BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c52294_g1_i1 len=308 path=[1:0-307]

Length=308
                                                                      Score     E

ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       71.2    8e-12   
emb|CDY44210.1|  BnaC05g15670D                                        69.7    2e-11   
ref|XP_009780984.1|  PREDICTED: subtilisin-like protease SBT5.3       69.7    3e-11   
ref|XP_009149504.1|  PREDICTED: subtilisin-like protease              69.3    3e-11   
ref|XP_004228919.2|  PREDICTED: CO(2)-response secreted protease-...  65.9    5e-10   
gb|KFK44143.1|  hypothetical protein AALP_AA1G220600                  65.5    7e-10   
ref|XP_009605223.1|  PREDICTED: subtilisin-like protease              65.1    9e-10   
ref|XP_009614808.1|  PREDICTED: cucumisin-like                        64.7    1e-09   
ref|XP_006348565.1|  PREDICTED: subtilisin-like protease-like         64.3    2e-09   
ref|XP_009757105.1|  PREDICTED: subtilisin-like protease SBT5.3       63.9    2e-09   
ref|XP_004238378.1|  PREDICTED: CO(2)-response secreted protease      62.8    6e-09   
ref|XP_006306824.1|  hypothetical protein CARUB_v10008367mg           62.8    6e-09   
ref|XP_006342240.1|  PREDICTED: subtilisin-like protease-like         62.8    6e-09   
ref|XP_002893091.1|  subtilase                                        61.6    1e-08   
ref|NP_001031070.1|  serine-type endopeptidase SBT5.2                 61.6    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564107.1|  serine-type endopeptidase SBT5.2                    61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24601.1|  Cucumisin                                             61.2    2e-08   
emb|CBI19918.3|  unnamed protein product                              61.2    2e-08   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...  61.2    2e-08   Vitis vinifera
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2   61.2    2e-08   
ref|XP_009619449.1|  PREDICTED: subtilisin-like protease isoform X1   61.2    2e-08   
ref|XP_002300693.2|  putative subtilisin precursor family protein     61.2    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010061088.1|  PREDICTED: subtilisin-like protease SBT5.3       60.8    2e-08   
ref|XP_010477246.1|  PREDICTED: CO(2)-response secreted protease ...  60.1    4e-08   
ref|XP_010477247.1|  PREDICTED: CO(2)-response secreted protease ...  60.1    4e-08   
ref|XP_006416425.1|  hypothetical protein EUTSA_v10006877mg           60.1    5e-08   
ref|XP_011083454.1|  PREDICTED: CO(2)-response secreted protease-...  59.7    6e-08   
gb|AAM65424.1|  subtilisin-like serine protease                       59.7    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009769238.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  59.3    9e-08   
ref|XP_009769237.1|  PREDICTED: subtilisin-like protease isoform X1   59.3    9e-08   
ref|XP_010498448.1|  PREDICTED: CO(2)-response secreted protease-...  59.3    1e-07   
ref|XP_004500924.1|  PREDICTED: subtilisin-like protease-like         59.3    1e-07   
ref|XP_010692513.1|  PREDICTED: CO(2)-response secreted protease      58.9    1e-07   
ref|XP_009768389.1|  PREDICTED: cucumisin-like                        58.9    1e-07   
gb|KDP40601.1|  hypothetical protein JCGZ_24600                       58.5    1e-07   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...  58.5    1e-07   
ref|XP_010536423.1|  PREDICTED: CO(2)-response secreted protease-...  58.2    2e-07   
ref|XP_006846917.1|  hypothetical protein AMTR_s00152p00071630        57.8    3e-07   
ref|XP_008449184.1|  PREDICTED: uncharacterized protein LOC103491134  56.6    7e-07   
ref|XP_011034984.1|  PREDICTED: CO(2)-response secreted protease      56.2    1e-06   
ref|XP_009607188.1|  PREDICTED: subtilisin-like protease SBT5.3       55.8    1e-06   
ref|XP_006347851.1|  PREDICTED: subtilisin-like protease-like         55.1    2e-06   
emb|CDP07365.1|  unnamed protein product                              54.3    4e-06   
ref|XP_003523384.1|  PREDICTED: subtilisin-like protease-like         54.3    5e-06   
ref|XP_004231226.1|  PREDICTED: CO(2)-response secreted protease-...  53.9    5e-06   
gb|KHN09070.1|  Subtilisin-like protease                              53.9    5e-06   
gb|KHM99088.1|  Subtilisin-like protease                              53.9    6e-06   
ref|XP_003545192.1|  PREDICTED: subtilisin-like protease-like         53.9    6e-06   
ref|XP_011003069.1|  PREDICTED: CO(2)-response secreted protease-...  53.9    6e-06   
ref|XP_009771512.1|  PREDICTED: subtilisin-like protease              53.1    6e-06   
ref|XP_004491111.1|  PREDICTED: subtilisin-like protease-like         53.5    8e-06   
ref|XP_002307740.1|  putative subtilisin precursor family protein     53.1    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003523395.1|  PREDICTED: subtilisin-like protease-like         53.1    1e-05   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3       52.8    1e-05   
gb|AAK53589.1|AF352059_1  subtilisin-like protein                     52.8    1e-05   Glycine max [soybeans]
ref|NP_001236511.1|  subtilisin-type protease precursor               52.8    1e-05   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3       52.8    1e-05   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like         52.4    2e-05   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative    52.4    2e-05   Ricinus communis
ref|XP_007141639.1|  hypothetical protein PHAVU_008G213000g           52.4    2e-05   
ref|WP_031170460.1|  serine protease                                  52.4    2e-05   
ref|XP_003608824.1|  Subtilisin-like protease                         52.0    2e-05   
ref|WP_012891725.1|  serine protease                                  52.0    3e-05   
ref|WP_033362075.1|  hypothetical protein                             51.6    3e-05   
ref|XP_009391633.1|  PREDICTED: subtilisin-like protease isoform X2   51.6    3e-05   
ref|XP_009391632.1|  PREDICTED: subtilisin-like protease isoform X1   51.6    3e-05   
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3       51.2    4e-05   
gb|EYU17578.1|  hypothetical protein MIMGU_mgv1a0038491mg             50.8    4e-05   
ref|XP_007017870.1|  Subtilisin-like serine endopeptidase family ...  51.2    4e-05   
ref|XP_004514295.1|  PREDICTED: subtilisin-like protease-like         51.2    5e-05   
ref|XP_007017871.1|  Subtilisin-like serine endopeptidase family ...  51.2    5e-05   
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg           51.2    5e-05   
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease              50.8    6e-05   
ref|XP_006435228.1|  hypothetical protein CICLE_v10000339mg           50.4    7e-05   
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3       50.4    7e-05   
gb|KDO84930.1|  hypothetical protein CISIN_1g004113mg                 50.4    7e-05   
gb|KDO84931.1|  hypothetical protein CISIN_1g004113mg                 50.4    7e-05   
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease              50.4    7e-05   
ref|XP_010095549.1|  Subtilisin-like protease                         50.4    8e-05   
ref|XP_002510578.1|  Cucumisin precursor, putative                    50.1    8e-05   Ricinus communis
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease              50.4    8e-05   
ref|XP_011085840.1|  PREDICTED: CO(2)-response secreted protease-...  50.4    9e-05   
ref|XP_004308419.1|  PREDICTED: xylem serine proteinase 1-like        50.1    9e-05   
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3       50.1    1e-04   
ref|XP_003603196.1|  Subtilisin-type protease                         50.1    1e-04   
ref|XP_008776598.1|  PREDICTED: subtilisin-like protease              50.1    1e-04   
ref|XP_002303965.2|  hypothetical protein POPTR_0003s18830g           50.1    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006432515.1|  hypothetical protein CICLE_v10000349mg           50.1    1e-04   
ref|XP_006432516.1|  hypothetical protein CICLE_v10000349mg           50.1    1e-04   
ref|XP_006471277.1|  PREDICTED: subtilisin-like protease-like         50.1    1e-04   
ref|XP_011020517.1|  PREDICTED: CO(2)-response secreted protease-...  50.1    1e-04   
gb|KEH19205.1|  subtilisin-like serine protease                       50.1    1e-04   
emb|CDP18817.1|  unnamed protein product                              50.1    1e-04   
gb|KEH19203.1|  subtilisin-like serine protease                       49.7    1e-04   
gb|KEH19202.1|  subtilisin-like serine protease                       49.7    1e-04   
ref|XP_006398245.1|  hypothetical protein EUTSA_v100011270mg          49.7    1e-04   
gb|KDP28708.1|  hypothetical protein JCGZ_14479                       49.3    2e-04   
dbj|BAJ53130.1|  JHL05D22.1                                           49.3    2e-04   
ref|XP_010091321.1|  Subtilisin-like protease                         49.3    2e-04   
ref|XP_003603806.1|  Subtilisin-like serine protease                  49.3    2e-04   
gb|KEH19206.1|  subtilisin-like serine protease                       49.3    2e-04   
gb|AES74057.2|  subtilisin-like serine protease                       48.9    2e-04   
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease              48.9    2e-04   
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3       48.9    2e-04   
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease              48.9    3e-04   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                     48.5    3e-04   
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3       48.5    3e-04   
emb|CDP14561.1|  unnamed protein product                              48.5    3e-04   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like         48.5    3e-04   
ref|XP_004308189.1|  PREDICTED: subtilisin-like protease-like         48.5    3e-04   
ref|XP_011039898.1|  PREDICTED: subtilisin-like protease SBT5.4       48.5    3e-04   
ref|XP_010095116.1|  Subtilisin-like protease                         48.5    4e-04   
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3       48.5    4e-04   
ref|XP_006843321.1|  hypothetical protein AMTR_s00910p00007910        47.8    4e-04   
ref|XP_008221224.1|  PREDICTED: subtilisin-like protease              48.1    4e-04   
gb|AAF79898.1|AC022472_7  Contains similarity to p69c gene from L...  48.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564106.1|  subtilisin-like serine endopeptidase family pro...  48.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500923.1|  PREDICTED: subtilisin-like protease-like         48.1    4e-04   
ref|XP_011074702.1|  PREDICTED: CO(2)-response secreted protease-...  48.1    4e-04   
ref|XP_006398487.1|  hypothetical protein EUTSA_v10001201mg           48.1    5e-04   
ref|XP_006471314.1|  PREDICTED: subtilisin-like protease-like         48.1    5e-04   
ref|XP_011074701.1|  PREDICTED: CO(2)-response secreted protease-...  48.1    5e-04   
ref|XP_008232921.1|  PREDICTED: xylem serine proteinase 1             48.1    5e-04   
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like         48.1    5e-04   
ref|XP_006432517.1|  hypothetical protein CICLE_v10003851mg           47.8    5e-04   
gb|KDO77989.1|  hypothetical protein CISIN_1g0040471mg                47.4    5e-04   
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4       47.8    5e-04   
gb|KDO77991.1|  hypothetical protein CISIN_1g0040471mg                47.8    5e-04   
ref|XP_006449588.1|  hypothetical protein CICLE_v10014347mg           47.8    5e-04   
gb|KDO77986.1|  hypothetical protein CISIN_1g0040471mg                47.8    6e-04   
ref|NP_001175897.1|  Os09g0482660                                     47.4    6e-04   
ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  47.8    6e-04   
ref|XP_007028364.1|  Subtilisin-like serine endopeptidase family ...  47.8    6e-04   
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like         47.8    6e-04   
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg              47.8    6e-04   
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg           47.8    6e-04   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        47.8    6e-04   Oryza sativa Indica Group [Indian rice]
gb|KDO77988.1|  hypothetical protein CISIN_1g0040471mg                47.4    6e-04   
ref|XP_008445401.1|  PREDICTED: subtilisin-like protease              47.4    7e-04   
ref|XP_006279865.1|  hypothetical protein CARUB_v10028532mg           47.4    7e-04   
ref|XP_007136109.1|  hypothetical protein PHAVU_009G018600g           47.4    7e-04   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  47.4    7e-04   
ref|XP_002299063.2|  hypothetical protein POPTR_0001s47290g           47.4    7e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008357123.1|  PREDICTED: subtilisin-like protease              47.4    8e-04   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g           47.4    8e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  47.4    8e-04   
gb|EEE69927.1|  hypothetical protein OsJ_29791                        47.0    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002273703.1|  PREDICTED: CO(2)-response secreted protease      47.0    0.001   Vitis vinifera
ref|XP_003545787.1|  PREDICTED: subtilisin-like protease-like         47.0    0.001   
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4       47.0    0.001   



