  295   KDSLAVEAYAARATAKVPYESQGTGGHKRAQLEFAAVANLTRVVFQSFNYH  345



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 248/338 (73%), Gaps = 9/338 (3%)
 Frame = -3

Query  1008  CTIFHVGLCRLITD-GLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGE  832
             C  F V   R     GL+ NGNFERGP PSQ++G+RV+    IP W  +SGFVEYI SG 
Sbjct  1     CVRFRVCNARRRRGAGLLANGNFERGPAPSQLRGTRVVGASAIPSWR-TSGFVEYIPSGR  59

Query  831   KQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYS-LSFTFVRTCAQEERLNVSVSPN  655
             KQG+MVLVVP+GSHAVRLG +ASI   +     G    L+F+  RTCAQ ERLNVS S  
Sbjct  60    KQGDMVLVVPEGSHAVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSAS--  117

Query  654   SEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKL  475
                  W +LP+QTMYSS G+D+Y+WA+ A ++   +V+HNP   +DP+CGP+IDSVA++ 
Sbjct  118   ---GQWAVLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGVTEDPACGPLIDSVAIRT  174

Query  474   LNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDS  295
             LN PRR   N++KNGDFEEGPYI+P T WGVLIP  + D+HSPLPGW++ESLKAVKYIDS
Sbjct  175   LNPPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDS  234

Query  294   NHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRL  115
             +HF VP G RAVEL+AGRESA+ Q++RT+PG+ Y L F+VGDA+N CEGS+ VEA+AGR 
Sbjct  235   DHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGRE  294

Query  114   TLQVPYQSKGKGGFI-RANHRFTAVSTRTRIRFLSSFY  4
             + +V ++S G+GG   RA   F A + RTR+ F SSFY
Sbjct  295   STRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFY  332



>ref|XP_006652463.1| PREDICTED: uncharacterized protein LOC102714172 [Oryza brachyantha]
Length=378

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 240/323 (74%), Gaps = 5/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DGL+ NGNFE  P  SQM G+RV+  + IP W ++ GFVEYI SG+KQG+M+L VP+G+H
Sbjct  26   DGLLQNGNFEYSPNKSQMNGTRVMGEYAIPYWKVT-GFVEYIASGQKQGDMLLTVPEGAH  84

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI   + V +G YYS++F+  RTCAQ E+LNVSV+P  E    G LP+QT+Y
Sbjct  85   AVRLGNEASIQQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPES---GELPIQTVY  141

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            +S+G+D+Y+WAF A+   V +++HN   + DP+CGP+IDSVA+K L  P+  + NMLKNG
Sbjct  142  TSSGWDSYAWAFKAKRGLVSLIIHNHGEDDDPACGPLIDSVAIKTLYPPQATQNNMLKNG  201

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESL-KAVKYIDSNHFLVPSGTRAVEL  253
            DFEEGPY+ PN  WGVL+PPN ED+HSPLPGW++ S  KAVKY+DS HF VP G RAVEL
Sbjct  202  DFEEGPYVFPNARWGVLLPPNTEDEHSPLPGWMVLSYTKAVKYVDSAHFAVPHGARAVEL  261

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            V+G E+A++Q V T+PG+ Y L FSVGDA +SC GS+ V A+AG     VPY S+G GG 
Sbjct  262  VSGLETALMQEVPTVPGRSYRLEFSVGDAGDSCVGSLQVRAYAGEGCTTVPYNSQGTGGH  321

Query  72   IRANHRFTAVSTRTRIRFLSSFY  4
             RA+  F AV+  TR+ F+SS Y
Sbjct  322  TRASLEFAAVADVTRVVFVSSSY  344



>ref|XP_004976082.1| PREDICTED: uncharacterized protein LOC101765204 [Setaria italica]
Length=375

 Score =   387 bits (995),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 248/351 (71%), Gaps = 9/351 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M + T+  + VLFL           +TDG++PNG+FE+GP  SQM G+RV+DP  IP W 
Sbjct  1     MARSTR--SAVLFLVLGVAARAVFAVTDGILPNGHFEQGPDKSQMNGTRVMDPDAIPYWK  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             I  GFVEYI SG++Q +M+L VP+G  AVRLG DA+I   + V +  YYS++F   RTCA
Sbjct  59    IY-GFVEYIGSGQQQDDMILPVPEGEQAVRLGNDATIRQQLDVTRHTYYSITFGAARTCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E+LNVSV+P S     G+LP+QT+Y+S+G+D+YSWAF A+ + V + +HNP  E DP+
Sbjct  118   QAEKLNVSVTPES-----GVLPIQTVYTSSGWDSYSWAFKAKHSTVWLSIHNPGHEDDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+ID++A+K +  P  ++ NML+NGDFE+GPYI PNT WGVL+PP +EDDHSPLPGW+
Sbjct  173   CGPLIDAIAIKAIRRPHHVKNNMLRNGDFEDGPYIFPNTPWGVLVPPIMEDDHSPLPGWM  232

Query  330   IES-LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I S  K VKY+D+ H  VP G+ AVELVAGRE A+VQ VRT+PG+ Y L FSVGDA N C
Sbjct  233   IMSDTKVVKYVDAAHHKVPHGSYAVELVAGRECALVQEVRTVPGRPYRLSFSVGDAANGC  292

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              G + V A+A R TL VPY+S G GG  RA   F A    TR+ F S+ ++
Sbjct  293   GGYLAVVAYASRATLNVPYESHGAGGSKRAELEFVADHNLTRVVFQSANHY  343



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 244/325 (75%), Gaps = 6/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE+GPKPSQ+KGS V +   +P W ++ G VEYIK+G+KQ +MVLVVP+G
Sbjct  27   IRDGLLPNGNFEKGPKPSQLKGSVVKERSAVPNWDMT-GLVEYIKAGQKQDDMVLVVPEG  85

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            S AVRLG +ASI+  + V  G  YS++F+  RTCAQ+ERLN+SV+  S     G++P+QT
Sbjct  86   SSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQT  140

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+YSWAF A    ++I +HNP  E+ P+CGP+ID+VA+K L  PR  R N++K
Sbjct  141  LYGSDGWDSYSWAFKAGGPEIEIRIHNPGHEEHPACGPLIDAVAIKALFPPRFSRYNLIK  200

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            NG FEEGPY+ P   WGVLIPP IED++SPLPGW+IESLKAVKY+D  HF VP G RA+E
Sbjct  201  NGKFEEGPYVFPKAKWGVLIPPFIEDENSPLPGWMIESLKAVKYVDKAHFFVPEGHRAIE  260

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+ QIVRT   K Y L F+VGDA ++CEG M VEAFAGR  + V Y SKG+GG
Sbjct  261  LVGGKESALSQIVRTSLNKFYALTFNVGDARDACEGPMAVEAFAGRSKVMVEYASKGRGG  320

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            F R    F AVS RTR+ F+S+FYH
Sbjct  321  FRRGRLVFKAVSPRTRVTFISTFYH  345



>emb|CAE01676.2| OSJNBb0091E11.17 [Oryza sativa Japonica Group]
 gb|EAZ31210.1| hypothetical protein OsJ_15310 [Oryza sativa Japonica Group]
Length=373

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 251/350 (72%), Gaps = 7/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M + T   AL+L +   F       ITDGL+PNGNFE  P  SQM G+RV   + IP+W 
Sbjct  1     MIQTTPCVALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI SG+KQG+M+L VP+G++AVRLG +ASI   + + +G +YS++F+  RTCA
Sbjct  61    IS-GFVEYIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E LN++++P S     G +P+QT+Y+S+G+D+YSWAF A+ + V  ++HNP    D +
Sbjct  120   QSELLNITITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-  334
             CGP+IDS A+K LN P+R +GNMLKNG FEEGPYI PNT+WGVL+PP  EDD+SPL  W 
Sbjct  175   CGPLIDSFAIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWT  234

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I+ + K+VKYID+ H+ VP G RAVELV+G E+A++Q V T+PG+ Y L FSVGDA + C
Sbjct  235   ILSTTKSVKYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGC  294

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              GS+ V+A+A R +++V YQS+G GG+ R    FTA   RTR+ F+S  Y
Sbjct  295   SGSLTVQAYASRGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAY  344



>ref|NP_001053189.1| Os04g0494800 [Oryza sativa Japonica Group]
 dbj|BAF15103.1| Os04g0494800 [Oryza sativa Japonica Group]
Length=379

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 251/350 (72%), Gaps = 7/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M + T   AL+L +   F       ITDGL+PNGNFE  P  SQM G+RV   + IP+W 
Sbjct  7     MIQTTPCVALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWE  66

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI SG+KQG+M+L VP+G++AVRLG +ASI   + + +G +YS++F+  RTCA
Sbjct  67    IS-GFVEYIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCA  125

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E LN++++P S     G +P+QT+Y+S+G+D+YSWAF A+ + V  ++HNP    D +
Sbjct  126   QSELLNITITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEA  180

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-  334
             CGP+IDS A+K LN P+R +GNMLKNG FEEGPYI PNT+WGVL+PP  EDD+SPL  W 
Sbjct  181   CGPLIDSFAIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWT  240

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I+ + K+VKYID+ H+ VP G RAVELV+G E+A++Q V T+PG+ Y L FSVGDA + C
Sbjct  241   ILSTTKSVKYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGC  300

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              GS+ V+A+A R +++V YQS+G GG+ R    FTA   RTR+ F+S  Y
Sbjct  301   SGSLTVQAYASRGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAY  350



>gb|EAY94676.1| hypothetical protein OsI_16455 [Oryza sativa Indica Group]
Length=379

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 251/350 (72%), Gaps = 7/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M + T   AL+L +   F       ITDGL+PNGNFE  P  SQM G+RV   + IP+W 
Sbjct  7     MIQTTPCVALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWE  66

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI SG+KQG+M+L VP+G++AVRLG +ASI   + + +G +YS++F+  RTCA
Sbjct  67    IS-GFVEYIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCA  125

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E LN++++P S     G +P+QT+Y+S+G+D+YSWAF A+ + V  ++HNP    D +
Sbjct  126   QSELLNITITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEA  180

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-  334
             CGP+IDS A+K LN P+R +GNMLKNG FEEGPYI PNT+WGVL+PP  EDD+SPL  W 
Sbjct  181   CGPLIDSFAIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWT  240

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I+ + K+VKYID+ H+ VP G RAVELV+G E+A++Q V T+PG+ Y L FSVGDA + C
Sbjct  241   ILSTTKSVKYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGC  300

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              GS+ V+A+A R +++V YQS+G GG+ R    FTA   RTR+ F+S  Y
Sbjct  301   SGSLTVQAYASRGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAY  350



>ref|NP_001053188.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAD41544.2| OSJNBb0091E11.14 [Oryza sativa Japonica Group]
 dbj|BAF15102.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAH67289.1| OSIGBa0103O01.7 [Oryza sativa Indica Group]
 gb|EAY94693.1| hypothetical protein OsI_16470 [Oryza sativa Indica Group]
 gb|EAZ31209.1| hypothetical protein OsJ_15309 [Oryza sativa Japonica Group]
 dbj|BAG99074.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   384 bits (987),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 247/344 (72%), Gaps = 10/344 (3%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             + AL+L + T       R   DGL+ NGNFE  P  SQM G+RV+  + IP W I+ GFV
Sbjct  9     VVALLLLVSTA-----ARAAGDGLLLNGNFEYQPSKSQMNGTRVMAEYAIPYWKIT-GFV  62

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EYI SG+KQG+M+L VP+G+HAVRLG +ASI   + V +G YYS++F+  RTCAQ E+LN
Sbjct  63    EYISSGQKQGDMLLTVPEGAHAVRLGNEASIEQQISVTRGMYYSITFSAARTCAQSEKLN  122

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             VSV+P  E    G LP+QT+Y+S+G+D+Y+WAF A+   V +++HN   + DP+CGP+ID
Sbjct  123   VSVAPGPES---GELPIQTVYTSSGWDSYAWAFKAKRGLVSLIIHNHGEDDDPACGPLID  179

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LK  316
             SVA+K L  P+  + NML+NGDFEEGPY+ PN  WGV++PP  EDDHSPLPGW++ S  K
Sbjct  180   SVAIKTLYPPQATQNNMLRNGDFEEGPYMFPNAAWGVMVPPISEDDHSPLPGWMVMSDTK  239

Query  315   AVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGV  136
             AVK +DS HF VP G RAVELV+G E+A++Q VRT+PG+ Y L FSVGDA++ C GSM V
Sbjct  240   AVKCVDSAHFTVPHGARAVELVSGLETALMQEVRTVPGRSYRLEFSVGDASDGCVGSMQV  299

Query  135   EAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             + +AG+    V Y S+G GG  RA+  F AV+  TR+ F+SS Y
Sbjct  300   KGYAGQGCTTVTYSSQGTGGHTRASLEFAAVANTTRVVFVSSTY  343



>emb|CAH67292.1| OSIGBa0103O01.10 [Oryza sativa Indica Group]
Length=373

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 250/350 (71%), Gaps = 7/350 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M + T   AL+L +   F       ITDGL+PNGNFE  P  SQM G+RV   + IP+W 
Sbjct  1     MIQTTPCVALLLLVGVAFAARSASAITDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             IS GFVEYI SG+KQG+M+L VP+G++AVRLG +ASI   + + +G +YS++F+  RTCA
Sbjct  61    IS-GFVEYIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLTLTRGMHYSITFSAARTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E LN++++P S     G +P+QT+Y+S+G+D+YSWAF A+ + V  ++HNP    D +
Sbjct  120   QSELLNITITPES-----GEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGVSDDEA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-  334
             CGP+IDS A+K LN P+R +GNMLKNG FEEGPYI PNT+WGVL+PP  EDD+SPL  W 
Sbjct  175   CGPLIDSFAIKTLNPPQRTKGNMLKNGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWT  234

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I+ + K+VKYID+ H+ VP G RAVELV+G E+A++Q V T+PG+ Y L FSVGDA + C
Sbjct  235   ILSTTKSVKYIDAAHYAVPGGARAVELVSGMETAMLQEVSTVPGRSYRLEFSVGDAGDGC  294

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              GS+ V+A+A   +++V YQS+G GG+ R    FTA   RTR+ F+S  Y
Sbjct  295   SGSLTVQAYASCGSVKVTYQSQGTGGYKRGLLEFTATEKRTRVVFVSMAY  344



>ref|XP_004978106.1| PREDICTED: uncharacterized protein LOC101761311 [Setaria italica]
Length=381

 Score =   381 bits (979),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 251/355 (71%), Gaps = 8/355 (2%)
 Frame = -3

Query  1065  LDPEYMKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHG  886
             ++ E + +  +  AL L  C +        I DGL+PNGNFE  P  SQ+ G+RV+  + 
Sbjct  3     MEREMVVQHARRAALFLLTCVV-SARAAAAIPDGLLPNGNFEEAPATSQLNGTRVMGRYA  61

Query  885   IPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTF  706
             IP W IS GFVEYI   +KQG+M+L VP+G++AVRLG +ASI   + V +  YYS++F+ 
Sbjct  62    IPHWEIS-GFVEYIGPAQKQGDMILPVPEGAYAVRLGNEASIRQLLNVTRKAYYSITFSA  120

Query  705   VRTCAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAR  526
              RTCAQ ERLNV+V+P S+     +LP+QT+Y++ G+D+YSWAF A  + V +++HNP  
Sbjct  121   ARTCAQAERLNVTVAPESD-----VLPIQTVYTANGWDSYSWAFKARRSAVTLIVHNPGV  175

Query  525   EKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSP  346
              +D +CGP++DS A+K L  P+R + NMLKNGDFEEGPYI P+T WGVL+PP  EDD+SP
Sbjct  176   TEDAACGPLLDSFAIKTLQVPQRTKNNMLKNGDFEEGPYIFPDTPWGVLVPPLDEDDYSP  235

Query  345   LPGW-IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGD  169
             L  W ++ S K+VKY+D+ H+ VP G  AVELV+G E+A+VQ VRT+PG+ Y L FS GD
Sbjct  236   LSPWMVLSSTKSVKYLDAAHYAVPRGAHAVELVSGLETALVQDVRTVPGRPYRLEFSAGD  295

Query  168   ANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             A N C GS+ V+A+A R +++V YQS+GKGG+ R    FTA++ +TR+ F+S  Y
Sbjct  296   AGNGCVGSLAVQAYAARGSVKVAYQSQGKGGYERGALEFTAIANQTRVVFVSMAY  350



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   378 bits (971),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 169/265 (64%), Positives = 220/265 (83%), Gaps = 0/265 (0%)
 Frame = -3

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G +AVRLG++ASI   V++ +G +Y+++F   RTCAQEE+LNVSV P +E  DWGI+P+Q
Sbjct  1    GDYAVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDWGIIPIQ  60

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            TMY S G+++++  F A+    +IV+HNP +E+DP+CGP+IDSVALK+L+ P+R R N+L
Sbjct  61   TMYGSNGWESFTCGFRADFPEAEIVIHNPGKEEDPACGPLIDSVALKVLDPPKRTRANLL  120

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNG+FEEGPY+ PN++WG LIPP+IED HSPLPGWI+ESLKAVKYIDS+HF VP G RA+
Sbjct  121  KNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDHFAVPEGKRAI  180

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG+ESA+ Q+V T  G+VY+L F+VGDANN+CEGSM VEAFAG  T+Q+PYQSKGKG
Sbjct  181  ELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETVQIPYQSKGKG  240

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            G +R   RF AV+TRTR+RFLS+FY
Sbjct  241  GSVRGKLRFKAVATRTRLRFLSTFY  265



>gb|EMT04285.1| hypothetical protein F775_14657 [Aegilops tauschii]
Length=375

 Score =   379 bits (974),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/326 (56%), Positives = 237/326 (73%), Gaps = 7/326 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            +TDGL+PNGNF+ GP  SQ+ G+ V+  H IP W IS GFVEYI+SG +QG MV+ VP+G
Sbjct  26   VTDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEIS-GFVEYIQSGHQQGGMVVAVPEG  84

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            + AVRLG DASI   +RV +  YYS++F+  RTCAQ E+LNVSV+ +S     G+LP+QT
Sbjct  85   ASAVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVAADS-----GVLPVQT  139

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +YSS G+D+YSWAF A+ + V + +HNP  E+DP+CGP+ID++A+K L  P + +GNML+
Sbjct  140  VYSSGGWDSYSWAFRAKHSAVWLAIHNPGAEEDPACGPVIDAIAIKTLQPPTKSKGNMLR  199

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYIDSNHFLVPSGTRAV  259
            NGDFE+GPYI P+  WGVL+PP  ED  SPLPGW I+ S K VKY+D+  + VP G RAV
Sbjct  200  NGDFEDGPYIFPDCPWGVLVPPMDEDSCSPLPGWMIMSSTKVVKYVDAPRYRVPHGARAV  259

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAGRE+A+VQ V T+ G+ Y L F VGDA N C+ SM VEA+    +L+V YQS+G G
Sbjct  260  ELVAGREAALVQEVATVAGRSYRLQFYVGDAANGCKESMVVEAYVAAASLKVQYQSQGTG  319

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            G+ RA   F AV   TR+ F S  YH
Sbjct  320  GYRRAMLDFVAVGNLTRVVFQSLHYH  345



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/273 (65%), Positives = 219/273 (80%), Gaps = 1/273 (0%)
 Frame = -3

Query  819  MVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPND  640
            M+L+VP+G+ AVRLG +A I   V V+KG +YSL+F+  RTCAQEERLNVSVSPN+E ND
Sbjct  1    MLLIVPEGAFAVRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKND  60

Query  639  WGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPR  460
            +G+ P+QTMYSS G+D+Y+WAF A+++ ++I +HNP  E+D +CGP+IDSVALK L  P+
Sbjct  61   FGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGVEEDAACGPLIDSVALKTLYNPK  120

Query  459  RLRGNMLKNGDFEEGPYILPN-TTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFL  283
            R R N+LKNG+FEEGPYI P  T+ GV+IPP+IEDDHSPLPGWIIESLKA+KYIDS HF 
Sbjct  121  RTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEHFS  180

Query  282  VPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQV  103
            VP G RA+EL+AG+ESAV QIV+T  G+ Y L F VGDANN CEG M VEAFAG+ T++V
Sbjct  181  VPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKNTVKV  240

Query  102  PYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             Y SKGKGGF  A   F A STRTRI F S+FY
Sbjct  241  SYNSKGKGGFKAARLAFRAESTRTRIMFYSTFY  273


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (44%), Gaps = 31/180 (17%)
 Frame = -3

Query  963  LVPNGNFERGPK--PSQMKGSRVIDPH------GIPKWVISS-GFVEYIKSGEKQGEMVL  811
            L+ NGNFE GP   P       +I PH       +P W+I S   ++YI S         
Sbjct  126  LLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDSEH------F  179

Query  810  VVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDW  637
             VP+G  A+ L  G+++++   V+   G  Y LSF         +  N    P       
Sbjct  180  SVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLV------GDANNGCEGPMVVEAFA  233

Query  636  GILPLQTMYSST---GFDTYSWAFLAESNRVQIVLHNP--AREKDPS---CGPIIDSVAL  481
            G   ++  Y+S    GF     AF AES R +I+ ++   A + D S   CGP++D V L
Sbjct  234  GKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKL  293



>tpg|DAA37152.1| TPA: hypothetical protein ZEAMMB73_071426 [Zea mays]
Length=379

 Score =   376 bits (966),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 246/346 (71%), Gaps = 9/346 (3%)
 Frame = -3

Query  1038  TKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSG  859
              +  AL+L +C          I DGL+PNGNFE  P  SQ+ G+RV+  + IP W IS G
Sbjct  11    ARRAALLLIVCLAARA--ASAIQDGLLPNGNFEEAPPKSQLNGTRVMGRNAIPHWEIS-G  67

Query  858   FVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEER  679
             +VEYI SG+KQG+M+L VP+G++AVRLG +ASI   + V  G  YS++F+  RTCAQ E+
Sbjct  68    YVEYIGSGQKQGDMLLPVPEGAYAVRLGNEASIQQRLAVTPGARYSITFSAARTCAQAEQ  127

Query  678   LNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPI  499
             LNV+V+P S+     +LP+QT+Y+S+G+D+YSWAF A  + V +++HNP   +D +CGP+
Sbjct  128   LNVTVAPESD-----VLPIQTVYTSSGWDSYSWAFQAAGSVVTLIVHNPGVAEDAACGPL  182

Query  498   IDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIES  322
             ID  A+K +  PR  + NMLKNGDFE+GPYI PNT WGVL+PP  EDD+SPL  W ++ S
Sbjct  183   IDLFAIKTMPTPRSSKNNMLKNGDFEDGPYIFPNTQWGVLVPPMDEDDYSPLAPWMVLSS  242

Query  321   LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSM  142
              K+VKY+D+ H  VP G RAVELV+G E+A+VQ V T+PG++Y L FS GDA N C GSM
Sbjct  243   TKSVKYVDAPHHAVPHGARAVELVSGMETALVQNVATVPGQLYRLQFSAGDAGNGCVGSM  302

Query  141   GVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
              V+A+A R +++VPYQS+GKGG  R    F AV+ +TR+ F+S  Y
Sbjct  303   TVQAYAARGSVKVPYQSQGKGGHTRGVLDFAAVADQTRVVFVSMGY  348



>gb|EMS63052.1| hypothetical protein TRIUR3_01733 [Triticum urartu]
Length=375

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/326 (55%), Positives = 237/326 (73%), Gaps = 7/326 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            +TDGL+PNGNF+ GP  SQ+ G+ V+  H IP W IS GFVEYI+SG  Q +M++ VP+G
Sbjct  26   VTDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEIS-GFVEYIQSGHTQDDMIVAVPEG  84

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            + AVRLG DASI   +RV +  YYS++F+  RTCAQ E+LNVSV+ +S     G+LP+QT
Sbjct  85   ASAVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVAADS-----GVLPVQT  139

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +YSS G+D+YSWAF A+ + V + +HNP  E+DP+CGP+ID++A+K L  P + +GNML+
Sbjct  140  VYSSGGWDSYSWAFRAKHSAVWLAIHNPGVEEDPACGPVIDAIAIKTLQPPTKTKGNMLR  199

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYIDSNHFLVPSGTRAV  259
            NGDFE+GPYI P+  WGVL+PP  ED+ SPLPGW ++ S K VKY+D+  + VP G RAV
Sbjct  200  NGDFEDGPYIFPDCPWGVLVPPMDEDNCSPLPGWMVMSSTKVVKYVDAPRYRVPHGARAV  259

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAGRE+A+VQ V T+ G+ Y L F VGDA N C+ SM VEA+    +L+V YQS+G G
Sbjct  260  ELVAGRETALVQEVATVAGRSYRLQFYVGDAANGCKESMVVEAYVAAASLKVQYQSQGTG  319

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            G+ RA   F AV   TR+ F S  +H
Sbjct  320  GYRRAMLDFVAVGNLTRVVFQSLHHH  345



>ref|XP_003581385.1| PREDICTED: uncharacterized protein LOC100824265 [Brachypodium 
distachyon]
Length=373

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 237/326 (73%), Gaps = 7/326 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            + DGL+PNGNF+ GP  SQ+ G+ V+  H IP W +S GFVEYI SG+KQGEM+L VP+G
Sbjct  24   VPDGLLPNGNFKDGPGKSQLNGTIVMGSHSIPFWEVS-GFVEYIGSGQKQGEMILPVPEG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            + AVRLG DASI   + V +  +YS++F+  RTCAQ E+LNVSV+     +D G+LP+QT
Sbjct  83   ACAVRLGNDASIRQKLSVTRRTFYSITFSAARTCAQAEKLNVSVA-----SDSGLLPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S G+D+YSWAF A  + V + +HNP  E DP+CGP+IDSVA+K L  P+  + NMLK
Sbjct  138  VYASIGWDSYSWAFKAMHSVVSLAIHNPGVEDDPACGPMIDSVAIKTLKPPQHTKSNMLK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESL-KAVKYIDSNHFLVPSGTRAV  259
            NGDFEEGP++ P++ WGVL+PP  ED  SPLPGW I S  KAVKYIDS HF+VP G+ AV
Sbjct  198  NGDFEEGPHVFPDSPWGVLVPPMDEDATSPLPGWTIMSQSKAVKYIDSPHFVVPQGSYAV  257

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAGRE+A+VQ V T+PG+ Y L FSVGDA + C+  M V+A+A R  LQ+ Y+S G G
Sbjct  258  ELVAGREAALVQEVITVPGRSYRLFFSVGDAGDGCKDGMVVDAYAARENLQMRYESLGVG  317

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            G  RA   F AV  RTR+ F S  YH
Sbjct  318  GHRRAEVGFVAVGNRTRVVFQSLNYH  343



>ref|XP_002446724.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
 gb|EES11052.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
Length=379

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 242/340 (71%), Gaps = 7/340 (2%)
 Frame = -3

Query  1020  VLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIK  841
              LFL           I DGL+PNGNFE  P  SQ+KGSRV+  + IP W IS GFVEYI 
Sbjct  15    ALFLIVCLAARAASAIQDGLLPNGNFEEAPPKSQLKGSRVMGRNAIPHWEIS-GFVEYIG  73

Query  840   SGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVS  661
             SG+KQG+M+L VP+G++AVRLG +ASI   + + +G +YS++F+  RTCAQ E+LNV+V+
Sbjct  74    SGQKQGDMLLPVPEGAYAVRLGNEASIQQRLALTQGAHYSITFSAARTCAQAEQLNVTVA  133