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKL-ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            STVYPL  G S K  +N ++++AR C+P SLD  K KGKI+LCE  D   Y    K+ EV
Sbjct  370  STVYPLIHGNSTKSNDNVSEADARSCVPGSLDENKVKGKIVLCENLDDGEYFPSDKLDEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  GV  IL+  D ++R +A K   FP  +
Sbjct  430  KSRGGVGFILI--DDDERTVAPKFKAFPAGV  458



>emb|CDY44210.1| BnaC05g15670D [Brassica napus]
Length=772

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++S+AR C   SLD EK KGKI+LCE  D +SY      EVK+
Sbjct  369  SPVYPLIHGKSAKSADASESSARTCDYGSLDQEKVKGKIVLCENFDGSSYASSASDEVKS  428

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  I V  D   R +A   G FP ++
Sbjct  429  KGGIGCIFV--DDRTRAVASAYGTFPTTV  455



>ref|XP_009780984.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=768

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLEN-ATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            S+VYPL  G S K  N  ++++AR C+P SLD  K KGKI+LCE  D   Y    K+ EV
Sbjct  370  SSVYPLIHGNSTKSNNNVSEADARSCVPGSLDENKVKGKIVLCENLDDGEYFPSDKLDEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  GV  IL+  D ++R +A K   FP  +
Sbjct  430  KSRGGVGFILI--DDDERTVAPKFNSFPAGV  458



>ref|XP_009149504.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=772

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++S+AR C   SLD EK KGKI+LCE  D +SY      EVK+
Sbjct  369  SPVYPLIYGKSAKSADASESSARTCDYGSLDQEKVKGKIVLCENFDGSSYASSASDEVKS  428

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  I V  D   R +A   G FP ++
Sbjct  429  KGGIGCIFV--DDRTRAVASAYGTFPTTV  455



>ref|XP_004228919.2| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=764

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 50/91 (55%), Gaps = 3/91 (3%)
 Frame = -2

Query  268  STVYPLATGASVKL--ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPLA   SVK+  E      A DC P  LD  K KGKII+C+  D    +  ++ EV
Sbjct  363  SPVYPLADSVSVKIDSEFVYDGEASDCEPDKLDEHKVKGKIIICDHLDDYYSLEERLDEV  422

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K   G+  IL  PD E  I A K+G FPG++
Sbjct  423  KKKGGIGFILSLPDDE-LITAPKMGSFPGAV  452



>gb|KFK44143.1| hypothetical protein AALP_AA1G220600 [Arabis alpina]
Length=773

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G   K  +A++ +AR C   SLD EK KGKI+LCE  D +SY      EVK+
Sbjct  371  SPVYPLIHGKFAKNVDASEGSARTCDDGSLDQEKVKGKIVLCENVDGSSYASSARDEVKS  430

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  I V  D   R +A   G FP ++
Sbjct  431  KGGIGCIFV--DDRSRAVASAYGAFPTTV  457



>ref|XP_009605223.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=783

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLENA--TKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            STVYPL +G   K E+   ++ NAR C+P SL+ +K KGKI+LC   D       K+ EV
Sbjct  370  STVYPLISGDLAKSEDNDISEKNARSCVPDSLNEKKVKGKIVLCHNHDEGYSPSDKLEEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  G+  ILV  D   R +A K   FP ++
Sbjct  430  KSKGGIGFILV--DDNARTVAPKFKSFPAAV  458



>ref|XP_009614808.1| PREDICTED: cucumisin-like [Nicotiana tomentosiformis]
Length=768

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S  L       A DC P +LD  K KGKI+LC+       I  ++ EVKN
Sbjct  370  SPVYPLVDSKSANL-TMYDGEASDCEPDTLDEHKVKGKIVLCDHLSDDFSIEDRLNEVKN  428

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  IL+ PD ++ I+A K+G FPG++
Sbjct  429  KGGIGFILIIPD-DELIVAPKMGSFPGAV  456



>ref|XP_006348565.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=796

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSN--ARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL    SVKL++    +  ARDC P +LD  K KGKII+C+       + +++ EV
Sbjct  363  SPVYPLVDSLSVKLDSEIVFDGPARDCEPDTLDERKVKGKIIVCDHLTDDFSLEVRLNEV  422

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K   G+  IL  PD +  I A K+G FPG++
Sbjct  423  KKKGGIGFILSIPD-DQLITAPKIGSFPGAV  452



>ref|XP_009757105.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLE--NATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL +G   K E  + ++ NAR C+P SLD +K KGKI+LC  RD       K+ EV
Sbjct  370  SAVYPLISGDLAKSEENDVSEKNARSCVPDSLDEKKVKGKIVLCHNRDEGYSPSDKLEEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  G+  ILV  D   R +A K   F  ++
Sbjct  430  KSKGGIGFILV--DDNARTVAPKFKSFAAAV  458



>ref|XP_004238378.1| PREDICTED: CO(2)-response secreted protease [Solanum lycopersicum]
Length=783

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 48/91 (53%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLEN--ATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL +G   K  N    +  AR C P SLD  K KGKI+LC+ RD    +  K+ EV
Sbjct  371  SPVYPLISGDLAKSSNNVVMEKGARYCYPNSLDETKVKGKIVLCDNRDGYFSLTEKLTEV  430

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K   G+  IL+  D   R +A K   FP ++
Sbjct  431  KKKGGIGFILI--DDNARTVAPKFNSFPAAV  459



>ref|XP_006306824.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
 gb|EOA39722.1| hypothetical protein CARUB_v10008367mg [Capsella rubella]
Length=770

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++  AR C   SLD +K KGKI+LCE    +SY      EVK+
Sbjct  368  SPVYPLIHGKSAKNADASEGEARACEFGSLDQDKVKGKIVLCENVGGSSYASAARDEVKS  427

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  + V  D   R +A   G FP ++
Sbjct  428  KGGIGCVFV--DDRTRAVASAYGAFPTTV  454



>ref|XP_006342240.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=773

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLENA--TKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL +G   K  N   ++ NAR C P SLD  K KGK++LC+ RD    +  K+ EV
Sbjct  371  SPVYPLISGDLAKSGNTVVSEKNARFCNPNSLDGTKVKGKVVLCDNRDGYYSLTEKLTEV  430

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  G+  I+V  D   R +A K   FP ++
Sbjct  431  KSKGGIGFIVV--DDNARTVAPKFKSFPAAV  459



>ref|XP_002893091.1| subtilase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69350.1| subtilase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++ +AR C   SLD EK KGKI+LCE    + Y      EVK+
Sbjct  328  SPVYPLIHGKSAKNVDASEGSARACDSGSLDQEKVKGKIVLCENVGGSYYASSARDEVKS  387

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  + V  D   R +A   G FP ++
Sbjct  388  KGGIGCVFV--DDRTRAVASAYGSFPTTV  414



>ref|NP_001031070.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 gb|AEE29946.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=730

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++ +AR C   SLD EK KGKI+LCE    + Y      EVK+
Sbjct  328  SPVYPLIHGKSAKSADASEGSARACDSDSLDQEKVKGKIVLCENVGGSYYASSARDEVKS  387

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G   + V  D   R +A   G FP ++
Sbjct  388  KGGTGCVFV--DDRTRAVASAYGSFPTTV  414