Query  660   PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVAL  481
             P S+     ILP+QT+Y+S+G+D+YSWAF A S+ V +++HNP   +D +CGP+ID  A+
Sbjct  134   PESD-----ILPIQTVYTSSGWDSYSWAFKATSSVVSLIIHNPGVAEDAACGPLIDLFAI  188

Query  480   KLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKY  304
             K L  P+  + N+LKNGDFEEGPYI PNT WGVL+PP  EDD+SPL  W I+ S K+VKY
Sbjct  189   KTLPTPQSSKNNLLKNGDFEEGPYIFPNTRWGVLVPPMDEDDYSPLSPWMILSSTKSVKY  248

Query  303   IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
             +D+ H +VP G RAVELV+G E+A+VQ   T+PG  Y L FS GDA N C GSM V+A+A
Sbjct  249   VDAPHHVVPHGARAVELVSGMETALVQNATTVPGLPYRLQFSAGDAGNGCVGSMAVQAYA  308

Query  123   GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             G  +++  +QS+GKGG  R    FTA + +TR+ F+S  Y
Sbjct  309   GGKSVKAQFQSQGKGGHKRGVLDFTATADQTRVVFVSMGY  348



>ref|XP_002446728.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
 gb|EES11056.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
Length=371

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 240/327 (73%), Gaps = 8/327 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            IT+GL+PNG+FE+GP  S+M G+RV+  + IP W IS GF+EYI+SG+KQ +M+L VP+G
Sbjct  24   ITEGLLPNGHFEQGPAKSEMNGTRVLGRYSIPHWEIS-GFLEYIESGQKQDDMLLQVPEG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
              AVRLG DA+I   + V +  YYS++F+  RTCAQ E+LNVSV+P S     G+LP+QT
Sbjct  83   ERAVRLGNDATIQQQLAVTRHTYYSITFSASRTCAQAEKLNVSVTPES-----GVLPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S+G+D+YSWAF A  + V + +HNP  E++P+CGP+ID VA+K L +P  ++ NML+
Sbjct  138  VYTSSGWDSYSWAFKARHSTVWLSIHNPGHEENPACGPLIDRVAVKTLRSPHHVKNNMLR  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKYIDSNHFLVPSGTRAV  259
            NGDFE+GPYI  +T WGVL+PP  ED+HSPLPGW+I S  K VKY+D+ H  VP G  AV
Sbjct  198  NGDFEDGPYIFADTPWGVLVPPITEDEHSPLPGWMIMSDTKVVKYVDAPHHAVPRGAGAV  257

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLT-LQVPYQSKGK  82
            ELVAGRE A+VQ VRT+P + Y+L F+VGDA N CEG++ V+  AGR   L VPY+S G 
Sbjct  258  ELVAGRECALVQEVRTVPRRSYKLSFAVGDAANGCEGNLAVDVSAGRAAKLNVPYESHGT  317

Query  81   GGFIRANHRFTAVSTRTRIRFLSSFYH  1
            GG+ RA   F A    TR+ F S+ ++
Sbjct  318  GGYKRAELEFVATDNLTRVVFQSANHY  344



>ref|XP_004978108.1| PREDICTED: uncharacterized protein LOC101762525 [Setaria italica]
Length=381

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 244/351 (70%), Gaps = 7/351 (2%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M K  +  AL   L ++    +  +++DGL+PNGNFE+GP  S+M G+RV D   I  W 
Sbjct  7     MTKGARRLALFFLLVSVAARAVSAVVSDGLLPNGNFEQGPNKSEMNGTRVKDRDAILHWE  66

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             I  GFVEYI+SG  Q +M+L VP+G  AVRLG DA+I   + V +  YYS++FT  R+CA
Sbjct  67    IY-GFVEYIESGHTQEDMILPVPEGDRAVRLGNDATIRQKLCVTRQAYYSITFTAARSCA  125

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E LNVSV+P     D+G+LP+QT+Y+S+G+D+YSWAF A+ + V + +HNP  E +P+
Sbjct  126   QAEALNVSVTP-----DFGVLPIQTVYTSSGWDSYSWAFKAKHSSVWLSIHNPGHEDNPA  180

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+IDS+A+K L+ P     NML+NGDFEEGPYI P+  WGVL+PP  ED +SPLPGW+
Sbjct  181   CGPLIDSIAIKNLHPPHHTPVNMLRNGDFEEGPYIFPDVPWGVLVPPMSEDLYSPLPGWM  240

Query  330   IES-LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             + S  K VKY+D+ H  VP G RAVELVAG E A+VQ VRT+PG+ Y L FSVGD  N C
Sbjct  241   VLSDTKVVKYVDAAHHAVPRGARAVELVAGMECALVQEVRTVPGRWYRLSFSVGDGANGC  300

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              GS+GV+A+AG+ T +V Y+S+G GG  R +  F A    TRI F SS YH
Sbjct  301   GGSLGVDAYAGKATTKVSYESRGTGGHRRVDLDFAAAENLTRIVFHSSNYH  351



>ref|XP_008669227.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 ref|XP_008669228.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 tpg|DAA37148.1| TPA: hypothetical protein ZEAMMB73_528816 [Zea mays]
Length=380

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 234/327 (72%), Gaps = 7/327 (2%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            ++TDGL+PNGNFE GP  S + G+RV++ + +P W I  GFVEYI SG+KQ +M+L VP+
Sbjct  39   VVTDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIF-GFVEYIGSGQKQDDMILAVPE  97

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G+ AVRLG DA+I   + VI+   YS++F   RTCAQ ERLNVSV+  S     G+LP+Q
Sbjct  98   GACAVRLGNDATIRQKLEVIRKTTYSITFCAARTCAQAERLNVSVAAES-----GVLPIQ  152

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            T+Y+S+G+D+Y++AF A  +     +HNP  E +P+CGP+ID +A+K LN P   +GNML
Sbjct  153  TVYTSSGWDSYAYAFRARHSTAWFSIHNPGHEDNPACGPLIDFIAIKALNPPPLAQGNML  212

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKYIDSNHFLVPSGTRA  262
            +NGDFEEGP+I P+T WGVL+PP  EDD SPLPGW++ S  K VKY+D+ H  VP G RA
Sbjct  213  RNGDFEEGPFIFPDTAWGVLVPPMSEDDVSPLPGWMVMSDTKVVKYVDAAHHAVPRGARA  272

Query  261  VELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGK  82
            VELVAGRE+A+VQ VRT+PG+ Y L  SVGDA N CEG M VEA+A R TL+  Y+S GK
Sbjct  273  VELVAGREAALVQDVRTVPGRRYRLSLSVGDAANGCEGPMAVEAYAARATLRTTYESLGK  332

Query  81   GGFIRANHRFTAVSTRTRIRFLSSFYH  1
            GG  RA   F A +  TR+   S  +H
Sbjct  333  GGSRRAAVEFEATANLTRVVLQSYNHH  359



>ref|XP_009630913.1| PREDICTED: uncharacterized protein LOC104120779 [Nicotiana tomentosiformis]
Length=367

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 232/324 (72%), Gaps = 7/324 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRV-IDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            +GL+PNGNFE  PKP  +K   V +  + +PKW I+ GFVEYI  G + G M   V  G 
Sbjct  27   EGLLPNGNFEEQPKPKDLKKKTVLVGKYALPKWEIN-GFVEYISGGPQPGGMYFPVAHGV  85

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
            HAVRLG DASI+ T+ V KG  Y+L+F   RTCAQ+E L VSV P +     G LPLQT+
Sbjct  86   HAVRLGNDASISQTIPVKKGSLYALTFGASRTCAQDEVLRVSVPPQT-----GDLPLQTL  140

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            YSS G DTY+W F A SN V+++ HNP  ++DP+CGP++D+VA+K L  PR  R N++KN
Sbjct  141  YSSNGGDTYAWGFYATSNVVKVIFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKN  200

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
              FEEGP++L N++ GVL+PP  ED  SPLPGWIIESLKAVK++DS HF VP G  A+EL
Sbjct  201  PGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGRAAMEL  260

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            +AGRESA+ QI+RT+P KVY   F+VGDA N C G M VEAFA + T +VP++S+GKG F
Sbjct  261  LAGRESAIAQIIRTVPKKVYTFAFTVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSF  320

Query  72   IRANHRFTAVSTRTRIRFLSSFYH  1
               + +FTA++ RTRI F SSFYH
Sbjct  321  KTVSFKFTAIADRTRITFYSSFYH  344



>ref|XP_010257158.1| PREDICTED: uncharacterized protein LOC104597378 [Nelumbo nucifera]
Length=367

 Score =   369 bits (947),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 227/323 (70%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DGL+PNGNFE GP  S MK + ++  + +PKW I+ G VEYI  G + G     VP+G H
Sbjct  28   DGLLPNGNFEEGPSRSNMKKTVIVGKYSLPKWEIN-GVVEYISGGPQPGSFFFAVPRGVH  86

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ TV V  G +YSL+F   RTCAQ+E L VSV P S     G LPLQT+Y
Sbjct  87   AVRLGNEASISQTVAVKPGSFYSLTFGATRTCAQDEVLRVSVPPFS-----GDLPLQTLY  141

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+WAF A SN  ++  HNP  ++DP+CGP++D+VA+K +  P   RGN++KNG
Sbjct  142  SSNGGDTYAWAFKATSNVAKVTFHNPGIQEDPTCGPLLDAVAIKEIIPPLHTRGNLVKNG  201

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
            DFE GP++  N + GVL+PP  +D  SPLPGW + SLKAVKYIDS HF VPSG  A+ELV
Sbjct  202  DFEYGPHLFKNFSTGVLLPPKQKDHVSPLPGWTVVSLKAVKYIDSKHFSVPSGFAAIELV  261

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ Q++RT+PGK Y L F+VGDA N C GSM VEAFA + TL+VP+Q+ G   F 
Sbjct  262  AGRESAISQVLRTVPGKSYNLTFTVGDAKNGCHGSMMVEAFAAKETLKVPFQAHGGSKFK  321

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
              + +F AV  RTRI F S FYH
Sbjct  322  TVSLKFKAVEPRTRITFYSGFYH  344



>ref|XP_006653558.1| PREDICTED: uncharacterized protein LOC102719203 [Oryza brachyantha]
Length=374

 Score =   369 bits (947),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 237/326 (73%), Gaps = 7/326 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            + DGL+PNGNFE GP  SQ+ G+ V   + IP W IS GFVEYI+SG  + +M++ VP+G
Sbjct  28   VNDGLLPNGNFEDGPDKSQLNGTVVTGRYSIPNWEIS-GFVEYIESGHNEKDMIVAVPEG  86

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            + AVRLG DA+I   + V +  YYS++F+  RTCAQ+ERLNVSV+P     ++G+LP+QT
Sbjct  87   ARAVRLGNDATIRQKLSVTRRAYYSITFSAARTCAQKERLNVSVTP-----EFGVLPIQT  141

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S+G+D+YSWAF A+ + V +  HNP  E+DP+CGP+IDSVA+K L  PRR +GNMLK
Sbjct  142  VYTSSGWDSYSWAFKAKHSAVWLSFHNPGEEEDPACGPLIDSVAIKTLYPPRRTKGNMLK  201

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKYIDSNHFLVPSGTRAV  259
            NGD EEGPYI P+  WG L+PP  ED+HSPLPGW+I S  KAVK +DS H  VP G RAV
Sbjct  202  NGDLEEGPYIFPDAGWGGLVPPIFEDEHSPLPGWMIMSDTKAVKCVDSAHHAVPQGARAV  261

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELV GRE+A+VQ V T+PG+ Y L FSVGDA N C  S+ VEA+A R  L+VPY+S+G G
Sbjct  262  ELVVGRETALVQEVATVPGRPYRLSFSVGDAGNGCRDSLAVEAYAARAALKVPYESRGTG  321

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            G   A   F AV+  TR+ F S  YH
Sbjct  322  GHKLAQLEFAAVANLTRVVFRSFNYH  347



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   369 bits (946),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/343 (53%), Positives = 245/343 (71%), Gaps = 8/343 (2%)
 Frame = -3

Query  1014  FLCTIFHVG--LC----RLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             F    F +G  LC       +DGL+PNGNFE+ P  S +KGS VI  + +P W I  G V
Sbjct  3     FFSFFFSLGVLLCFSCVSAFSDGLLPNGNFEKAPSHSSLKGSVVIGKNSLPDWEIG-GAV  61

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EY+KSG+K G+++LV+P+G  AVRLG DA I   V V KG  Y+L+ +  RTCA +E+LN
Sbjct  62    EYVKSGQKSGDLMLVIPEGFAAVRLGSDAFIRQRVSVNKGELYALTLSAARTCASDEKLN  121

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             V+VS +S   D G++ +QT+Y++ G+D+Y+WAFLAES+ + + + +P +++DP+CG ++D
Sbjct  122   VTVSTDS-IRDSGLISVQTIYNAKGWDSYAWAFLAESSEIGVFIGDPGQDEDPACGSVVD  180

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKA  313
             +VALK+L+ P+  RGN+LKNGDFEEGPY LPN   GVLIPPN  D +SPLPGW I SLK+
Sbjct  181   AVALKVLHPPKANRGNLLKNGDFEEGPYFLPNNLDGVLIPPNQIDRNSPLPGWTILSLKS  240

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             V+YIDS HF VP G +AVEL+AG+ES + Q   T+P   Y L F VGDANN+C+GSM VE
Sbjct  241   VRYIDSPHFSVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANNTCKGSMAVE  300

Query  132   AFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             A+AGR +L+V Y+SKG GGF RA   F A+   TR  F S+FY
Sbjct  301   AYAGRGSLKVDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFY  343



>gb|EAY74932.1| hypothetical protein OsI_02826 [Oryza sativa Indica Group]
Length=361

 Score =   367 bits (943),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 233/325 (72%), Gaps = 19/325 (6%)
 Frame = -3

Query  972  TDGLVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            TDGL+PNGNFE GP  S +  G+ V   + IP+W  +SGFVEYI+SG KQG+M+LVVPQG
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWE-TSGFVEYIESGHKQGDMLLVVPQG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            +HAVRLG +ASI   + V +G YY+++F+  RTCAQ E+LNVSV+P     +WG+LP+QT
Sbjct  83   AHAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVTP-----EWGVLPMQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+            L  P   +GNMLK
Sbjct  138  IYGSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPAA-----------LYPPTLAKGNMLK  186

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVE  256
            N      P + P+ +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVE
Sbjct  187  NAGSRR-PLLPPHASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAVPQGARAVE  245

Query  255  LVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGG  76
            LV G+ESA+VQ VRT+PG  Y L F+VGDA + C GSM  EA+A R +++VPY+SKG GG
Sbjct  246  LVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVPYESKGTGG  305

Query  75   FIRANHRFTAVSTRTRIRFLSSFYH  1
            + RA   F A++ RTR+ F S+FYH
Sbjct  306  YKRAVLEFAAIANRTRVVFQSTFYH  330



>ref|XP_008669229.1| PREDICTED: uncharacterized protein LOC103646276 [Zea mays]
Length=379

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 233/327 (71%), Gaps = 7/327 (2%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            +++DGL+PNGNFE GP  S + G+RV++ + +P W I  GFVEYI SG+KQ +M+L VP+
Sbjct  38   VVSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIL-GFVEYIGSGQKQDDMILPVPE  96

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G+ AVRLG DA+I   + +I+   YS++F   RTCAQ ERL VSV+  S     G+LP+Q
Sbjct  97   GACAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAES-----GVLPIQ  151

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            T+Y+S G+D+YS+AF A  +     +HNP  E DP+CGP+IDSVA+K LN P   + NML
Sbjct  152  TVYTSNGWDSYSYAFRARHSTAWFSIHNPGHEDDPACGPLIDSVAIKALNPPHLTKDNML  211

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKYIDSNHFLVPSGTRA  262
            +NGDFEEGP I P+T WGVL+PP  EDD SPLPGW++ S  K VKY+D+ H  VP G RA
Sbjct  212  RNGDFEEGPVIFPDTAWGVLVPPMSEDDVSPLPGWMVMSDTKVVKYVDAAHHAVPRGARA  271

Query  261  VELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGK  82
            VELVAGRE+A+VQ VRT+PG+ Y L  +VGDA N CEG M VEA+A R TL+  Y+S+G 
Sbjct  272  VELVAGREAALVQEVRTVPGRHYRLSLAVGDAANGCEGPMAVEAYAARATLRTTYESRGN  331

Query  81   GGFIRANHRFTAVSTRTRIRFLSSFYH  1
            GG  RA   FTA++  TR+   S  +H
Sbjct  332  GGSKRAVVDFTAIANLTRVVLQSYNHH  358



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/323 (57%), Positives = 230/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            +GL+PNGNFE  P PS +  + +   + +PKW I+ G VEYI  G + G M   V  G H
Sbjct  25   EGLLPNGNFEEPPNPSTLHKTVIQGKYSLPKWEIN-GLVEYISGGPQPGGMYFPVVHGVH  83

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ T+ V  G  YSL+F   RTCAQ+E L VSV P S     G LPLQT+Y
Sbjct  84   AVRLGNEASISQTIPVKPGSLYSLTFGSSRTCAQDEVLRVSVPPLS-----GDLPLQTLY  138

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+WAF   SN  +++ HN   ++DP+CGP++D+VA+K L  P   R N+++NG
Sbjct  139  SSNGGDTYAWAFRPTSNFAKVIFHNLGVQEDPACGPLLDAVAIKELLPPMPTRDNLVRNG  198

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP++L N+T GVL+PP  ED  SPLPGWIIESLKAVK+IDS HF VP G+ AVELV
Sbjct  199  GFEEGPHLLKNSTNGVLLPPKQEDATSPLPGWIIESLKAVKFIDSAHFNVPYGSAAVELV  258

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AG+ESA+ Q++RT+P K+Y L F+VGDA N C GSM VEAFAG  TL+VP++SKGKGGF 
Sbjct  259  AGKESAIAQVIRTVPNKLYNLTFTVGDARNGCHGSMSVEAFAGAETLKVPFESKGKGGFK  318

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
              + +F AV  RTRI F SSFYH
Sbjct  319  AVSFKFKAVGARTRITFFSSFYH  341



>ref|XP_004229647.1| PREDICTED: uncharacterized protein LOC101251618 [Solanum lycopersicum]
Length=402

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 239/348 (69%), Gaps = 10/348 (3%)
 Frame = -3

Query  1035  KLTALVLFLCTIFHVGLCRLI--TDGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVIS  865
             K++ L+LF   +F     R     +GL+PNGNFE  PK   +K   V+   + +PKW I+
Sbjct  39    KVSVLILF-SFLFTASAVRPAPPLEGLLPNGNFEELPKAKDLKKKTVLQGKYALPKWEIN  97

Query  864   SGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQE  685
              G VEYI  G + G M   V  G HAVRLG +ASI+ T+ V KG  Y+L+F   RTCAQE
Sbjct  98    -GLVEYISGGPQPGGMYFAVAHGVHAVRLGNEASISQTIPVKKGSLYALTFGASRTCAQE  156

Query  684   ERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCG  505
             E L VSV P +     G LPLQT+YSS G DTY+W F A SN V+I  HNP  ++DP+CG
Sbjct  157   EVLRVSVPPQT-----GDLPLQTLYSSNGGDTYAWGFYATSNVVKITFHNPGVQEDPACG  211

Query  504   PIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIE  325
             P++D+VA+K L  PR  R N++KN  FEEGP++L N++ GVL+PP  ED  SPLPGWIIE
Sbjct  212   PLLDAVAIKELFPPRPTRVNLVKNAGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIE  271

Query  324   SLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGS  145
             SLKAVK++DS HF VP G  AVEL+AGRESA+ QI+RT+P KVY   FSVGDA N C G 
Sbjct  272   SLKAVKFLDSAHFNVPFGQAAVELLAGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGD  331

Query  144   MGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             M VEAFA + T +VP++S+GKG F   + +FTA++ RTRI F SSFYH
Sbjct  332   MMVEAFAAKETFKVPFKSQGKGSFKTVSFKFTAIADRTRITFYSSFYH  379



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   367 bits (941),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 230/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DGL+ NGNFE  PKP+ +K   ++  + +PKW I  G VEYI +G + G M   V  G H
Sbjct  30   DGLLANGNFEEPPKPTNLKKKVLVGKYALPKWEID-GLVEYISAGPQPGGMYFNVAHGVH  88

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ T++V  G  Y+L+F   RTCAQEE L V V P +     G LP+QT+Y
Sbjct  89   AVRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLY  143

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A S  V++  HNP  ++DP+CGP++D++A+K L      R N+++N 
Sbjct  144  SSNGGDTYAWGFRATSATVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRDNLVRNP  203

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEE P+ L N++ GVL+PP   D  SPLPGWIIESLKAVK+IDSNHF VP G  AVELV
Sbjct  204  GFEEAPHRLLNSSHGVLLPPKQLDATSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELV  263

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RT+P K+Y L F+VGDA N C+GSM VEAFAG+ TL+VP+ SKGKGGF 
Sbjct  264  AGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKETLKVPFASKGKGGFK  323

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
            +A+ RF AVS RTRI F SSFYH
Sbjct  324  KASFRFKAVSIRTRITFFSSFYH  346



>dbj|BAD52536.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61499.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 211/273 (77%), Gaps = 5/273 (2%)
 Frame = -3

Query  819  MVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPND  640
            M+LVVPQG+HAVRLG +ASI   + V +G YY+++F+  RTCAQ E+LNVSVSP     +
Sbjct  1    MLLVVPQGAHAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP-----E  55

Query  639  WGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPR  460
            WG+LP+QT+Y S G+D+Y+WAF A+ + V +V+HNP  E+DP+CGP+ID VA++ L  P 
Sbjct  56   WGVLPMQTIYGSNGWDSYAWAFKAKMDEVALVIHNPGVEEDPACGPLIDGVAIRALYPPT  115

Query  459  RLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLV  280
              +GNMLKNG FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF V
Sbjct  116  LAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFAV  175

Query  279  PSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVP  100
            P G RAVELV G+ESA+VQ VRT+PG  Y L F+VGDA + C GSM  EA+A R +++VP
Sbjct  176  PQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARASIKVP  235

Query  99   YQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            Y+SKG GG+ RA   F A++ RTR+ F S+FYH
Sbjct  236  YESKGTGGYKRAVLEFAAIANRTRVVFQSTFYH  268



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 232/323 (72%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DGL+ NGNFE  PKP+ +K + ++  + +PKW I+ G VEYI +G + G M   V  G H
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEIN-GLVEYISAGPQPGGMYFHVAHGVH  88

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ T++V  G  Y+L+F   RTCAQEE L V V P +     G LP+QT+Y
Sbjct  89   AVRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLY  143

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A S  V++  HNP  ++DP+CGP++D++A+K L      RGN+++N 
Sbjct  144  SSNGGDTYAWGFRATSETVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRGNLVRNP  203

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEE P+ L N++ GVL+PP   D  SPLPGWIIESLKAVK+IDSNHF VP G  AVELV
Sbjct  204  GFEEAPHRLLNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELV  263

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RT+P K+Y L F+VGDA N C+GSM VEAFAG+ TL+VP+ SKGK GF 
Sbjct  264  AGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFASKGKCGFK  323

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
            +A+ RF AVS RTRI F SSFYH
Sbjct  324  KASFRFKAVSIRTRITFFSSFYH  346



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   366 bits (939),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 230/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            +GL+PNGNFE  PK + +K + +   +G+PKW I+ G VEYI  G + G M   V  G H
Sbjct  28   EGLLPNGNFEDPPKRTDLKKTVIQGKNGLPKWEIN-GLVEYISGGPQPGGMFFAVAHGVH  86

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG DASI+ ++ V  G  Y+L+F   RTCAQ+E L VSV P +     G LPLQT+Y
Sbjct  87   AVRLGNDASISQSIPVKPGSLYALTFGASRTCAQDEVLRVSVHPQT-----GDLPLQTLY  141

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A SN  ++V HNP  ++DP+CGP++D+VA+K L  PR  R N++KN 
Sbjct  142  SSNGGDTYAWGFRAASNVAKVVFHNPGVQEDPACGPLLDAVAIKELFPPRPTRDNLVKNA  201

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP+ L N++ GVL+PP  ED  SPLPGWIIESLKAVK+ID  HF VP G  AVELV
Sbjct  202  GFEEGPHRLINSSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDKKHFNVPFGLAAVELV  261

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ Q++RT+P K Y L F+VGDA N C GSM VEAFA + TL+VP+QS+GKG F 
Sbjct  262  AGRESAIAQMIRTLPSKCYNLTFAVGDARNGCHGSMMVEAFAAKDTLKVPFQSQGKGRFK  321

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A+S RTR+ F SSFYH
Sbjct  322  TASLKFKALSARTRLTFFSSFYH  344



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   365 bits (938),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 232/323 (72%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DGL+ NGNFE  PKP+ +K + ++  + +PKW I+ G VEYI +G + G M   V  G H
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEIN-GLVEYISAGPQPGGMYFHVAHGVH  88

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ T++V  G  Y+L+F   RTCAQEE L V V P +     G LP+QT+Y
Sbjct  89   AVRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQA-----GDLPMQTLY  143

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A S  V++  HNP  ++DP+CGP++D++A+K L      R N+++N 
Sbjct  144  SSNGGDTYAWGFRATSETVKVTFHNPGVQEDPACGPLLDAIAIKELFPVYPTRDNLVRNP  203

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEE P+ L N++ GVL+PP   D  SPLPGWIIESLKAVK+IDSNHF VP G  AVELV
Sbjct  204  GFEEAPHRLLNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSNHFNVPVGKGAVELV  263

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RT+P K+Y L F+VGDA N C+GSM VEAFAG+ TL+VP+ SKGKGGF 
Sbjct  264  AGRESAIAQIIRTVPNKLYSLSFTVGDARNGCQGSMMVEAFAGKDTLKVPFASKGKGGFK  323

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
            +A+ RF AVS RTRI F SS+YH
Sbjct  324  KASFRFKAVSIRTRITFFSSYYH  346



>ref|XP_009758716.1| PREDICTED: uncharacterized protein LOC104211372 [Nicotiana sylvestris]
Length=366

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 230/324 (71%), Gaps = 7/324 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRV-IDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            +GL+PNGNFE  PKP  +K   V +  + +PKW I+ G VEYI  G + G M   V  G 
Sbjct  26   EGLLPNGNFEEQPKPKDLKKKTVLVGKYALPKWEIN-GLVEYISGGPQPGGMYFPVAHGI  84

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
            HAVRLG DASI+ T+ V KG  Y+L+F   RTCAQ+E L VSV P +     G LPLQT+
Sbjct  85   HAVRLGNDASISQTIPVKKGSLYALTFGASRTCAQDEVLRVSVPPQT-----GDLPLQTL  139

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            YSS G DTY+W F A SN V++  HNP  ++DP+CGP++D+VA+K L  PR  R N++KN
Sbjct  140  YSSNGGDTYAWGFYATSNVVKVSFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKN  199

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
              FEEGP++L N++ GVL+PP  ED  SPLPGWIIESLKAVK++DS HF VP G  AVEL
Sbjct  200  PGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGQAAVEL  259

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            +AGRESA+ QI+RT+P KVY   F+VGDA N C G M VEAFA + T +VP++S+GKG F
Sbjct  260  LAGRESAIAQIIRTVPKKVYAFAFTVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSF  319

Query  72   IRANHRFTAVSTRTRIRFLSSFYH  1
               + +FTA++ RTRI F SS+YH
Sbjct  320  KTVSFKFTAIADRTRITFYSSYYH  343



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 230/326 (71%), Gaps = 6/326 (2%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            L  DGL+ NGNFE  PKP+ +K + +I  + +PKW I  G VEYI +G + G M   V  
Sbjct  27   LPLDGLLANGNFEEPPKPTDLKKTVIIGKNSLPKWEID-GLVEYISAGPQPGGMYFDVAH  85