>ref|NP_564107.1| serine-type endopeptidase SBT5.2 [Arabidopsis thaliana]
 sp|Q9LNU1.1|CRSP_ARATH RecName: Full=CO(2)-response secreted protease; AltName: Full=Subtilisin-like 
serine protease; Short=AtSBT5.2; AltName: Full=Tripeptidyl-peptidase 
II; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF79897.1|AC022472_6 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082. ESTs 
gb|T22485, gb|R65370, gb|AA651071 come from this gene [Arabidopsis 
thaliana]
 dbj|BAF00765.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29945.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=769

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++ +AR C   SLD EK KGKI+LCE    + Y      EVK+
Sbjct  367  SPVYPLIHGKSAKSADASEGSARACDSDSLDQEKVKGKIVLCENVGGSYYASSARDEVKS  426

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G   + V  D   R +A   G FP ++
Sbjct  427  KGGTGCVFV--DDRTRAVASAYGSFPTTV  453



>gb|KHG24601.1| Cucumisin [Gossypium arboreum]
Length=768

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 3/89 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYP+  G S K ++A  +++R+C   SLD E  KGKI++CE  D T Y    + EVK 
Sbjct  369  SPVYPIVYGKSAKKKDADVNDSRNCNTNSLDQELVKGKIVVCENLDKT-YANDHMDEVKQ  427

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+ V+L+  D + + MA   G FP ++
Sbjct  428  LGGIGVVLI--DYDSKGMASSFGTFPMTV  454



>emb|CBI19918.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G+S K  ++   +AR+C P SL  +K KG+I+LC+  D       K+ EVK 
Sbjct  344  SPAYPLIYGSSAKSNSSKVDDARNCKPNSLGEDKIKGRIVLCDNDDGEYTQTEKLEEVKR  403

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              GV +IL+  + E R +A + G FP
Sbjct  404  LGGVGLILI--EDETRAVASRYGAFP  427



>ref|XP_002269753.1| PREDICTED: CO(2)-response secreted protease-like [Vitis vinifera]
Length=768

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G+S K  ++   +AR+C P SL  +K KG+I+LC+  D       K+ EVK 
Sbjct  369  SPAYPLIYGSSAKSNSSKVDDARNCKPNSLGEDKIKGRIVLCDNDDGEYTQTEKLEEVKR  428

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              GV +IL+  + E R +A + G FP
Sbjct  429  LGGVGLILI--EDETRAVASRYGAFP  452



>ref|XP_009619450.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana tomentosiformis]
Length=760

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKL-ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            S VYPL  G S KL +  T+  AR C+P SLD  K KGKI++CE   +  +    ++ EV
Sbjct  370  SPVYPLIQGNSAKLNKRITEEEARGCVPDSLDKNKVKGKIVVCENHQNDGFSPNDRLLEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  GV  IL+  D + R +A K   FP ++
Sbjct  430  KSRGGVGFILI--DDDLRTVAPKFESFPAAV  458



>ref|XP_009619449.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana tomentosiformis]
Length=786

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query  268  STVYPLATGASVKL-ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            S VYPL  G S KL +  T+  AR C+P SLD  K KGKI++CE   +  +    ++ EV
Sbjct  370  SPVYPLIQGNSAKLNKRITEEEARGCVPDSLDKNKVKGKIVVCENHQNDGFSPNDRLLEV  429

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            K+  GV  IL+  D + R +A K   FP ++
Sbjct  430  KSRGGVGFILI--DDDLRTVAPKFESFPAAV  458



>ref|XP_002300693.2| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE79966.2| putative subtilisin precursor family protein [Populus trichocarpa]
Length=767

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S V+PL  G S K  +AT+S AR+C P S+D E  KGKI+LC+  D +     K YEV++
Sbjct  366  SPVHPLVYGKSAKKTDATESEARNCNPDSMDGEMIKGKIVLCDNDDDSYSFYDKEYEVQS  425

Query  88   ANGVAVILV  62
              G+ ++LV
Sbjct  426  LGGIGLVLV  434



>ref|XP_010061088.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW67983.1| hypothetical protein EUGRSUZ_F01673 [Eucalyptus grandis]
Length=767

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            V+PL    S +   A +S AR+C P S+D  K KGKI++C+  D+      K+ EVK+  
Sbjct  369  VHPLIYAKSARQSEALESEARNCNPSSMDATKIKGKIVVCDNDDNEYSKESKLEEVKDLG  428

Query  82   GVAVILVSPDPEDRIMALKLGGFPGSI  2
            GV +ILV  D E+R +    G FP ++
Sbjct  429  GVGLILV--DDEERSVTSTYGTFPMTV  453



>ref|XP_010477246.1| PREDICTED: CO(2)-response secreted protease isoform X1 [Camelina 
sativa]
Length=807

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++  AR C   SLD EK KGK++LCE    + Y      EVK+
Sbjct  405  SPVYPLIHGKSAKNADASEGEARACDFGSLDKEKVKGKVVLCENVGGSYYASSASDEVKS  464

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  + V  D   R +A   G FP ++
Sbjct  465  KGGIGCVFV--DDRTRAVASTYGTFPTTV  491



>ref|XP_010477247.1| PREDICTED: CO(2)-response secreted protease isoform X2 [Camelina 
sativa]
Length=784

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++  AR C   SLD EK KGK++LCE    + Y      EVK+
Sbjct  382  SPVYPLIHGKSAKNADASEGEARACDFGSLDKEKVKGKVVLCENVGGSYYASSASDEVKS  441

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  + V  D   R +A   G FP ++
Sbjct  442  KGGIGCVFV--DDRTRAVASTYGTFPTTV  468



>ref|XP_006416425.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
 gb|ESQ34778.1| hypothetical protein EUTSA_v10006877mg [Eutrema salsugineum]
Length=766

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S K  +A++  AR C   SLD +K KGKI+LCE  D + Y      EVK+
Sbjct  364  SPVYPLIHAKSAKNADASERAARTCESGSLDQDKVKGKIVLCENVDGSYYASNAKEEVKS  423

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  I V  D   R +A   G FP ++
Sbjct  424  KGGIGCIFV--DDISRAVASVYGAFPTTV  450



>ref|XP_011083454.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=729

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -2

Query  268  STVYPLATGASVKLENATK--SNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL  G S K  +     ++AR+C+P SLD  K KGKI+LCE +D       K   +
Sbjct  332  SAVYPLIDGTSAKSSSNQHDDTDARNCIPGSLDDSKVKGKIVLCENKDEDYGSKYKYDTL  391

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFP  11
            K+   V +ILV  D ++R +  K G FP
Sbjct  392  KSQGAVGMILV--DNDERQVPSKYGTFP  417



>gb|AAM65424.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=769

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G S K  +A++ +AR C   SLD EK KGKI+LCE    + Y      +VK+
Sbjct  367  SPVYPLIHGKSAKSADASEGSARACDSDSLDQEKVKGKIVLCENVGGSYYASSARDKVKS  426

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G   + V  D   R +A   G FP ++
Sbjct  427  KGGTGCVFV--DDRTRAVASAYGSFPTTV  453



>ref|XP_009769238.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = -2

Query  268  STVYPLATGASVKL-ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            S VYPL  G S KL +  T+  AR C+P SLD  K KGKI++CE   +  +    ++ EV
Sbjct  371  SAVYPLIQGYSAKLNKRITEEEARGCVPDSLDKNKVKGKIVVCENLQNDGFSPSDRLLEV  430

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGS  5
            K+  GV  IL+  D + R +A K   FP +
Sbjct  431  KSRGGVGFILI--DDDLRTVAPKFESFPAA  458



>ref|XP_009769237.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = -2

Query  268  STVYPLATGASVKL-ENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYI-GLKIYEV  95
            S VYPL  G S KL +  T+  AR C+P SLD  K KGKI++CE   +  +    ++ EV
Sbjct  371  SAVYPLIQGYSAKLNKRITEEEARGCVPDSLDKNKVKGKIVVCENLQNDGFSPSDRLLEV  430

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFPGS  5
            K+  GV  IL+  D + R +A K   FP +
Sbjct  431  KSRGGVGFILI--DDDLRTVAPKFESFPAA  458



>ref|XP_010498448.1| PREDICTED: CO(2)-response secreted protease-like [Camelina sativa]
Length=769

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G   K  +A++  AR C   SLD EK KGK++LCE    + Y      EVK+
Sbjct  367  SPVYPLIHGKFAKNADASEGEARACDYGSLDQEKVKGKVVLCENVGGSYYASSAREEVKS  426

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+  + V  D   R +A   G FP ++
Sbjct  427  KGGIGCVFV--DDRTRAVASTYGAFPTTV  453



>ref|XP_004500924.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            Y L  G S K  +A+  +AR C P SLD +K KGKI+LC+  D     G K+  VK+A G
Sbjct  382  YSLVHGESAKAISASLDDARKCHPNSLDEKKVKGKIVLCDGIDDVYLTGFKVQLVKDAGG  441

Query  79   VAVILVSPDPEDRIMALKLGGFPGS  5
            + ++ V+   +D  MA     FP +
Sbjct  442  IGLVHVT--NQDLTMATNSVDFPAT  464



>ref|XP_010692513.1| PREDICTED: CO(2)-response secreted protease [Beta vulgaris subsp. 
vulgaris]
Length=760

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL +G + K ++A++ +AR+C P S+D +K KGK++LC+ ++    +  K   VK+  G
Sbjct  364  YPLVSGGAAKSKSASEEDARNCYPDSIDADKIKGKLVLCQHKEGGFSMRAKQMGVKSRGG  423

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            + +I +  +   R++A   G FP ++
Sbjct  424  LGMIFI--NDATRLVASNWGTFPVTV  447



>ref|XP_009768389.1| PREDICTED: cucumisin-like [Nicotiana sylvestris]
Length=765

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S  L      +A +C P +LD  K KGKI++C        I  ++ EVKN
Sbjct  367  SPVYPLVDSRSANL-TMYDGDASNCEPDTLDEHKVKGKIVVCYHLTDDYSIEDRLNEVKN  425