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G HAVRLG DASI+ T++V  G  Y+L+F   RTCAQEE L VSV P +     G LPLQ
Sbjct  86   GVHAVRLGNDASISQTIKVKLGSLYALTFGASRTCAQEEVLRVSVPPQA-----GDLPLQ  140

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            T+YSS G DTY+W F A S  V++  HNP  ++DP+CGP++D+VA+K L      R N++
Sbjct  141  TLYSSNGGDTYAWGFRATSETVKVTFHNPGIQEDPACGPLLDAVAIKELFPVYPSRDNLV  200

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            +N  FEE P+ L N++ GVL+PP   D  SPLPGWIIESLKA+K+ID+ HF VP G  AV
Sbjct  201  RNPGFEEAPHRLFNSSHGVLLPPKQLDATSPLPGWIIESLKAIKFIDAKHFNVPFGKGAV  260

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAGRESA+ Q++RT+P K+Y L F+VGDA N C GSM VEAFAG+ TL+VP+ SKGKG
Sbjct  261  ELVAGRESAIAQVLRTVPNKLYSLSFTVGDARNGCHGSMMVEAFAGKETLKVPFTSKGKG  320

Query  78   GFIRANHRFTAVSTRTRIRFLSSFYH  1
            GF  A+ RF AVS RTRI F SSFYH
Sbjct  321  GFKTASFRFKAVSIRTRITFFSSFYH  346



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 230/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            +GL+ NGNFE  PKPS +K + +I  + +PKW I+ GFVEYI  G + G M   V  G H
Sbjct  29   EGLLANGNFEEPPKPSSLKKTVLIGKNALPKWEIN-GFVEYISGGPQPGGMYFAVAHGVH  87

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ T++V  G  Y+L+F   RTCAQEE L VSV P +     G LPLQT+Y
Sbjct  88   AVRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPPQA-----GDLPLQTLY  142

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A SN V++  HNP  ++DP+CGP++D++A+K L      R N+++N 
Sbjct  143  SSNGGDTYAWGFKATSNTVKVTFHNPGIQEDPACGPLLDAIAIKELFPVLPTRDNLVRNP  202

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEE P+ L N++ GVL+PP   D  SPLPGWIIESLKAVK+ID+ HF VP G  AVELV
Sbjct  203  GFEEAPHRLMNSSHGVLLPPKQLDATSPLPGWIIESLKAVKFIDAKHFNVPFGKGAVELV  262

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ Q++RT+P K+Y L F++GDA N C GSM VEAFAG+ TL+VP+ S+GKGGF 
Sbjct  263  AGRESAIAQVLRTVPNKLYSLSFTIGDARNGCHGSMMVEAFAGKDTLKVPFNSQGKGGFK  322

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A S RTRI F SSFYH
Sbjct  323  NASFKFKATSFRTRITFFSSFYH  345



>ref|XP_010673134.1| PREDICTED: uncharacterized protein LOC104889574 [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 225/323 (70%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG +PNGNFE GPKP+ +K + +   H +PKWV   G VEY+  G + G    VVP+G H
Sbjct  31   DGYLPNGNFEEGPKPTNIKKTVIKGKHSLPKWV-KKGMVEYVSGGPQPGGFFFVVPRGVH  89

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +AS++  VRV KG YYSL+F+  RTCA EE L VS S  S       LP+QT+Y
Sbjct  90   AVRLGNEASVSQYVRVKKGLYYSLTFSATRTCALEEVLRVSASKISTD-----LPIQTLY  144

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+WAF A SN V++  HNP  E+DP+CGP++D VA+K +    +  GN++KNG
Sbjct  145  SSNGGDTYAWAFQAMSNIVKVTFHNPGTEEDPTCGPLLDDVAIKEMMPLLKPIGNIVKNG  204

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
            DFE GP++  N + GVL+ P+  D  SPLPGWIIESLK VKYIDS HF VPSG+ A+ELV
Sbjct  205  DFEIGPHVFKNFSTGVLLLPHSHDVISPLPGWIIESLKPVKYIDSTHFFVPSGSFAIELV  264

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
             GRESA+ QI+RTIP K Y L F VGDA N C GSM VEAFA     +V Y S+GKGGF 
Sbjct  265  GGRESAIAQIIRTIPDKFYLLTFKVGDAKNGCHGSMLVEAFAAEENTKVSYDSQGKGGFT  324

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
              + +F A+STRTR+ F SSFYH
Sbjct  325  STSLKFQAISTRTRLTFWSSFYH  347



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 238/349 (68%), Gaps = 13/349 (4%)
 Frame = -3

Query  1026  ALVLFLCTIFHV-------GLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVI  868
             A VLFL   F            ++  DGL+ NGNFE  PKP+ +K + +I  + +PKW I
Sbjct  2     AAVLFLLLAFSFMFTNPAYAAVQVPLDGLLNNGNFEEPPKPTNLKKTVLIGKYALPKWEI  61

Query  867   SSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQ  688
             + GFVEYI  G + G M   V  G HAVRLG +ASI+ T++V  G  Y+L+F   RTCAQ
Sbjct  62    N-GFVEYISGGPQPGGMYFSVAHGVHAVRLGNEASISQTIKVKPGSLYALTFGASRTCAQ  120

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             EE L VSV P +     G LPLQT+YSS G DTY+W F A SN V++  HNP  ++DP+C
Sbjct  121   EEVLRVSVPPQA-----GDLPLQTLYSSNGGDTYAWGFRATSNVVKVTFHNPGVQEDPAC  175

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP++D++A+K L      R N+++N  FEE P+ L N++ GVL+PP   D  SPLPGWII
Sbjct  176   GPLLDAIAIKELFPALPTRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWII  235

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLKAVK+IDS HF VP G  AVELVAGRESA+ Q++RT+P K+Y+L F VGDA N C G
Sbjct  236   ESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHG  295

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM VEAFAG+ TL+VP+ S+GKGGF  A+ +F A S RTRI F SSFYH
Sbjct  296   SMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYH  344



>ref|XP_006653557.1| PREDICTED: uncharacterized protein LOC102718925 [Oryza brachyantha]
Length=384

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 239/338 (71%), Gaps = 20/338 (6%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I+ GL+PNGNFE  P  SQM G+RV   + IPKW IS GFVEYI SG+KQG+M+L VP+G
Sbjct  24   ISYGLLPNGNFEEAPDESQMNGTRVTGRYAIPKWEIS-GFVEYIGSGQKQGDMLLPVPEG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   + + +G +YS++F+  RTCAQ E LNV+VSP S     G LP+QT
Sbjct  83   AYAVRLGNEASIQQKLGLTRGMHYSITFSAARTCAQSEVLNVTVSPES-----GDLPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLR-----  451
            +Y+S+G+D+YSWAF A+ + V +++HN     D +CGP+IDS A+K L  P+R +     
Sbjct  138  VYTSSGWDSYSWAFKAKHSVVTLIVHNVGVSDDAACGPLIDSFAIKTLQLPQRTKVQFMG  197

Query  450  --------GNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYID  298
                    GNMLKNG FEEGPYI PNT+WGVL+PP  EDD+SPL  W ++ S K+VK ID
Sbjct  198  AHRETNQPGNMLKNGGFEEGPYIFPNTSWGVLVPPRDEDDYSPLSPWAVLSSTKSVKCID  257

Query  297  SNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGR  118
            S H+ VP G RAVEL++G E+A+VQ V T+PG+ Y L FSVGDA + C GS+ V+A+A R
Sbjct  258  SAHYSVPGGARAVELLSGMETALVQEVSTVPGRSYRLEFSVGDAGDGCAGSLAVQAYASR  317

Query  117  LTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFY  4
             +++VPYQS+G GG  R    FTA   RTR+ F+S  Y
Sbjct  318  GSVKVPYQSQGTGGHKRGVLEFTATEKRTRVVFVSMAY  355



>ref|XP_010241208.1| PREDICTED: uncharacterized protein LOC104585885 [Nelumbo nucifera]
Length=366

 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 227/323 (70%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            D L+PNGNFE GP PS +K + +I  + +PKW I  G VEYI  G + G     VP+G H
Sbjct  27   DELLPNGNFEEGPNPSNLKKTVIIGKYSLPKWEID-GLVEYISGGPQPGGFFYAVPRGVH  85

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            A RLG +ASI+ ++ V  G +Y+L+F   RTCAQ+E L VSV P S     G LP+QT+Y
Sbjct  86   AARLGNEASISQSIAVKPGSFYALTFGTTRTCAQDEVLRVSVPPFS-----GDLPIQTLY  140

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+WAF A SN  +I  HN   ++DP+CGP++D+VA+K + +P    GN++KNG
Sbjct  141  SSNGGDTYAWAFKATSNVAKITFHNLGIQEDPACGPLLDAVAIKEIISPLPTGGNLVKNG  200

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
            DFE GP++  N + GVLIPP  +D  SPLPGWIIESLKAVKYIDS HF VPSG  A+ELV
Sbjct  201  DFENGPHLFKNFSTGVLIPPKQQDLISPLPGWIIESLKAVKYIDSKHFSVPSGFAAIELV  260

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ Q++RT+PGK+YEL F+VGDA N C GSM VEAFA   TL+VP+QS     F 
Sbjct  261  AGRESAIAQVLRTVPGKLYELTFTVGDAKNGCYGSMMVEAFAANETLKVPFQSHASSRFK  320

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A+  RTRI F S FYH
Sbjct  321  TASLKFKALEPRTRITFYSGFYH  343



>ref|XP_003580051.1| PREDICTED: uncharacterized protein LOC100841904 [Brachypodium 
distachyon]
Length=373

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 241/351 (69%), Gaps = 9/351 (3%)
 Frame = -3

Query  1050  MKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             M K  +  AL+L +       L   +TDGL+PNG F +GP  SQM G+ V   H +P W 
Sbjct  1     MTKSRRCMALLLLVGMAAPAVLA--VTDGLLPNGRFSQGPDKSQMNGTVVTGKHAMPNWE  58

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             +S GFVEYI+SG K+ +M+L VP G++AVRLG DA+I   + V +  YYS++F   R+CA
Sbjct  59    LS-GFVEYIESGHKEADMLLAVPVGANAVRLGNDATIRQQLSVTRKAYYSITFVAARSCA  117

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E+LNVSV P     ++G+LP+QT+Y+STG+D+YSWAF A  + V + +HN   E+DP+
Sbjct  118   QAEKLNVSVDP-----EFGVLPIQTVYTSTGWDSYSWAFKARRSTVTLSIHNTGIEEDPA  172

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP+I +VA+K L  P+R++GNML+NGDFE GPYI P+T WGV++PP +ED HSPLPGW+
Sbjct  173   CGPLIIAVAIKALALPQRIKGNMLRNGDFELGPYIFPDTPWGVMVPPILEDVHSPLPGWM  232

Query  330   IES-LKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             I S  K VKY+D+ H  VP G  AVELVAGRESA+VQ V T+ G  Y L F VGDA N C
Sbjct  233   IMSHTKVVKYVDTPHHAVPHGAYAVELVAGRESALVQEVGTVEGWTYRLSFFVGDAGNGC  292

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              GS+ VE +A   +L+  Y+S GKGG      +FTAV   TR+ F SS +H
Sbjct  293   TGSLAVEVYAAGASLRAAYESDGKGGSKPFKLQFTAVGNSTRVVFQSSNHH  343



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   364 bits (934),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 231/330 (70%), Gaps = 6/330 (2%)
 Frame = -3

Query  990  GLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVL  811
            GL     +G + NGNFE+ PKP  +  + +   + +P W  ++G VEYI +G + G M  
Sbjct  19   GLAATYMEGFLKNGNFEQKPKPRDINKTVLKGKNALPGWE-TNGLVEYISAGPQPGGMYF  77

Query  810  VVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGI  631
             V  G HAVRLG +ASI+ T+ V  G  Y+L+F   RTCAQ+E L VSV P S     G 
Sbjct  78   AVAHGVHAVRLGNEASISQTLAVKAGSLYALTFGASRTCAQDEVLRVSVPPLS-----GD  132

Query  630  LPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLR  451
            LPLQT+YSS G DTY+W F+A+SN V++  HNP  ++DP+CGP++D+VA+K L  PR  R
Sbjct  133  LPLQTLYSSNGGDTYAWGFIAKSNVVKVTFHNPGVQEDPACGPLVDAVAIKELFPPRPTR  192

Query  450  GNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSG  271
             N++KN  FEEGP+ L NT+ GVL+PP  ED  SPLPGWIIESLKAVK+IDS HF VP G
Sbjct  193  DNLVKNPGFEEGPHRLVNTSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDSKHFNVPFG  252

Query  270  TRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQS  91
              AVELVAGRESA+ QI+RTIP KVY+L FSVGDA N C GSM VEAFA + T +VP++S
Sbjct  253  LAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKNGCHGSMMVEAFAAKDTFKVPFES  312

Query  90   KGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
            +GKG F   +  F AVS RTRI F SS+YH
Sbjct  313  QGKGKFKTVSFNFKAVSARTRITFYSSYYH  342



>ref|XP_009355498.1| PREDICTED: uncharacterized protein LOC103946508 [Pyrus x bretschneideri]
Length=366

 Score =   363 bits (933),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 237/349 (68%), Gaps = 11/349 (3%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCR-----LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVI  868
             ++ L L LC + +  LC      +  DG +PNG+FE  P PS +K + +I  + +PKW I
Sbjct  1     MSPLSLLLCFLTYFSLCNSYASAVPLDGELPNGHFEESPHPSNLKKTVIIGKYSLPKWEI  60

Query  867   SSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQ  688
             S G VEY+K G + G     VP+G HAVRLG +ASI+  V V     YSL+F   RTCAQ
Sbjct  61    S-GLVEYVKGGPQPGGFFFNVPRGVHAVRLGNEASISQNVIVSPSSVYSLTFGATRTCAQ  119

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             +E L VSV     P     L LQT++SS G DTY+WAF A SN V+I LHNP  ++DP+C
Sbjct  120   DEVLTVSV-----PGQSADLSLQTVFSSNGGDTYAWAFKAMSNVVKITLHNPGVQEDPAC  174

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP++D++A+K +      RGN++KNG FE+GP++  N + G+LIPP + D +SPLPGWI+
Sbjct  175   GPLLDAIAIKQMLPFNYTRGNLVKNGGFEKGPHVFKNFSTGILIPPKVNDPYSPLPGWIV  234

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLK VKYID  HF VP G  A+ELVAGRESA+ QI+RT+P K Y L+F++GDA N C G
Sbjct  235   ESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNGCHG  294

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM VEAFAG+ TL+VP+ S GKGGF  A  +F A S RTR+ F S++YH
Sbjct  295   SMMVEAFAGKETLKVPFVSAGKGGFKTAILKFQANSIRTRLTFYSAYYH  343



>gb|ACU17881.1| unknown [Glycine max]
Length=282

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYI  844
             LVLFL +I         TDGL+PNGNFE+GPKPSQ+KGS V     IP W IS GFVEYI
Sbjct  8     LVLFL-SISTSHAVFSFTDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTIS-GFVEYI  65

Query  843   KSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSV  664
             KSG+KQG+M+LVVP+G +AVRLG +ASI   +++IKG +YS++F+  RTCAQEE+LNVSV
Sbjct  66    KSGQKQGDMLLVVPEGDYAVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSV  125

Query  663   SPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVA  484
              P +E  DWGI+P+QTMY S G+++++  F A+    QIV+HNP +E+DP+CGP+IDSVA
Sbjct  126   VPTTEKRDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVIHNPGKEEDPACGPLIDSVA  185

Query  483   LKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKY  304
             LK+L  P+R R N+LKNG+FEEGPYI PN++WG LIPP+IED H PLPGWI+ESLKAVKY
Sbjct  186   LKVLYPPKRTRANLLKNGNFEEGPYIFPNSSWGALIPPHIEDSHGPLPGWIVESLKAVKY  245

Query  303   IDSNHFLVPSGTRAVELVAGRESA  232
             IDS+HF VP G RA+ELVAG+ESA
Sbjct  246   IDSDHFAVPEGKRAIELVAGKESA  269



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 180/327 (55%), Positives = 230/327 (70%), Gaps = 6/327 (2%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVP  802
            R   +GL+PNGNFE   KPS +K + +I  + +PKW IS G VEYI  G + G M   V 
Sbjct  33   RTPLEGLLPNGNFEDPIKPSDIKKTTLIGKYALPKWEIS-GKVEYIHGGPQPGGMYFAVA  91

Query  801  QGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPL  622
             G HAVRLG +ASI+ T+ V  G  Y+L+F   +TCAQ E L VSV P +     G LPL
Sbjct  92   HGVHAVRLGNEASISQTIPVKIGTLYALTFGASKTCAQNEVLRVSVPPQT-----GDLPL  146

Query  621  QTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNM  442
            QT+YSS G DTY + F+  +N  +I  HNP  ++DP+CGP++D+VA+K L+ P+  R N+
Sbjct  147  QTLYSSNGGDTYGFGFIPNTNYAKITFHNPGIQEDPACGPLLDAVAIKELSPPKPTRANL  206

Query  441  LKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRA  262
            +KNGDFEEGPY L N++ GVL+PP+ ED  SPLPGWIIESLKAVK+ID+ HF VPSG  A
Sbjct  207  VKNGDFEEGPYRLINSSHGVLLPPSQEDRTSPLPGWIIESLKAVKFIDAMHFNVPSGRAA  266

Query  261  VELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGK  82
            +EL+ GRES + QI+RT+P K Y L FSVGD  N C GSM VEAFA + TL+VP+QS GK
Sbjct  267  IELLGGRESVIAQIIRTVPNKEYNLTFSVGDGKNGCHGSMMVEAFAAKSTLKVPFQSVGK  326

Query  81   GGFIRANHRFTAVSTRTRIRFLSSFYH  1
            G +   + +FTA+S RTR+ F SSFYH
Sbjct  327  GQYKTVSFKFTAISARTRLTFFSSFYH  353



>ref|XP_011091660.1| PREDICTED: uncharacterized protein LOC105172024 [Sesamum indicum]
Length=371

 Score =   363 bits (932),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 237/352 (67%), Gaps = 6/352 (2%)
 Frame = -3

Query  1056  EYMKKMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPK  877
             E  KK+  L   V F+  +  V       +GL+PNGNFE  PKP+ +K + +     +PK
Sbjct  2     EVKKKICLLVYCVWFVYAVSGVAPPPAPLEGLLPNGNFEEKPKPTDLKKTVLQGKRALPK  61

Query  876   WVISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRT  697
             W I  G VEYI  G + G M   V  G HAVRLG +AS++ T+ V  G  Y+L+F   RT
Sbjct  62    WEID-GLVEYISGGPQPGGMYFAVAHGVHAVRLGNEASVSQTIPVKNGSLYALTFGASRT  120

Query  696   CAQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKD  517
             CAQ+E L VSV P +     G LPLQT+YSS G DTY+W F A S+ V+++ HNP R++D
Sbjct  121   CAQDEVLRVSVPPQT-----GDLPLQTLYSSNGGDTYAWGFRANSDSVKVIFHNPGRQED  175

Query  516   PSCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPG  337
             P+CGP++D+VA+K L  PR  R N++KN  FEEGP++L N++ GVL+PP  ED  SPLPG
Sbjct  176   PACGPLLDAVAIKELFPPRPTRVNLVKNNGFEEGPHLLINSSHGVLLPPKQEDLTSPLPG  235

Query  336   WIIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNS  157
             WIIESLKAVK+IDS +F VP G  AVEL+AGRESA+ Q++RT+P K Y L F VGDA N 
Sbjct  236   WIIESLKAVKFIDSANFNVPFGKAAVELLAGRESAIAQVIRTVPNKAYNLTFVVGDAKND  295

Query  156   CEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             C GSM +EAFA +  ++ P++S+GKG F   + +FTA   RTR+ F SSFYH
Sbjct  296   CHGSMMIEAFAAKSVMKAPFKSEGKGKFSTYSFKFTATLYRTRLTFFSSFYH  347



>emb|CAD41548.2| OSJNBb0091E11.18 [Oryza sativa Japonica Group]
Length=371

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 237/325 (73%), Gaps = 7/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE  P  SQ+ G+RVI  + IP+W IS GFVEYI SG+ QG+M+L VP+G
Sbjct  24   IMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEIS-GFVEYIGSGQMQGDMLLPVPEG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   + + +G +YS++F+  RTCAQ E LN++V+P     + G +P+QT
Sbjct  83   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S+G+D+YSWAF A  + V +++HNP    D +CGP+IDS A+K L +P   + N+LK
Sbjct  138  VYTSSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYIDSNHFLVPSGTRAV  259
            NG FEEGPYI PNT+WGVL+PP  EDD+SPL  W I+   K+VKY+D+ H+ VP G RAV
Sbjct  198  NGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAV  257

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG E+A+VQ V T+PG+ Y L FSVGDA + C GSM V+A+    +++VPY+S+G+G
Sbjct  258  ELVAGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRG  317

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            G+ R    FTA   RTR+ F+S  Y
Sbjct  318  GYKRGVLEFTATDKRTRVVFVSMAY  342



>emb|CAH67377.1| OSIGBa0159F11.1 [Oryza sativa Indica Group]
 emb|CAH67293.1| OSIGBa0103O01.11 [Oryza sativa Indica Group]
 gb|EAY94677.1| hypothetical protein OsI_16456 [Oryza sativa Indica Group]
Length=371

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 237/325 (73%), Gaps = 7/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE  P  SQ+ G+RVI  + IP+W IS GFVEYI SG+ QG+M+L VP+G
Sbjct  24   IMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEIS-GFVEYIGSGQMQGDMLLPVPEG  82

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   + + +G +YS++F+  RTCAQ E LN++V+P     + G +P+QT
Sbjct  83   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQT  137

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S+G+D+YSWAF A  + V +++HNP    D +CGP+IDS A+K L +P   + N+LK
Sbjct  138  VYTSSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLK  197

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYIDSNHFLVPSGTRAV  259
            NG FEEGPYI PNT+WGVL+PP  EDD+SPL  W I+   K+VKY+D+ H+ VP G RAV
Sbjct  198  NGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAV  257

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG E+A+VQ V T+PG+ Y L FSVGDA + C GSM V+A+    +++VPY+S+G+G
Sbjct  258  ELVAGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRG  317

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            G+ R    FTA   RTR+ F+S  Y
Sbjct  318  GYKRGVLEFTATDKRTRVVFVSMAY  342



>ref|NP_001053190.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAF15104.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAG93696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 237/325 (73%), Gaps = 7/325 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE  P  SQ+ G+RVI  + IP+W IS GFVEYI SG+ QG+M+L VP+G
Sbjct  30   IMDGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEIS-GFVEYIGSGQMQGDMLLPVPEG  88

Query  795  SHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQT  616
            ++AVRLG +ASI   + + +G +YS++F+  RTCAQ E LN++V+P     + G +P+QT
Sbjct  89   AYAVRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP-----EIGEVPIQT  143

Query  615  MYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLK  436
            +Y+S+G+D+YSWAF A  + V +++HNP    D +CGP+IDS A+K L +P   + N+LK
Sbjct  144  VYTSSGWDSYSWAFKARRSDVSLIVHNPGVTDDAACGPLIDSFAIKTLQSPPSTKDNLLK  203

Query  435  NGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW-IIESLKAVKYIDSNHFLVPSGTRAV  259
            NG FEEGPYI PNT+WGVL+PP  EDD+SPL  W I+   K+VKY+D+ H+ VP G RAV
Sbjct  204  NGGFEEGPYIFPNTSWGVLVPPMDEDDYSPLSPWTIMGYTKSVKYVDAAHYAVPGGARAV  263

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKG  79
            ELVAG E+A+VQ V T+PG+ Y L FSVGDA + C GSM V+A+    +++VPY+S+G+G
Sbjct  264  ELVAGMEAALVQEVCTVPGRSYRLEFSVGDAGDGCVGSMSVQAYVSHGSVKVPYESQGRG  323

Query  78   GFIRANHRFTAVSTRTRIRFLSSFY  4
            G+ R    FTA   RTR+ F+S  Y
Sbjct  324  GYKRGVLEFTATDKRTRVVFVSMAY  348



>ref|XP_011087959.1| PREDICTED: uncharacterized protein LOC105169285 [Sesamum indicum]
Length=369

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 242/350 (69%), Gaps = 9/350 (3%)
 Frame = -3

Query  1041  MTKLTALVL---FLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWV  871
             MT  T+ VL   FL T+  +        GL+PNGNFE  PK + +K + +   + +PKW 
Sbjct  1     MTVKTSFVLSLYFLYTVSGLASPSASFQGLLPNGNFEEKPKSTGIKKTVLEGRYALPKWE  60

Query  870   ISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCA  691
             I+ G VEYI  G + G M   V QG HAVRLG +ASI+ T+ V  G  Y+L+F+  RTCA
Sbjct  61    IN-GLVEYISGGPQPGGMYFPVAQGIHAVRLGNEASISQTIPVKNGSLYALTFSASRTCA  119

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q+E L VSV P +     G LPLQT+Y S G DTY+W F A+SN V+++ HNP  ++DP+
Sbjct  120   QDEVLRVSVPPQT-----GDLPLQTLYCSNGGDTYAWGFRAKSNSVKVIFHNPGVQEDPA  174

Query  510   CGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWI  331
             CGP++D+VA+K L  PR  + N++KN  FEEGP+ L N++ GVL+PP  +D  SPLPGW+
Sbjct  175   CGPLLDAVAIKELKPPRPTKENLVKNAGFEEGPHHLFNSSNGVLLPPRQQDLTSPLPGWM  234

Query  330   IESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCE  151
             IESLKAVK+IDS ++ +P G  AVELVAGRESA+ Q++RTIP KVY L F VGDA N C 
Sbjct  235   IESLKAVKFIDSTYYNIPFGKSAVELVAGRESAIAQVIRTIPNKVYNLKFVVGDAKNGCH  294

Query  150   GSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             GSM VEAFA + +++ P++S+GKG F   + +FTA S RTRI FLSSFYH
Sbjct  295   GSMMVEAFAAKASIKAPFKSEGKGKFQAFSFQFTATSYRTRITFLSSFYH  344



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 230/323 (71%), Gaps = 7/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            +G +PNG+FE  PKP+ +K + ++  H +PKW I+ GFVE+I  G + G M   V  G H
Sbjct  29   EGYLPNGDFEELPKPTNLKKTVLVGKHALPKWEIN-GFVEFIAGGPQPGGMFFPVSHGVH  87

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            A+RLG +ASI+ T+ V  G  Y+L+F   RTCAQ+E L VSV P S     G LPLQT+Y
Sbjct  88   AIRLGNEASISQTITVKPGALYALTFGASRTCAQDEVLRVSVPPQS-----GDLPLQTLY  142

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
               G DTY+W F A++N V +  HNP  ++DP+CGP+ID+VA+K L  P   R N++KN 
Sbjct  143  DING-DTYAWGFRAKTNIVTVTFHNPGVQEDPACGPLIDAVAIKELYPPMPTRDNLVKNP  201

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP+ L NTT GVL+PP  ED  SPLPGWIIESLKAVK+ID+ HF VP G  AVELV
Sbjct  202  GFEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAKHFNVPYGHAAVELV  261

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RT+P K Y L F++GDA N C GSM VEAFAG+ T+ VP++SKGKGGF 
Sbjct  262  AGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDTVAVPFESKGKGGFK  321

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A++ RTRI F S++YH
Sbjct  322  SASLKFKAIAARTRITFFSTYYH  344



>ref|XP_008392232.1| PREDICTED: uncharacterized protein LOC103454416 [Malus domestica]
Length=366