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
             +G+  IL+ PD ++ I+A  +G FPG++
Sbjct  426  KSGIGFILIIPD-DELIVAPNMGSFPGAV  453



>gb|KDP40601.1| hypothetical protein JCGZ_24600 [Jatropha curcas]
Length=765

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S +YPL  G  V + N   S+AR C+P SLDPEKA GKII+C T D T  I  ++ E K 
Sbjct  367  SKMYPLVLGEDVAINNTLVSDARQCIPGSLDPEKASGKIIVCITSDPT--IRTELAEAKG  424

Query  88   ANGVAVILVSP  56
               VA IL  P
Sbjct  425  LILVAEILEVP  435



>ref|XP_010266013.1| PREDICTED: CO(2)-response secreted protease-like [Nelumbo nucifera]
Length=780

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S +YPL    S KL +++  +AR+C P +LD  K KG+I+LC+          K+ EVK+
Sbjct  380  SPIYPLIYAESAKLNSSSDEDARNCNPDALDGAKIKGEIVLCQHSQRYYSKREKMEEVKS  439

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+ +IL+  D  +R +A   G FP ++
Sbjct  440  LGGIGLILI--DDLERAVAFTYGEFPMTV  466



>ref|XP_010536423.1| PREDICTED: CO(2)-response secreted protease-like [Tarenaya hassleriana]
Length=766

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            +PL  G S K  +A+  +AR C   +LD E  KGKI++CE  D T+Y    + EVK+  G
Sbjct  364  HPLIHGKSAKSTDASVDSARRCEFGTLDGETVKGKIVVCENADGTTYATNAMEEVKSKGG  423

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            +  + V  D   R +A   G FP ++
Sbjct  424  IGCVFV--DDRTRSVASTYGTFPTTV  447



>ref|XP_006846917.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
 gb|ERN08498.1| hypothetical protein AMTR_s00152p00071630 [Amborella trichopoda]
Length=784

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL  G +    ++++  A +C P SLD EK KGKI+LC+  D       K+  VK+
Sbjct  387  SPVYPLIYGGTAGSNSSSQDEASNCNPGSLDGEKIKGKIVLCQHTDQGYSKKEKMNGVKS  446

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
              G  V LV  D E+R +A     FP +
Sbjct  447  LGGFGVALV--DNEERYVAFDYDTFPAT  472



>ref|XP_008449184.1| PREDICTED: uncharacterized protein LOC103491134 [Cucumis melo]
Length=1511

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = -2

Query  262   VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
              YPL  G  VK  NAT   A  C   SLDP KAKGKI+LC   DS      K +EV+ A 
Sbjct  1121  FYPLVDGVQVKAGNATDKLALLCEDGSLDPAKAKGKIVLCLRGDSARMD--KSFEVRRAG  1178

Query  82    GVAVILVSPDPED  44
             G+ +ILV+ D ED
Sbjct  1179  GIGLILVN-DKED  1190



>ref|XP_011034984.1| PREDICTED: CO(2)-response secreted protease [Populus euphratica]
Length=762

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S ++PL  G S K  +AT+S AR+C P S+D E  KGKI+LC+  D +     K  EV++
Sbjct  364  SPIHPLIYGKSAKKTDATESEARNCNPDSMDGEMIKGKIVLCDNDDDSYSFYEKEGEVQS  423

Query  88   ANGVAVILV  62
              G+ ++LV
Sbjct  424  LGGIGLVLV  432



>ref|XP_009607188.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=792

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA G ++    +  S AR+C+P SLD ++  GKII+C   D T    +K   V++
Sbjct  387  SRTYPLAFGENIPFHPSLTSQARNCMPGSLDAKRVAGKIIVCMNDDWTISREIKKLVVQD  446

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            AN   +IL+  D  ++      G FP
Sbjct  447  ANAKGLILI--DEAEKRSPFDSGNFP  470



>ref|XP_006347851.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=774

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPLA G +V    +  S AR+C+P SLD +K  GKII+C     +    +K   V++AN 
Sbjct  383  YPLAFGENVHFHPSLTSQARNCMPGSLDAKKVAGKIIVCMNDGWSISRLIKKLVVQDANA  442

Query  79   VAVILVSPDPEDRIMALKLGGFP  11
              VIL+  D +++      G FP
Sbjct  443  KGVILI--DEQEKSSPFDSGNFP  463



>emb|CDP07365.1| unnamed protein product [Coffea canephora]
Length=762

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S +YPL  G S K   A+  + R C+P +LD +K KGKII+CE  D       K+  V +
Sbjct  366  SPIYPLIYGPSAKDSAASDDSGRTCIPGALDKDKVKGKIIVCENSDGEYSPKEKLQTVIS  425

Query  88   ANGVAVILVSPD  53
              G+ V+L+  D
Sbjct  426  QGGIGVVLIDDD  437



>ref|XP_003523384.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45944.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 2/89 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YP+  G S K  + + + AR C P SLD  K KGKI++C+ ++       KI  VK 
Sbjct  374  SAEYPMIYGESAKAASTSLAEARQCHPDSLDANKVKGKIVVCDGKNDGYSTSEKIGTVKE  433

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
            A G+ ++ ++   ++  +A   G FP ++
Sbjct  434  AGGIGLVHIT--DQNGAIASYYGDFPATV  460



>ref|XP_004231226.1| PREDICTED: CO(2)-response secreted protease-like [Solanum lycopersicum]
Length=772

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G +V    +  S AR+C+P SLD +K  GKII+C   + +    +K   V++AN 
Sbjct  381  YPLVFGENVYFHPSLTSQARNCMPGSLDAKKVAGKIIVCMNDNWSISRLIKKLVVQDANA  440

Query  79   VAVILVSPDPEDRIMALKLGGFP  11
              +IL+  D +D+      G FP
Sbjct  441  KGLILI--DEQDKSSPFDSGNFP  461



>gb|KHN09070.1| Subtilisin-like protease [Glycine soja]
Length=766

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G S K  + + + AR C P SLD  K KGKI++C+ ++       K+  VK   G
Sbjct  373  YPLIYGESAKANSTSLAEARQCHPNSLDGNKVKGKIVVCDDKNDKYSTRKKVATVKAVGG  432

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            + ++ ++   ++  +A   G FP ++
Sbjct  433  IGLVHIT--DQNEAIASNYGDFPATV  456



>gb|KHM99088.1| Subtilisin-like protease [Glycine soja]
Length=763

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL    + +L NAT  +A  C P +LDP K KG I++C  RD T+ +  + YE  NA  
Sbjct  366  YPLVHAVNARLPNATIEDAGLCKPGALDPRKIKGNILVCIRRDKTTSVA-QGYEAANAGA  424

Query  79   VAVILVS  59
            V V +V+
Sbjct  425  VGVFVVN  431



>ref|XP_003545192.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=787

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL    + +L NAT  +A  C P +LDP K KG I++C  RD T+ +  + YE  NA  
Sbjct  390  YPLVHAVNARLPNATIEDAGLCKPGALDPRKIKGNILVCIRRDKTTSVA-QGYEAANAGA  448

Query  79   VAVILVS  59
            V V +V+
Sbjct  449  VGVFVVN  455



>ref|XP_011003069.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=760

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCET-RDSTSYIGLKIYEVK  92
            S V+PL    S K   A + +AR+C P S+D +K KGKI++C+   D  SY   K+ EV+
Sbjct  367  SPVHPLIYAKSAKKAGADERDARNCYPDSMDGKKIKGKIVICDNDEDINSY--YKMNEVR  424

Query  91   NANGVAVILVS  59
            N  G+  +LVS
Sbjct  425  NLEGIGAVLVS  435



>ref|XP_009771512.1| PREDICTED: subtilisin-like protease, partial [Nicotiana sylvestris]
Length=453

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA G ++    +  S AR+C+P SLD ++  GKII+C   D T    +K   V++
Sbjct  47   SRTYPLAFGENIPFHPSLTSQARNCMPGSLDAKRVTGKIIVCMNDDWTISREIKKLVVQD  106

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A    +IL+  D  ++      G FP
Sbjct  107  AKAKGLILI--DEAEKSSPFDSGNFP  130



>ref|XP_004491111.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=791

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
             YP+      +  NAT  NAR C P +LDP K KGKI++C   + T+ +  + YE   A 
Sbjct  393  FYPMIHAIDARFPNATIQNARYCKPKTLDPAKVKGKILVCIRLEGTTSVA-QGYEASIAG  451

Query  82   GVAVILVSPDPEDRIMALKLGGFPGS  5
             VAV +++ +    I+  +    PG+
Sbjct  452  AVAVFVINDEKSGSILLAEPHPLPGA  477



>ref|XP_002307740.1| putative subtilisin precursor family protein [Populus trichocarpa]
 gb|EEE94736.1| putative subtilisin precursor family protein [Populus trichocarpa]
Length=769

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCET-RDSTSYIGLKIYEVK  92
            S V+PL    S K   A   +AR+C P S+D +K KGKI++C+   D  SY   K+ EV+
Sbjct  369  SPVHPLIYAKSAKKAGADARDARNCYPDSMDGKKIKGKIVICDNDEDINSY--YKMNEVR  426

Query  91   NANGVAVILVS  59
            N  G+  +LVS
Sbjct  427  NLEGIGAVLVS  437



>ref|XP_003523395.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN45942.1| Subtilisin-like protease [Glycine soja]
Length=769

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGL-KIYEVKNAN  83
            YP+  G S K + A    AR C P SLD  K KGKI++C+ +    YI + KI  VK A 
Sbjct  376  YPMVYGESAKAKRANLGTARKCHPNSLDRNKVKGKIVICDGKKDPKYITMEKINIVKAAG  435

Query  82   GVAVILVSPDPEDRIMALKLGGFPGS  5
            G+ +  ++   +D  +A     FP +
Sbjct  436  GIGLAHIT--DQDGSVAFNYVDFPAT  459



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G++ K  N++   A  C P +LDPEK +GKI++C TRD++     K  +V  A G
Sbjct  377  YPLIDGSNAKRPNSSAEEAGWCYPGTLDPEKVRGKIVVC-TRDTSFARVEKGVDVLKAGG  435

Query  79   VAVILVSPDPE  47
              +IL + D E
Sbjct  436  AGMILANSDEE  446



>gb|AAK53589.1|AF352059_1 subtilisin-like protein [Glycine max]
Length=766

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G S K  + +   AR C P SLD  K KGKI++C+ ++       K+  VK   G
Sbjct  373  YPLIYGESAKANSTSLVEARQCHPNSLDGNKVKGKIVVCDDKNDKYSTRKKVATVKAVGG  432

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            + ++ ++   ++  +A   G FP ++
Sbjct  433  IGLVHIT--DQNEAIASNYGDFPATV  456



>ref|NP_001236511.1| subtilisin-type protease precursor [Glycine max]
 gb|AAK53065.1| subtilisin-type protease precursor [Glycine max]
Length=766

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G S K  + +   AR C P SLD  K KGKI++C+ ++       K+  VK   G
Sbjct  373  YPLIYGESAKANSTSLVEARQCRPNSLDGNKVKGKIVVCDDKNDKYSTRKKVATVKAVGG  432

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            + ++ ++   ++  +A   G FP ++
Sbjct  433  IGLVHIT--DQNEAIASNYGDFPATV  456



>ref|XP_004232973.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=775

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   N TK  A  CLP SL PEKAKGKI++C  R + + +G K  EVK A 
Sbjct  387  MYPLVYAGEVINTNVTKDLAGQCLPGSLSPEKAKGKIVMC-LRGNGTRVG-KGGEVKRAG  444

Query  82   GVAVIL  65
            G+  IL
Sbjct  445  GIGYIL  450



>ref|XP_006355620.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=775

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   N TK  A  CLP SL PEKAKGKI++C  R + + +G K  EVK A 
Sbjct  387  MYPLVYAGEVINTNVTKDLAGQCLPGSLSPEKAKGKIVMC-LRGNGTRVG-KGGEVKRAG  444

Query  82   GVAVIL  65
            G+  IL
Sbjct  445  GIGYIL  450



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGL-----KIYEV  95
            YPL    + K  NA+ S+AR C+P SL+P K KGKI+ CE        GL     K + V
Sbjct  355  YPLIYSGNAKAANASVSHARFCVPGSLEPTKMKGKIVYCER-------GLIPDLQKSWVV  407

Query  94   KNANGVAVILVSPDPEDRI  38
              A GV +IL +  P + I
Sbjct  408  AQAGGVGMILANQFPTENI  426



>ref|XP_007141639.1| hypothetical protein PHAVU_008G213000g [Phaseolus vulgaris]
 gb|ESW13633.1| hypothetical protein PHAVU_008G213000g [Phaseolus vulgaris]
Length=783

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 45/85 (53%), Gaps = 1/85 (1%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            Y L   A+  L NAT ++AR C P +LD  K KG I++C  RD T+ +  + YE  NA  
Sbjct  389  YRLVHAANAGLPNATVNDARLCKPGTLDITKIKGNILICIRRDKTTSVA-QGYEAANAGA  447

Query  79   VAVILVSPDPEDRIMALKLGGFPGS  5
            V V +V+ D     +  +    PG+
Sbjct  448  VGVFVVNNDKSGNTLLAEPYTIPGA  472



>ref|WP_031170460.1| serine protease [Streptosporangium roseum]
Length=971

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -2

Query  256  PLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANGV  77
            PLAT  SVK   A+ S+A+ C   SLDP KA GKII C  R  T  +  K  EVK A GV
Sbjct  430  PLATSVSVKNAAASDSDAQICAEGSLDPAKAAGKIIYC-VRGVTPRVD-KSAEVKRAGGV  487

Query  76   AVILVSPDPED  44
             ++L +P  +D
Sbjct  488  GMVLGNPSDQD  498



>ref|XP_003608824.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES91021.1| subtilisin-like serine protease [Medicago truncatula]
Length=780

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILC-ETRDSTSYI--GLKIYEVK  92
            +YPL TGA VK +NA+  +A +C   +LDP+KAKGKI++C +  D   ++    K  E  
Sbjct  381  LYPLITGADVKYDNASSKDALNCEGGTLDPQKAKGKILVCFQVPDDCHFLCRTHKGVEAA  440

Query  91   NANGVAVILVSPDPE  47
                V +IL + D +
Sbjct  441  RVGAVGIILANSDKD  455



>ref|WP_012891725.1| serine protease [Streptosporangium roseum]
 ref|YP_003340731.1| serine protease [Streptosporangium roseum DSM 43021]
 gb|ACZ87988.1| serine protease [Streptosporangium roseum DSM 43021]
Length=971

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 2/71 (3%)
 Frame = -2

Query  256  PLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANGV  77
            PLAT  SVK   A+ S+A+ C   SLDP KA GK+I C  R  T  +  K  EVK A GV
Sbjct  430  PLATSVSVKNAAASDSDAQICAEGSLDPAKAAGKVIYC-VRGVTPRVD-KSAEVKRAGGV  487

Query  76   AVILVSPDPED  44
             ++L +P  +D
Sbjct  488  GMVLGNPSDQD  498



>ref|WP_033362075.1| hypothetical protein [Dactylosporangium aurantiacum]
Length=965

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = -2

Query  256  PLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANGV  77
            PL T  S KL  A+ ++AR C   +LDP K  GK+++C+ R   + I  K +EVK A GV
Sbjct  407  PLVTAVSAKLAGASDNDARLCFDGTLDPAKVTGKVVICD-RGVNARID-KSFEVKRAGGV  464

Query  76   AVILVSPDPE  47
             ++L +  P 
Sbjct  465  GMVLTNTSPN  474



>ref|XP_009391633.1| PREDICTED: subtilisin-like protease isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=775

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G +V  E+   S A +C P SLD +KA GKII+C   D T    +K    + 
Sbjct  380  SESYPLVFGGAVAAESTPISEASNCYPGSLDADKAAGKIIVCVDTDPTVTRRIKKLVAEG  439

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A    +ILV  D  +R +    G FP S
Sbjct  440  ARAKGLILV--DEAERGVPFDSGSFPFS  465



>ref|XP_009391632.1| PREDICTED: subtilisin-like protease isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=826

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G +V  E+   S A +C P SLD +KA GKII+C   D T    +K    + 
Sbjct  431  SESYPLVFGGAVAAESTPISEASNCYPGSLDADKAAGKIIVCVDTDPTVTRRIKKLVAEG  490

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A    +ILV  D  +R +    G FP S
Sbjct  491  ARAKGLILV--DEAERGVPFDSGSFPFS  516



>ref|XP_009604273.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=775

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   N TK  A  CLP SL P+KAKGKI++C  R + + +G K  EVK A 
Sbjct  387  MYPLVYAGQVINSNVTKDVAGQCLPGSLSPKKAKGKIVIC-LRGNGTRVG-KGGEVKRAG  444

Query  82   GVAVIL  65
            G+  IL
Sbjct  445  GIGYIL  450



>gb|EYU17578.1| hypothetical protein MIMGU_mgv1a0038491mg, partial [Erythranthe 
guttata]
Length=501

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATK--SNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            ST+YPL  G S KL +      +A +C+P SLD  K KGKI++CE  D +     K  ++
Sbjct  179  STMYPLIDGRSAKLSSNVNGDDDAGNCIPGSLDDSKVKGKIVVCENSDESYEPRDKFDDL  238

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFP  11
            +    + +I++  D  D   A+  G  P
Sbjct  239  QQQGAIGMIVIDNDENDLREAVAPGRDP  266



>ref|XP_007017870.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
 gb|EOY15095.1| Subtilisin-like serine endopeptidase family protein isoform 1 
[Theobroma cacao]
Length=735

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYP+    S       ++ +R C P S+D E  KGKI++C+ +D       K   VKN
Sbjct  336  SPVYPIIYAQSANKTGVDENESRSCNPDSMDQEIIKGKIVVCD-KDGPYSPSEKKDVVKN  394

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+ V+L+  D E R +A   G FP ++
Sbjct  395  LGGIGVVLI--DDESRAVASTFGTFPATV  421



>ref|XP_004514295.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=769

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            ST++PL  G  +  +    S AR+C P SLD  K  GKI++C   D      +K   +++
Sbjct  374  STMFPLVFGDEIAAKFTPTSEARNCYPGSLDYNKVAGKIVVCVNDDPNISRRIKKLVLQD  433

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A  + +ILV  D  +R ++   G FP
Sbjct  434  ARAMGMILV--DENNRDVSFDAGAFP  457



>ref|XP_007017871.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
 gb|EOY15096.1| Subtilisin-like serine endopeptidase family protein isoform 2 
[Theobroma cacao]
Length=761

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYP+    S       ++ +R C P S+D E  KGKI++C+ +D       K   VKN
Sbjct  362  SPVYPIIYAQSANKTGVDENESRSCNPDSMDQEIIKGKIVVCD-KDGPYSPSEKKDVVKN  420

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              G+ V+L+  D E R +A   G FP ++
Sbjct  421  LGGIGVVLI--DDESRAVASTFGTFPATV  447



>ref|XP_007213640.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
 gb|EMJ14839.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
Length=779

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            + +YPL   A V      K  A  CLP SL PEK KGKI+LC  R S   IG K  EVK 
Sbjct  387  NNMYPLVYAADVINTGVPKDMAGQCLPGSLSPEKVKGKIVLC-MRGSGLRIG-KGMEVKR  444