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 237/349 (68%), Gaps = 11/349 (3%)
 Frame = -3

Query  1032  LTALVLFLCTIFHVGLCR-----LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVI  868
             ++ L L +C + +  +C      +  DG +PNG+FE  P PS +K + +I  + +P W I
Sbjct  1     MSPLSLLICFLTYFSVCNGYASAVPLDGELPNGHFEESPHPSNLKKTVIIGKYSLPXWEI  60

Query  867   SSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQ  688
             S G VEY+K G + G     VP+G HAVRLG +ASI+ +V V     YSL+F   RTCAQ
Sbjct  61    S-GLVEYVKGGAQPGGFFFNVPRGVHAVRLGNEASISQSVNVSPSSVYSLTFGATRTCAQ  119

Query  687   EERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSC  508
             +E L VSV     P     L LQT++SS G DTY+WAF A SN V+I LHNP  ++DP+C
Sbjct  120   DEVLTVSV-----PGQSTDLSLQTVFSSNGGDTYAWAFKAMSNVVKITLHNPGVQEDPAC  174

Query  507   GPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWII  328
             GP++D++A+K +      RGN++KNG FE+GP++  N + G+LIPP + D +SPLPGWII
Sbjct  175   GPLLDAIAIKQMLPFNYTRGNLVKNGGFEKGPHVFKNFSTGILIPPKVNDPYSPLPGWII  234

Query  327   ESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEG  148
             ESLK VKYID  HF VP G  A+ELVAGRESA+ QI+RT+P K Y L+F++GDA N C G
Sbjct  235   ESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKNGCHG  294

Query  147   SMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             SM VEAFAG+ TL+VP+ S GKGGF  A  +F A S RTR+ F S++YH
Sbjct  295   SMMVEAFAGKETLKVPFVSAGKGGFKTAILKFQATSFRTRLTFYSAYYH  343



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 228/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            +GL+PNGNFE  P  S +  + +   + +PKW I+ G VEYI  G + G M   V  G H
Sbjct  26   EGLLPNGNFEEKPSASNLNKTVLKGKNSLPKWEIN-GLVEYISGGPQPGGMYFAVAHGIH  84

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +AS++ T+ V  G  YSL+F   RTCAQ+E L VSV P S     G LPLQT+Y
Sbjct  85   AVRLGNEASVSQTIPVKPGSLYSLTFGASRTCAQDEVLRVSVPPLS-----GDLPLQTLY  139

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A S   +++ HNP  ++DP+CGP++D+VA+K L  P   + N++KN 
Sbjct  140  SSNGGDTYAWGFRATSKFAKVIFHNPGIQEDPACGPLLDAVAIKELFPPMATKDNLVKNS  199

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP++L N+T GVL+PP  ED  SPLPGWIIESLKAVK+IDS HF VP G +AVELV
Sbjct  200  GFEEGPHLLQNSTNGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSAHFNVPYGFKAVELV  259

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RT+P ++Y + F+VGDA N C GSM VEAFA + TL+VPY+S GKGGF 
Sbjct  260  AGRESAIAQIIRTVPNRLYGVSFTVGDARNGCHGSMMVEAFAAKETLKVPYESHGKGGFK  319

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A+  RTRI F SSFYH
Sbjct  320  TASFKFKAIEPRTRITFYSSFYH  342



>ref|XP_002446726.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
 gb|EES11054.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
Length=378

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 236/323 (73%), Gaps = 8/323 (2%)
 Frame = -3

Query  975  ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQG  796
            I DGL+PNGNFE+GP  SQM GSRVI  + IP W  +SGFVEYI+ G++Q +MVLVVP+G
Sbjct  28   IPDGLLPNGNFEQGPDKSQMNGSRVIGQNSIPCWE-TSGFVEYIEPGQQQNDMVLVVPEG  86

Query  795  SHAVRLGEDASITTTV-RVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            + AVRLG DA+I   +  + +   YS++F+  RTCAQ E+LNVSV+  S     G+LP+Q
Sbjct  87   ARAVRLGNDATIRQQLPGLTRSMSYSITFSAARTCAQAEQLNVSVAAES-----GVLPVQ  141

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            T+Y+S+G+D+YS+AF A    V + +HNP  E+DP+CGPIIDSVA+K L+ P R++ NML
Sbjct  142  TVYTSSGWDSYSYAFKARHTAVWLTIHNPGVEEDPACGPIIDSVAIKALHPPSRVKDNML  201

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKYIDSNHFLVPSGTRA  262
            KNGDFEEGPY+ P+  WGVL+PP  EDD SPLPGW+I S  KAVKY+D+ HF VP G  A
Sbjct  202  KNGDFEEGPYMFPDLAWGVLVPPMDEDDVSPLPGWMIMSDTKAVKYLDAAHFAVPHGAYA  261

Query  261  VELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGK  82
            VELVAG E+A+VQ V+T PG+ Y+L FSVGDA N C  ++ V+A+A R    V Y+S G 
Sbjct  262  VELVAGTEAALVQEVQTKPGRSYKLSFSVGDAANGCASTLLVDAYAARGRQPVSYESHGM  321

Query  81   GGFIRANHRFTAVSTRTRIRFLS  13
            GG +R+   F AV+  TR+ F S
Sbjct  322  GGCVRSELEFAAVANLTRVVFQS  344



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/345 (53%), Positives = 236/345 (68%), Gaps = 48/345 (14%)
 Frame = -3

Query  1023  LVLFLCTIFHVGLCRL---ITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFV  853
             ++L LC       CRL   ITDGL+ NGNFERGP+PSQ++G++V+    IP W  +SG V
Sbjct  10    VLLLLCAT-----CRLALGITDGLLANGNFERGPQPSQLRGTQVVGASSIPSWR-TSGCV  63

Query  852   EYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLN  673
             EYI SG KQG+ VLVVP+                                    + ERLN
Sbjct  64    EYIPSGRKQGDRVLVVPEAR---------------------------------GRAERLN  90

Query  672   VSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIID  493
             VS S  S     G+L +QTMYSS G+D+YSWA+ A ++ V++V+HNP   +DP+CGP+ID
Sbjct  91    VSASGQS-----GVLVMQTMYSSNGWDSYSWAWDATADEVEVVVHNPGVTEDPACGPLID  145

Query  492   SVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKA  313
             SVA+K L  PRR   N++KNGDFEEGPYI+P T WGVLIP  + D+HSPLPGW++ESLKA
Sbjct  146   SVAIKTLTPPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKA  205

Query  312   VKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVE  133
             VKYIDS+HF VP G RAVEL+AGRESA+ Q++RT+PG+ Y L FSVG+A+N+C GS+ VE
Sbjct  206   VKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTCRGSLMVE  265

Query  132   AFAGRLTLQVPYQSKGKGGFI-RANHRFTAVSTRTRIRFLSSFYH  1
             A+AGR + +VPY+S G+GG   RA   F A S+RTR+ F SSFY+
Sbjct  266   AYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYN  310


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 86/195 (44%), Gaps = 31/195 (16%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKG----SRVIDPHG-IPKWVISS-GFVEYIKSGEKQ  826
            R     LV NG+FE GP   P    G    SR++D H  +P W++ S   V+YI S    
Sbjct  156  RRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAVKYIDSDH--  213

Query  825  GEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSVS  661
                  VP+G  AV L  G +++I   +R + G  Y+LSF+      TC     L V   
Sbjct  214  ----FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTC--RGSLMVEAY  267

Query  660  PNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNP---AREKDPS--CGPII  496
               E      +P ++             F A S+R ++V  +     R  D S  CGP+I
Sbjct  268  AGRESTK---VPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVI  324

Query  495  DSVALKLLNA--PRR  457
            D VA+  + A  P+R
Sbjct  325  DDVAVVSVRARPPKR  339



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 240/351 (68%), Gaps = 9/351 (3%)
 Frame = -3

Query  1044  KMTKLTALVL---FLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKW  874
             KM  + +L+L   F+ T        +  DGL+ NGNFE  PKP+ +K + +I  + +PKW
Sbjct  87    KMAAVLSLLLAFSFMFTNPAYAAVHVPLDGLLNNGNFEEPPKPTSLKKTVLIGKYALPKW  146

Query  873   VISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTC  694
              I+ GFVEYI  G + G M   V  G HAVRLG +ASI+ T++V  G  Y+L+F   RTC
Sbjct  147   EIN-GFVEYISGGPQPGGMYFSVAHGVHAVRLGNEASISQTIKVKPGSLYALTFGASRTC  205

Query  693   AQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDP  514
             AQEE L VSV P +     G LPLQT+YSS G DTY+W F A SN V++  HNP  ++DP
Sbjct  206   AQEEVLRVSVPPQA-----GDLPLQTLYSSNGGDTYAWGFRATSNVVKVTFHNPGVQEDP  260

Query  513   SCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW  334
             +CGP++D++A+K L      R N+++N  FEE P+ L N++ GVL+PP   D  SPLPGW
Sbjct  261   ACGPLLDAIAIKELFPALPTRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGW  320

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             IIESLKAVK+IDS HF VP G  AVELVAGRESA+ Q++RT+P K+Y L F VGDA N C
Sbjct  321   IIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYNLSFVVGDARNGC  380

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              GSM VEAFAG+ TL+VP+ S+GKGGF  A+ +F A S RTRI F SSFYH
Sbjct  381   HGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYH  431



>ref|NP_001141282.1| hypothetical protein precursor [Zea mays]
 gb|ACF85954.1| unknown [Zea mays]
 tpg|DAA37150.1| TPA: hypothetical protein ZEAMMB73_862661 [Zea mays]
Length=375

 Score =   361 bits (926),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 245/348 (70%), Gaps = 14/348 (4%)
 Frame = -3

Query  1044  KMTKLTALVLFLCTIFHVGLCRLITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVIS  865
             + +    ++LFL     VG+     DGL+PNGNFE+GP   QM G+ VI    IP W IS
Sbjct  4     RASSRRGVLLFLL----VGVASANPDGLLPNGNFEQGPDKYQMNGTWVIGRKSIPCWEIS  59

Query  864   SGFVEYIKSGEKQGE-MVLVVPQGSHAVRLGEDASITTTVR-VIKGGYYSLSFTFVRTCA  691
              GFVEYI SG++Q   MV+ VP+G+ AVRLG DASI   +  + +G  YS++F+  RTCA
Sbjct  60    -GFVEYIVSGQQQDNGMVVAVPEGARAVRLGNDASIRQRLTGMTRGTSYSVTFSASRTCA  118

Query  690   QEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPS  511
             Q E+LNVSV+P S     G+LP+QT+Y+S+G+D+YS+AF A  +   +V+HNP  E+DP+
Sbjct  119   QAEQLNVSVAPES-----GVLPIQTVYTSSGWDSYSYAFRARHSAAWLVIHNPGVEEDPA  173

Query  510   CGPIIDSVALKLLNAPRR-LRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW  334
             CGP+IDSVA+K L+ P R  + NMLKNGDFEEGPY+ P+T WGVL+PP  EDD SPLPGW
Sbjct  174   CGPVIDSVAIKALHPPSRTAKDNMLKNGDFEEGPYVFPDTPWGVLVPPMDEDDVSPLPGW  233

Query  333   -IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNS  157
              ++   KAVKY+D+ HF VP G+RAVELVAG E+A+VQ VRT PG+ Y L FS GDA + 
Sbjct  234   TVMSDTKAVKYLDAAHFAVPRGSRAVELVAGTEAALVQEVRTTPGRSYTLSFSAGDAADG  293

Query  156   CEGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLS  13
             C G++ V+A+A R  L V Y+S+G GGF+R    F AV+  TR+ F S
Sbjct  294   CAGALRVDAYAARGRLPVSYESRGTGGFVRNELEFAAVANLTRVVFQS  341


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 84/196 (43%), Gaps = 33/196 (17%)
 Frame = -3

Query  981  RLITDGLVPNGNFERGPK--PSQMKGSRV-----IDPHGIPKWVISSG--FVEYIKSGEK  829
            R   D ++ NG+FE GP   P    G  V      D   +P W + S    V+Y+ +   
Sbjct  191  RTAKDNMLKNGDFEEGPYVFPDTPWGVLVPPMDEDDVSPLPGWTVMSDTKAVKYLDAAH-  249

Query  828  QGEMVLVVPQGSHAVRL--GEDASITTTVRVIKGGYYSLSFTF---VRTCAQEERLNVSV  664
                   VP+GS AV L  G +A++   VR   G  Y+LSF+       CA   R++   
Sbjct  250  -----FAVPRGSRAVELVAGTEAALVQEVRTTPGRSYTLSFSAGDAADGCAGALRVDAYA  304

Query  663  SPNSEPNDWGILPLQTMYSSTG-FDTYSWAFLAESNRVQIVLHNPAREKDPS---CGPII  496
            +        G LP+      TG F      F A +N  ++V  +      P    CGP++
Sbjct  305  AR-------GRLPVSYESRGTGGFVRNELEFAAVANLTRVVFQSMGHYMKPDGTLCGPVV  357

Query  495  DSVALKLL--NAPRRL  454
            D V+L  +  +A RRL
Sbjct  358  DDVSLVAVHKHAARRL  373



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 227/323 (70%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            DG +PNG+FE  PKPS +K + +I  + +PKW IS G VEYIK G + G     VP+G H
Sbjct  32   DGELPNGHFEEAPKPSNLKKTVIIGKYSLPKWEIS-GLVEYIKGGPQPGGFFFPVPRGVH  90

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+  V V +G  YSL+F   RTC+Q+E L +S+     P     L LQT+Y
Sbjct  91   AVRLGNEASISQDVVVTQGSVYSLTFGATRTCSQDEVLRISI-----PGQSADLSLQTLY  145

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+WAF A S  V++  HN   ++DP+CGP++D++A+K +   + +RG ++KNG
Sbjct  146  SSDGGDTYAWAFRATSKVVKVTFHNLGVQEDPTCGPLLDAIAIKEILPLKYIRGTLVKNG  205