Query  88   ANGVAVIL  65
            A GV  IL
Sbjct  445  AGGVGFIL  452



>ref|XP_008225402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=780

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            + +YPL   A V      K  A  CLP SL PEK KGKI+LC  R S   +G K  EVK 
Sbjct  388  NNMYPLVYAADVINTGVPKDMAGQCLPGSLSPEKVKGKIVLC-MRGSGVRVG-KGMEVKR  445

Query  88   ANGVAVIL  65
            A GV  IL
Sbjct  446  AGGVGFIL  453



>ref|XP_006435228.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
 gb|ESR48468.1| hypothetical protein CICLE_v10000339mg [Citrus clementina]
Length=787

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S K ++A ++ AR+C   SL     KGKI+LC+  D    +  K   VK+
Sbjct  384  SPVYPLIYAKSAKKDDANENAARNCDLDSLAGALVKGKIVLCDNDDDMGSVVDKKDGVKS  443

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              GV VI++  D + R +A   G FP
Sbjct  444  LGGVGVIVI--DDQSRAVASSYGTFP  467



>ref|XP_009360803.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 35/65 (54%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL   A V      K  A  CLP SL PEK KGKI+LC  R S   +G K  EVK A G
Sbjct  390  YPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLC-MRGSGMRVG-KGMEVKRAGG  447

Query  79   VAVIL  65
            V  IL
Sbjct  448  VGFIL  452



>gb|KDO84930.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=773

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S K ++A ++ AR+C   SL     KGKI+LC+  D    +  K   VK+
Sbjct  370  SPVYPLIYAKSAKKDDANENAARNCDLDSLAGALVKGKIVLCDNDDDMGSVVDKKDGVKS  429

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              GV VI++  D + R +A   G FP
Sbjct  430  LGGVGVIVI--DDQSRAVASSYGTFP  453



>gb|KDO84931.1| hypothetical protein CISIN_1g004113mg [Citrus sinensis]
Length=606

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S K ++A ++ AR+C   SL     KGKI+LC+  D    +  K   VK+
Sbjct  203  SPVYPLIYAKSAKKDDANENAARNCDLDSLAGALVKGKIVLCDNDDDMGSVVDKKDGVKS  262

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              GV VI++  D + R +A   G FP
Sbjct  263  LGGVGVIVI--DDQSRAVASSYGTFP  286



>ref|XP_011096454.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=686

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL   A V   +   + +  CLP SL PEKAKGKI+LC  R + + +G K  EVK A 
Sbjct  297  LYPLVYAAQVTNSDVPNNISGQCLPGSLSPEKAKGKIVLC-LRGNGTRVG-KGMEVKRAG  354

Query  82   GVAVIL  65
            G+  IL
Sbjct  355  GIGFIL  360



>ref|XP_010095549.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB60669.1| Subtilisin-like protease [Morus notabilis]
Length=669

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 11/93 (12%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYE---  98
            S VYPL    S K  +A  ++A +C   SL+    KGKI++CE  D     G  +Y+   
Sbjct  272  SPVYPLVHAKSTKKSDADDNSASNCQGDSLEENAVKGKIVVCERTD-----GYSVYDKRD  326

Query  97   -VKNANGVAVILVSPDPEDRIMALKLGGFPGSI  2
             VK+  G+ V++V  D E R +A     FP ++
Sbjct  327  TVKSLGGLGVVIV--DDESRAVAENYKSFPATV  357



>ref|XP_002510578.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52765.1| Cucumisin precursor, putative [Ricinus communis]
Length=578

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            ++PL    + K  N  + +AR+C P S+D +  KGKI+ C+  D       K  EV+   
Sbjct  179  LHPLIYAKAAKTANGDEDDARNCRPDSMDKDMIKGKIVFCDNEDGELSENQKKEEVQKLG  238

Query  82   GVAVILVSPDPEDRIMALKLGGFP  11
            G+ ++LV  D + R +A     FP
Sbjct  239  GIGLVLV--DDKTRAVAASYKEFP  260



>ref|XP_011102178.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=787

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL   A V   +   + +  CLP SL PEKAKGKI+LC  R + + +G K  EVK A 
Sbjct  398  LYPLVYAAQVTNSDVPNNISGQCLPGSLSPEKAKGKIVLC-LRGNGTRVG-KGMEVKRAG  455

Query  82   GVAVIL  65
            G+  IL
Sbjct  456  GIGFIL  461



>ref|XP_011085840.1| PREDICTED: CO(2)-response secreted protease-like [Sesamum indicum]
Length=767

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (51%), Gaps = 2/83 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPLA G  V       S+AR+C+P SLDP+K  GKII+C   +      +K   V++A  
Sbjct  375  YPLAFGEEVAANFTPASDARNCIPGSLDPKKVAGKIIVCMNDEPNVSRRIKKLVVEDAKA  434

Query  79   VAVILVSPDPEDRIMALKLGGFP  11
              VI++  D E        G +P
Sbjct  435  EGVIII--DGERETSPFDSGTYP  455



>ref|XP_004308419.1| PREDICTED: xylem serine proteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCE  140
            +YPL +G  V   + TK NAR CL  SLDP++ KGKI+ C+
Sbjct  364  LYPLVSGVDVAQSSETKENARFCLGGSLDPKRVKGKIVFCQ  404



>ref|XP_009803454.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=776

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   N TK  A  CLP SL P+KAKGKI++C  R + + +G K  EVK A 
Sbjct  388  MYPLVYAGQVINSNVTKDVAGQCLPGSLLPKKAKGKIVIC-LRGNGTRVG-KGGEVKRAG  445

Query  82   GVAVIL  65
            G+  IL
Sbjct  446  GIGYIL  451



>ref|XP_003603196.1| Subtilisin-type protease [Medicago truncatula]
 gb|AES73447.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL TG S K   A  + A  C P SLD +K +G I++C+  D       KI  V+ A G
Sbjct  369  YPLITGKSAKTTTADLTEASQCHPSSLDKKKVEGNIVICDGVDGDYSTDEKIRTVQEAGG  428

Query  79   VAVILVSPDPEDRIMALKLGGFPGSI  2
            + ++ ++   +D  +A     FP ++
Sbjct  429  LGLVHIT--DQDGAVANIYADFPATV  452



>ref|XP_008776598.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=770

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  +PL  GA V  E+   S A +C P SLD EKA GKIILC   D T    +K    + 
Sbjct  375  SESFPLVFGADVAAESTPVSEASNCYPGSLDTEKAAGKIILCVDSDPTVTRRVKKLVAEG  434

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A    +IL+  D  ++ +    G +P S
Sbjct  435  ARAKGLILI--DEAEKGVPFDSGSYPFS  460



>ref|XP_002303965.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
 gb|EEE78944.2| hypothetical protein POPTR_0003s18830g [Populus trichocarpa]
Length=646

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 2/83 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPLA G  V  +    S AR+C P SLD +K  GKI++C   D      +K   V++A  
Sbjct  254  YPLAFGEDVAAKFTPISEARNCYPGSLDTQKVAGKIVVCTDDDLNIPRQIKKLVVEDARA  313

Query  79   VAVILVSPDPEDRIMALKLGGFP  11
              +ILVS D  + ++    G FP
Sbjct  314  KGLILVSED--ETVVPFDSGTFP  334



>ref|XP_006432515.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45755.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=779

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YP+A G  +  +    S AR C P SLDP+K  GKII+C   D T    +K    ++
Sbjct  382  SMTYPIAFGKDIAAKFTPVSEARTCRPGSLDPKKVAGKIIVCVDDDPTVPRKIKKLVAED  441

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A+   +IL+  D E  +     G FP S
Sbjct  442  ADAKGLILIDEDYEKHV-PFDSGIFPFS  468



>ref|XP_006432516.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
 gb|ESR45756.1| hypothetical protein CICLE_v10000349mg [Citrus clementina]
Length=780

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YP+A G  +  +    S AR C P SLDP+K  GKII+C   D T    +K    ++
Sbjct  383  SMTYPIAFGKDIAAKFTPVSEARTCRPGSLDPKKVAGKIIVCVDDDPTVPRKIKKLVAED  442

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A+   +IL+  D E  +     G FP S
Sbjct  443  ADAKGLILIDEDYEKHV-PFDSGIFPFS  469



>ref|XP_006471277.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=806

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YP+A G  +  +    S AR C P SLDP+K  GKII+C   D T    +K    ++
Sbjct  409  SMTYPIAFGKDIAAKFTPVSEARTCRPGSLDPKKVAGKIIVCVDDDPTVPRKIKKLVAED  468

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGS  5
            A+   +IL+  D E  +     G FP S
Sbjct  469  ADAKGLILIDEDYEKHV-PFDSGIFPFS  495



>ref|XP_011020517.1| PREDICTED: CO(2)-response secreted protease-like [Populus euphratica]
Length=788

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPLA G  V  +    S AR+C P SLD +K +GKI++C   D      +K   V++A  
Sbjct  396  YPLAFGEDVAAKFTPISEARNCYPGSLDTQKVEGKIVVCTDNDLNIPRQIKKLVVEDARA  455

Query  79   VAVILVSPDPEDRIMALKLGGFP  11
              +IL+S D  + ++    G FP
Sbjct  456  KGLILLSED--ETVVPFDSGTFP  476



>gb|KEH19205.1| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            ST++ L  G  V  E A  S AR+C P SLD  K  G+I++C   D      +K   V++
Sbjct  371  STMHSLVFGEEVAAEFAPTSEARNCYPGSLDYNKIAGRIVVCVDDDPNISRKIKKLVVQD  430

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A  + +I VS + +D  ++   G FP
Sbjct  431  ARAMGMIFVSENNKD--VSFDAGAFP  454



>emb|CDP18817.1| unnamed protein product [Coffea canephora]
Length=771

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA G +V     + S+AR+C P SLD  K  GKI++C   + T    +K   V++
Sbjct  376  SKAYPLAFGENVAARFVSPSDARNCAPGSLDRIKVAGKIVICLNDNPTISRMIKKLVVED  435

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A    +IL+  D E R   L  G FP
Sbjct  436  AKAKGLILI--DEEKRSSLLDSGIFP  459



>gb|KEH19203.1| subtilisin-like serine protease [Medicago truncatula]
Length=636

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            ST++ L  G  V  +  TKS AR+C P SLD +K  GKI++C   D      +K   +++
Sbjct  244  STMFSLVFGEDVAAKKTTKSEARNCYPGSLDNKKVAGKIVICANDDQNLTRKMKKLILQD  303

Query  88   ANGVAVILVSPDPED  44
            A  + +IL+  +  D
Sbjct  304  AGAMGMILIEKEHLD  318



>gb|KEH19202.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            ST++ L  G  V  +  TKS AR+C P SLD +K  GKI++C   D      +K   +++
Sbjct  368  STMFSLVFGEDVAAKKTTKSEARNCYPGSLDNKKVAGKIVICANDDQNLTRKMKKLILQD  427

Query  88   ANGVAVILVSPDPED  44
            A  + +IL+  +  D
Sbjct  428  AGAMGMILIEKEHLD  442



>ref|XP_006398245.1| hypothetical protein EUTSA_v100011270mg, partial [Eutrema salsugineum]
 gb|ESQ39698.1| hypothetical protein EUTSA_v100011270mg, partial [Eutrema salsugineum]
Length=512

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 10/78 (13%)
 Frame = -2

Query  256  PLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANGV  77
            PL   A V +   ++  A  CLP SL PE  +GK++LC  R   S IG K  EVK A GV
Sbjct  393  PLVYAADVVVPGISRKYASQCLPNSLSPELVRGKVVLC-LRGHGSRIG-KSLEVKRAGGV  450

Query  76   AVIL--------VSPDPE  47
             +IL        + PDP 
Sbjct  451  GMILGNSRVNDVIQPDPH  468



>gb|KDP28708.1| hypothetical protein JCGZ_14479 [Jatropha curcas]
Length=746

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETR  134
            +YPL +GA V   +A K NAR CL  S++P K KGK++ CE +
Sbjct  364  LYPLVSGADVARNSANKDNARFCLDGSMEPSKVKGKLVYCELQ  406



>dbj|BAJ53130.1| JHL05D22.1 [Jatropha curcas]
Length=743

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETR  134
            +YPL +GA V   +A K NAR CL  S++P K KGK++ CE +
Sbjct  361  LYPLVSGADVARNSANKDNARFCLDGSMEPSKVKGKLVYCELQ  403



>ref|XP_010091321.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB44295.1| Subtilisin-like protease [Morus notabilis]
Length=919

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G  V       S AR+C P SLDP+K  GKI++C   D +    +K   V++
Sbjct  347  SKAYPLVFGKDVTANFTPASEARNCYPGSLDPKKVAGKIVVCANDDPSVTRRIKKLVVED  406

Query  88   ANGVAVILVSPD  53
            A    +IL+  D
Sbjct  407  AKAKGMILIDED  418



>ref|XP_003603806.1| Subtilisin-like serine protease [Medicago truncatula]
Length=641

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL TG +VK   A  + AR C P SLD  K KGKI++C+  D    I  KI   +   G
Sbjct  373  YPLVTGEAVKTTTADLAEARMCHPNSLDTNKVKGKIVICDGIDDGYTIYDKIKMAQEMGG  432

Query  79   VAVILV  62
            + ++ +
Sbjct  433  LGLVHI  438



>gb|KEH19206.1| subtilisin-like serine protease [Medicago truncatula]
Length=671

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            ST++ L  G  V  E A  S AR+C P SLD  K  G+I++C   D      +K   V++
Sbjct  371  STMHSLVFGEEVAAEFAPTSEARNCYPGSLDYNKIAGRIVVCVDDDPNISRKIKKLVVQD  430

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A  + +I VS + +D  ++   G FP
Sbjct  431  ARAMGMIFVSENNKD--VSFDAGAFP  454



>gb|AES74057.2| subtilisin-like serine protease [Medicago truncatula]
Length=581

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 0/66 (0%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL TG +VK   A  + AR C P SLD  K KGKI++C+  D    I  KI   +   G
Sbjct  373  YPLVTGEAVKTTTADLAEARMCHPNSLDTNKVKGKIVICDGIDDGYTIYDKIKMAQEMGG  432

Query  79   VAVILV  62
            + ++ +
Sbjct  433  LGLVHI  438



>ref|XP_008371534.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=780

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 35/65 (54%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL   A V      K  A  CLP SL PEK KGKI+LC  R S   + +K  EVK A G
Sbjct  391  YPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLC-MRGSGMRV-VKGMEVKRAGG  448

Query  79   VAVIL  65
            V  IL
Sbjct  449  VGFIL  453



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 35/65 (54%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL   A V      K  A  CLP SL PEK KGKI+LC  R S   + +K  EVK A G
Sbjct  392  YPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGKIVLC-MRGSGMRV-VKGMEVKRAGG  449

Query  79   VAVIL  65
            V  IL
Sbjct  450  VGFIL  454



>ref|XP_008383532.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=778

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL   A V      K  A  CLP SL PEK KG I+LC  R S   +G K  EVK A G
Sbjct  390  YPLVYAADVINSGVPKDMAGQCLPGSLSPEKVKGNIVLC-MRGSGMRVG-KGMEVKRAGG  447

Query  79   VAVIL  65
            V  IL
Sbjct  448  VGFIL  452



>gb|KGN64982.1| hypothetical protein Csa_1G171040 [Cucumis sativus]
Length=757

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDS  128
            +YPL TGA  K +NAT   AR C P +LD  K KGKI++C   D+
Sbjct  366  LYPLITGAEAKAKNATAEEARLCKPKTLDHSKVKGKILVCLRGDT  410



>ref|XP_004251819.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=772

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSY  119
            +P+ TGAS K+ NAT   A  C+  +LDP+KAKG I++C    S ++
Sbjct  381  FPIITGASAKVANATAEEANFCIEGTLDPKKAKGTILVCHRGGSAAF  427



>emb|CDP14561.1| unnamed protein product [Coffea canephora]
Length=532

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   N TK     C+P SL PE AKGKI+ C  R + + +G K  EVK A 
Sbjct  386  LYPLVRAGQVVNPNVTKDLLDQCMPGSLSPEMAKGKIVFC-LRGNGTRVG-KGAEVKRAG  443

Query  82   GVAVIL  65
            GV  IL
Sbjct  444  GVGYIL  449



>ref|XP_004139597.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=751

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDS  128
            +YPL TGA  K +NAT   AR C P +LD  K KGKI++C   D+
Sbjct  360  LYPLITGAEAKAKNATAEEARLCKPKTLDHSKVKGKILVCLRGDT  404



>ref|XP_004308189.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 40/86 (47%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G          S A +C P S DP+K  GKI++C   D T    +K   V +
Sbjct  375  SRTYPLVFGKDAAANFTPVSEASNCYPGSFDPKKVAGKIVVCVADDQTVSRKIKKLVVDD  434

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A    +IL+  D E++ +    G FP
Sbjct  435  AKAKGLILI--DEEEKTVPFDSGVFP  458



>ref|XP_011039898.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=794

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL  GA   L  AT  +A+ CL  +LDP K  GKIILC    S      K YE + A 
Sbjct  406  LYPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKIILCLRGQSPRLP--KGYEAERAG  463

Query  82   GVAVILVS  59
             V ++LV+
Sbjct  464  AVGMVLVN  471



>ref|XP_010095116.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB58282.1| Subtilisin-like protease [Morus notabilis]
Length=784

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPLA    +      + NA  CLP SL P+K KGKI+LC  R + S +G K   VK+A 
Sbjct  392  MYPLAYATDLAEPGVLRDNASLCLPDSLSPKKTKGKIVLC-MRGNNSRVG-KGLVVKSAG  449

Query  82   GVAVILVS  59
            GV  IL +
Sbjct  450  GVGFILAN  457



>ref|XP_010665649.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=780

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL     + + N T+  +  CLP SL  EKA GKI+ C  R + + +G K  EVK A G
Sbjct  392  YPLVYAGEITIPNVTRELSGQCLPNSLSSEKANGKIVFC-FRGNGTRVG-KGMEVKRAGG  449

Query  79   VAVIL  65
            +  IL
Sbjct  450  IGYIL  454



>ref|XP_006843321.1| hypothetical protein AMTR_s00910p00007910, partial [Amborella 
trichopoda]
 gb|ERN04996.1| hypothetical protein AMTR_s00910p00007910, partial [Amborella 
trichopoda]
Length=321

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  259  YPLATGASV--KLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNA  86
            YPL +GA +     N +  NAR+CL  SLDP K KGKI+ C   D+      K   VK A
Sbjct  181  YPLISGADILNPRSNFSLLNARNCLIGSLDPTKTKGKIVACLRGDNARV--EKGEAVKQA  238

Query  85   NGVAVILVS-PDPEDRIMA  32
             G+ +IL + PD  + ++A
Sbjct  239  GGIGMILCNDPDSGNEVIA  257



>ref|XP_008221224.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            STVYPL    S     A K +AR+C   S+  EK KGK+++C+T D       +I  VK+
Sbjct  384  STVYPLIYAGS-----AGKGDARNCDANSMAAEKIKGKVVMCDTNDDNYSRNEQIDAVKS  438

Query  88   ANGVAVILVSPDP  50
              GV +I    +P
Sbjct  439  LGGVGIIFQEKNP  451



>gb|AAF79898.1|AC022472_7 Contains similarity to p69c gene from Lycopersicon esculentum 
gb|Y17277 and is a member of subtilase family PF|00082 [Arabidopsis 
thaliana]
Length=779

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            +  YPL    S K  +A +  AR+C P +LD    KGKI++C++      I  K  EVK 
Sbjct  370  TQAYPLIHARSAKKIDANEEAARNCAPDTLDQTIVKGKIVVCDSDLDNQVIQWKSDEVKR  429