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FE GP++  N + G+L+PP  +D  SPLPGWIIESLK VKYID  HF VP G  A+ELV
Sbjct  206  GFESGPHVFKNFSTGILLPPKAKDQISPLPGWIIESLKPVKYIDKKHFSVPGGLAAIELV  265

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RTIP K Y L F++GDA N+C GSM VEAFAG+ TL+VPY S+GKGGF 
Sbjct  266  AGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKETLKVPYTSQGKGGFK  325

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
             A+ +F A S RTRI F S++YH
Sbjct  326  TASFKFQATSPRTRITFYSAYYH  348



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 235/351 (67%), Gaps = 15/351 (4%)
 Frame = -3

Query  1026  ALVLFLCTIFHVGLCRLIT---------DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKW  874
             AL L LC    +  C             DGLV NGNFE+ P  S +K   +I  + +PKW
Sbjct  2     ALFLALCFAIILSFCHGSAHAAIPPRPLDGLVENGNFEQAPAKSNLKKRAIIGKYSLPKW  61

Query  873   VISSGFVEYIKSGEKQGEMVLVVPQGSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTC  694
              I+ G VEY+  G + G   L +P+G HAVRLG +ASI+ T+ V  G  Y+L+F   RTC
Sbjct  62    EIN-GIVEYVSGGPQPGGFYLAIPRGVHAVRLGNEASISQTLTVKPGSIYALTFGATRTC  120

Query  693   AQEERLNVSVSPNSEPNDWGILPLQTMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDP  514
             AQ+E L VSV     P     LP+QT+YSS G DTY+WA+ A S  V++  HNP  ++DP
Sbjct  121   AQDEVLRVSV-----PGQSSDLPIQTLYSSNGGDTYAWAWKATSKAVKVTFHNPGIQEDP  175

Query  513   SCGPIIDSVALKLLNAPRRLRGNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGW  334
             +CGP++D++A+K     +  +GN++KNG FE GP++  N + G+L+PP  +D  SPLPGW
Sbjct  176   TCGPLLDAIAIKETLPLKYSKGNLVKNGVFEVGPHVFKNFSTGILLPPKQQDLISPLPGW  235

Query  333   IIESLKAVKYIDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSC  154
             IIESLK VKYIDS HF VP+G  A+E+VAGRESA+ QI+RTIP K Y L F++GDA N+C
Sbjct  236   IIESLKPVKYIDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAKNAC  295

Query  153   EGSMGVEAFAGRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
              GSM VEAFAGR TL+VPY S+GKGG+  A  RF A+S+RTRI F S +YH
Sbjct  296   HGSMMVEAFAGRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYH  346



>emb|CDY39990.1| BnaC06g40680D [Brassica napus]
Length=341

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 219/286 (77%), Gaps = 7/286 (2%)
 Frame = -3

Query  975  ITDG-LVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            I+DG L+ NGNFE+GPKPSQ+KGS +     +P W I+ GFVEYIK+G+KQ +MVLVVP+
Sbjct  24   ISDGSLLANGNFEKGPKPSQLKGSVIKGRTAVPNWEIT-GFVEYIKAGQKQDDMVLVVPE  82

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            GS AVRLG +ASI+  + V  G  YS++F+  RTCAQ+ERLN+SV+  S     G++P+Q
Sbjct  83   GSSAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHES-----GVIPIQ  137

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNML  439
            TMY S G+D+YSWAF A  + ++I +HNP RE+ P+CGP+ID++A+K L  PR    N++
Sbjct  138  TMYGSDGWDSYSWAFKAGGSEIEIRIHNPGREEHPACGPLIDAIAIKALFPPRFSGNNLI  197

Query  438  KNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAV  259
            KNG+FEEGPY+ P   WGVLIPP IEDD+SPLPGW+IESLKAVKY+D  HF VP G RA+
Sbjct  198  KNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKAHFFVPEGHRAI  257

Query  258  ELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAG  121
            ELV G+ESAV QIVRT   K Y L F+VGDA ++CEG M VEAFAG
Sbjct  258  ELVGGKESAVSQIVRTSLNKFYALGFNVGDARDACEGPMAVEAFAG  303



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   358 bits (920),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 226/323 (70%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            D L+PNGNFE  PKPS +K + +     +PKW I  G VEYI  G + G M   V  G H
Sbjct  31   DALLPNGNFEDPPKPSDLKKTVIQGRFSLPKWEIH-GLVEYISGGPQPGGMFFAVAHGVH  89

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+ ++ V  G  YSL+F   RTCAQ+E L VSV P       G LPLQT+Y
Sbjct  90   AVRLGNEASISQSIPVKNGSLYSLTFGSSRTCAQDEVLRVSVPPL-----LGDLPLQTLY  144

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS G DTY+W F A SN  +I  HN   ++DP+CGP++D+VA+K L  P   + N++KNG
Sbjct  145  SSDGGDTYAWGFRATSNVAKITFHNIGAQEDPACGPLLDAVAIKELFPPFPTKDNLVKNG  204

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FEEGP++L N+T G+L+PP   D +SPLPGWIIES+KAV+Y+DS+HF VP G  AVELV
Sbjct  205  GFEEGPHVLKNSTSGILLPPKQNDINSPLPGWIIESIKAVRYLDSHHFTVPLGAAAVELV  264

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ Q++RT+P KVY L F VGDA N C GSM VEAFAG+ T++VP++S+G+GG+ 
Sbjct  265  AGRESAIAQLIRTVPKKVYTLSFIVGDAKNGCHGSMLVEAFAGKDTVKVPFESRGQGGYK  324

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
                RF A+  RTRI F SSFYH
Sbjct  325  VGKMRFMALEPRTRITFFSSFYH  347



>tpg|DAA37149.1| TPA: hypothetical protein ZEAMMB73_398073 [Zea mays]
Length=382

 Score =   358 bits (920),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 233/341 (68%), Gaps = 21/341 (6%)
 Frame = -3

Query  978  LITDGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQ  799
            +++DGL+PNGNFE GP  S + G+RV++ + +P W I  GFVEYI SG+KQ +M+L VP+
Sbjct  27   VVSDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIL-GFVEYIGSGQKQDDMILPVPE  85

Query  798  GSHAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQ  619
            G+ AVRLG DA+I   + +I+   YS++F   RTCAQ ERL VSV+  S     G+LP+Q
Sbjct  86   GACAVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAES-----GVLPIQ  140

Query  618  TMYSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLR----  451
            T+Y+S G+D+YS+AF A  +     +HNP  E DP+CGP+IDSVA+K LN P   +    
Sbjct  141  TVYTSNGWDSYSYAFRARHSTAWFSIHNPGHEDDPACGPLIDSVAIKALNPPHLTKESHT  200

Query  450  ----------GNMLKNGDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIES-LKAVKY  304
                       NML+NGDFEEGP I P+T WGVL+PP  EDD SPLPGW++ S  K VKY
Sbjct  201  AGLSQRSEHADNMLRNGDFEEGPVIFPDTAWGVLVPPMSEDDVSPLPGWMVMSDTKVVKY  260

Query  303  IDSNHFLVPSGTRAVELVAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFA  124
            +D+ H  VP G RAVELVAGRE+A+VQ VRT+PG+ Y L  +VGDA N CEG M VEA+A
Sbjct  261  VDAAHHAVPRGARAVELVAGREAALVQEVRTVPGRHYRLSLAVGDAANGCEGPMAVEAYA  320

Query  123  GRLTLQVPYQSKGKGGFIRANHRFTAVSTRTRIRFLSSFYH  1
             R TL+  Y+S+G GG  RA   FTA++  TR+   S  +H
Sbjct  321  ARATLRTTYESRGNGGSKRAVVDFTAIANLTRVVLQSYNHH  361



>gb|EMS58461.1| hypothetical protein TRIUR3_29087 [Triticum urartu]
Length=336

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 224/322 (70%), Gaps = 37/322 (11%)
 Frame = -3

Query  963  LVPNGNFERGPKPSQM-KGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSHA  787
            L+PNGNFE GP  S++  G+ V     IP+W  +SGFVEYI+SG KQG+M+LVVPQG++A
Sbjct  20   LLPNGNFELGPAKSELVNGTVVKGGKAIPRWE-TSGFVEYIESGHKQGDMLLVVPQGAYA  78

Query  786  VRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMYS  607
            VRLG DASI   + V +G YY+++F+  RTCAQ ERLNVSVSP S     G+LP+QT+Y 
Sbjct  79   VRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPES-----GVLPMQTIYG  133

Query  606  STGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNGD  427
            S G+D+Y+WAF A+ + V++VLHNP  E+DP+CGP++D+VA++ L  P   +GNMLKNG 
Sbjct  134  SNGWDSYAWAFKAKLDVVELVLHNPGVEEDPACGPLVDAVAIRTLYPPTLSKGNMLKNGG  193

Query  426  FEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELVA  247
            FEEGPY LPN +WGVL+PPNIEDDHSPLP W+I S KAVKY+D+ HF VP G RAVELV 
Sbjct  194  FEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAAHFKVPEGARAVELVG  253

Query  246  GRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFIR  67
            G+ESA+VQ VRT+PG  Y L F+VGD+ + C G                           
Sbjct  254  GKESALVQEVRTVPGWAYRLSFAVGDSADGCMGD--------------------------  287

Query  66   ANHRFTAVSTRTRIRFLSSFYH  1
                F AV  RTR+ F S+FYH
Sbjct  288  ----FVAVRDRTRVVFQSAFYH  305



>ref|XP_006345424.1| PREDICTED: uncharacterized protein LOC102582371 [Solanum tuberosum]
Length=367

 Score =   358 bits (918),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 230/324 (71%), Gaps = 7/324 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVID-PHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGS  793
            +GL+PNGNFE  PKP  +K   V+   + +PKW I+ G VEYI  G + G M   V  G 
Sbjct  27   EGLLPNGNFEELPKPKDLKKKTVLQGKYALPKWEIN-GLVEYISGGPQPGGMYFAVAHGV  85

Query  792  HAVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTM  613
            HAVRLG +ASI+ T+ V KG  Y+L+F   RTCAQEE L VSV P +     G LPLQT+
Sbjct  86   HAVRLGNEASISQTIPVKKGSLYALTFGASRTCAQEEVLRVSVPPQT-----GDLPLQTL  140

Query  612  YSSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKN  433
            YSS G DTY+W F A SN V++  HNP  ++DP+CGP++D+VA+K L  PR  R N++KN
Sbjct  141  YSSNGGDTYAWGFYATSNVVKVTFHNPGVQEDPACGPLLDAVAIKELFPPRPTRVNLVKN  200

Query  432  GDFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVEL  253
              FEEGP++L N++ GVL+PP  ED  SPLPGWIIESLKAVK++DS HF VP G  AVEL
Sbjct  201  AGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSAHFNVPFGQAAVEL  260

Query  252  VAGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGF  73
            +AGRESA+ QI+RT+P KVY   FSVGDA N C G M VEAFA + T +VP++S+GKG F
Sbjct  261  LAGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGDMMVEAFAAKETFKVPFKSQGKGSF  320

Query  72   IRANHRFTAVSTRTRIRFLSSFYH  1
               + +FTA++ RTRI F SSFYH
Sbjct  321  KTVSFKFTAIADRTRITFYSSFYH  344



>ref|XP_006489949.1| PREDICTED: uncharacterized protein LOC102629059 [Citrus sinensis]
 gb|KDO40669.1| hypothetical protein CISIN_1g046274mg [Citrus sinensis]
Length=373

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 228/323 (71%), Gaps = 6/323 (2%)
 Frame = -3

Query  969  DGLVPNGNFERGPKPSQMKGSRVIDPHGIPKWVISSGFVEYIKSGEKQGEMVLVVPQGSH  790
            D L+PNGNFE  PK S +  + +I  + +PKW IS G VEYI  G + G     VP+G H
Sbjct  34   DTLLPNGNFELSPKKSNLNKTVIIGKYSLPKWEIS-GLVEYISGGPQPGGFYFAVPRGVH  92

Query  789  AVRLGEDASITTTVRVIKGGYYSLSFTFVRTCAQEERLNVSVSPNSEPNDWGILPLQTMY  610
            AVRLG +ASI+  VRV +G  YSL+F   RTCAQ+E L VSV     P     LP+QT+Y
Sbjct  93   AVRLGNEASISQNVRVKRGSIYSLTFGTTRTCAQDEMLRVSV-----PGQSSDLPIQTLY  147

Query  609  SSTGFDTYSWAFLAESNRVQIVLHNPAREKDPSCGPIIDSVALKLLNAPRRLRGNMLKNG  430
            SS+G DTY+WAF A S+ V+++ HNP  ++DP+CGP++D+VA+K +   +  +GN +KNG
Sbjct  148  SSSGGDTYAWAFKATSDVVKVMFHNPGIQEDPTCGPLLDAVAIKEMLPLKYTKGNQVKNG  207

Query  429  DFEEGPYILPNTTWGVLIPPNIEDDHSPLPGWIIESLKAVKYIDSNHFLVPSGTRAVELV  250
             FE GP+   N + GVL+PP ++D  SPLPGWIIESLK VKYID  HF VPSG  A+E+V
Sbjct  208  GFEIGPHTFKNFSTGVLLPPKLQDLISPLPGWIIESLKPVKYIDKKHFFVPSGFSAIEIV  267

Query  249  AGRESAVVQIVRTIPGKVYELMFSVGDANNSCEGSMGVEAFAGRLTLQVPYQSKGKGGFI  70
            AGRESA+ QI+RTIP K Y+L F++GDA N+C GSM + AFA   T++ PY S GKGGF 
Sbjct  268  AGRESAIAQIIRTIPNKFYKLTFTIGDAKNACHGSMVIVAFAANETVKAPYDSVGKGGFK  327

Query  69   RANHRFTAVSTRTRIRFLSSFYH  1
            +A+  F A+S+RTRI F S++YH
Sbjct  328  KASLIFQAISSRTRITFYSAYYH  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2605467596544