Query  88   ANGVAVILVSPDPED  44
              G+ ++LV  +  D
Sbjct  430  LGGIGMVLVDDESMD  444



>ref|NP_564106.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AEE29944.1| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=780

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            +  YPL    S K  +A +  AR+C P +LD    KGKI++C++      I  K  EVK 
Sbjct  371  TQAYPLIHARSAKKIDANEEAARNCAPDTLDQTIVKGKIVVCDSDLDNQVIQWKSDEVKR  430

Query  88   ANGVAVILVSPDPED  44
              G+ ++LV  +  D
Sbjct  431  LGGIGMVLVDDESMD  445



>ref|XP_004500923.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=768

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL  G S K  ++    AR C   SLD  K KGKI++C+  D  +    K   V+   G
Sbjct  375  YPLVYGYSAKTSSSDLDEARQCYENSLDETKVKGKIVVCDGIDDYNLAFNKTNTVQKVGG  434

Query  79   VAVILVSPDPEDRIMALKLGGFPGS  5
            + +I ++   +D   A+  G FP +
Sbjct  435  IGIIHIT--DQDGGDAIYYGDFPST  457



>ref|XP_011074702.1| PREDICTED: CO(2)-response secreted protease-like isoform X2 [Sesamum 
indicum]
Length=733

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATK--SNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL  G S K E++ +   +AR+C P SLD +K K KI+LCE +       +K   +
Sbjct  330  SPVYPLIDGLSAKSESSQQGDDDARNCNPGSLDGDKVKEKIVLCENKVRPFGTTIKYETL  389

Query  94   KNANGVAVILVSPD  53
            K+   + ++L+  D
Sbjct  390  KDQGAIGMVLIDDD  403



>ref|XP_006398487.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
 gb|ESQ39940.1| hypothetical protein EUTSA_v10001201mg [Eutrema salsugineum]
Length=763

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +Y L TGA  KL NA+  +A  C   +LDP KAKGKI++C  R  TS +G K  +   A 
Sbjct  375  MYSLITGAQAKLANASAVDAMLCKEGTLDPHKAKGKIMVC-LRGDTSRVG-KGRQAALAG  432

Query  82   GVAVIL  65
             VA+IL
Sbjct  433  AVAMIL  438



>ref|XP_006471314.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=775

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA G ++ + +   S AR C   S+DP+K  GKI++C   D     G KI   +N
Sbjct  379  SKTYPLAYGKAIAVNSTLVSQARSCRLGSIDPKKVAGKILVCIHTDPMDTRGRKIAVAEN  438

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
                 +I ++ D  ++I   + G  P
Sbjct  439  VEAQGLIFINDD--EKIWPTERGILP  462



>ref|XP_011074701.1| PREDICTED: CO(2)-response secreted protease-like isoform X1 [Sesamum 
indicum]
Length=762

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = -2

Query  268  STVYPLATGASVKLENATK--SNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEV  95
            S VYPL  G S K E++ +   +AR+C P SLD +K K KI+LCE +       +K   +
Sbjct  359  SPVYPLIDGLSAKSESSQQGDDDARNCNPGSLDGDKVKEKIVLCENKVRPFGTTIKYETL  418

Query  94   KNANGVAVILVSPD  53
            K+   + ++L+  D
Sbjct  419  KDQGAIGMVLIDDD  432



>ref|XP_008232921.1| PREDICTED: xylem serine proteinase 1 [Prunus mume]
Length=751

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCE  140
            +YPL +G  V   + TK +AR CL  SLDP K KGK++LC+
Sbjct  370  LYPLVSGVDVARNSQTKESARFCLQDSLDPNKVKGKLVLCK  410



>ref|XP_006350127.1| PREDICTED: subtilisin-like protease-like, partial [Solanum tuberosum]
Length=760

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSY  119
            +P+ TGAS K+ NAT   A  C+  +LDP+KAKG I++C    S ++
Sbjct  369  FPIITGASAKVANATAEEANFCIEGTLDPKKAKGTILVCHRGGSPAF  415



>ref|XP_006432517.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
 gb|ESR45757.1| hypothetical protein CICLE_v10003851mg [Citrus clementina]
Length=714

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 43/86 (50%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA G ++ + +   S AR C   S+DP+K  GKI++C   D     G KI   +N
Sbjct  318  SKTYPLAYGKAIAVNSTLVSQARSCRLGSIDPKKVAGKILVCIHTDPMDTRGRKIAVAEN  377

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
                 +I ++ D  ++I   + G  P
Sbjct  378  VEAQGLIFINDD--EKIWPTERGILP  401



>gb|KDO77989.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=341

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  199  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  253

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  254  RAGGVGLIL  262



>ref|XP_010273518.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=779

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL       +     S A  CLP SL PEK KGKI+LC  R  T  +G K  EV+ A 
Sbjct  388  MYPLVYAGDAVVPGVNNSVADQCLPGSLSPEKVKGKIVLCLRRLGTR-VG-KGLEVRRAG  445

Query  82   GVAVIL  65
            G A+ L
Sbjct  446  GAAIFL  451



>gb|KDO77991.1| hypothetical protein CISIN_1g0040471mg [Citrus sinensis]
Length=557

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  169  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  223

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  224  RAGGVGLIL  232



>ref|XP_006449588.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 ref|XP_006449589.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62828.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62829.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=557

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  169  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  223

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  224  RAGGVGLIL  232



>gb|KDO77986.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
 gb|KDO77987.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=587

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  199  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  253

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  254  RAGGVGLIL  262



>ref|NP_001175897.1| Os09g0482660 [Oryza sativa Japonica Group]
 dbj|BAH94625.1| Os09g0482660, partial [Oryza sativa Japonica Group]
Length=523

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -2

Query  259  YPLATGASVKLENATKS-NARDCLPMSLDPEKAKGKIILC-ETRDSTSYIGLKIYEVKNA  86
            YPL TG S K  + + + +A  C P +LD  K KGKI+LC  +R+S +    K+ E+K+A
Sbjct  121  YPLITGESAKSSSVSDTESASHCEPGTLDASKIKGKIVLCHHSRNSDTPKTEKVGELKSA  180

Query  85   NGVAVILVSPDPEDRIMALKLGGFP  11
              V  +LV  D  ++ +A     FP
Sbjct  181  GAVGAVLV--DDLEKAVATAYIDFP  203



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = -2

Query  259  YPLATGASVKLENATKSN-ARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            YPL TGA+ K  + + ++ A  C P +LD  K +GKI+LC    S +   +K  E+++A 
Sbjct  409  YPLITGAAAKSSSVSDTDSASHCEPGTLDSSKIRGKIVLCHHSQSDTSKLVKADELQSAG  468

Query  82   GVAVILVSPDPEDRIMALKLGGFP  11
                ILV  D E  +    L  FP
Sbjct  469  AAGCILVMNDNESSVATAYL-DFP  491



>ref|XP_007028364.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY08866.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=762

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILC  143
            S  YPLA G  +  + +  S AR C P SLDPE+ KGK+I+C
Sbjct  372  SETYPLAYGKDIAAKFSPISEARSCYPGSLDPERVKGKVIIC  413



>ref|XP_006467568.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=777

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  389  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  443

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  444  RAGGVGLIL  452



>gb|EYU28144.1| hypothetical protein MIMGU_mgv1a001682mg [Erythranthe guttata]
Length=773

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL     V   +  K+ +  CLP SL P KAKGKI+LC  R + + +G K  EVK A 
Sbjct  388  LYPLVYAGQVINPDVQKNLSGQCLPGSLSPSKAKGKIVLC-LRGNGTRVG-KGMEVKRAG  445

Query  82   GVAVIL  65
            G+  IL
Sbjct  446  GIGFIL  451



>ref|XP_006449587.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62827.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=777

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  389  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  443

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  444  RAGGVGLIL  452



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 4/85 (5%)
 Frame = -2

Query  259  YPLATGASVKLENATKS-NARDCLPMSLDPEKAKGKIILC-ETRDSTSYIGLKIYEVKNA  86
            YPL TG S K  + + + +A  C P +LD  K KGKI+LC  +R+S +    K+ E+K+A
Sbjct  408  YPLITGESAKSSSVSDTESASHCEPGTLDASKIKGKIVLCHHSRNSDTPKTEKVGELKSA  467

Query  85   NGVAVILVSPDPEDRIMALKLGGFP  11
              V  +LV  D  ++ +A     FP
Sbjct  468  GAVGAVLV--DDLEKAVATAYIDFP  490



>gb|KDO77988.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=418

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKI---YEVK  92
            ++PL   A V +    ++    CLP SL PEK KGKI+LC  R S    G K+    EVK
Sbjct  199  MHPLVYAADVVVPGVHQNETNQCLPGSLTPEKVKGKIVLC-MRGS----GFKLSKGMEVK  253

Query  91   NANGVAVIL  65
             A GV +IL
Sbjct  254  RAGGVGLIL  262



>ref|XP_008445401.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=745

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPL  G     +    S AR+C P SLD  K  GKI++C + D ++   +K   V++
Sbjct  350  SKTYPLVFGKDAAAKFTPTSEARNCYPGSLDRSKVAGKIVVCASDDFSTSRTIKELVVQD  409

Query  88   ANGVAVILVS  59
            A  V +IL++
Sbjct  410  AKAVGLILIN  419



>ref|XP_006279865.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
 gb|EOA12763.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
Length=796

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
 Frame = -2

Query  256  PLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCET--RDSTSYIGLKIYEVKNAN  83
            PL     V +   T+  A  C+P SL P+ A+GK+ILC      S S IG  I EVK A 
Sbjct  394  PLVNSLDVAVPGCTREEASQCVPNSLSPDLARGKVILCMRGFGSSRSTIGKSI-EVKRAG  452

Query  82   GVAVILVSPDPED  44
            GV +IL +    D
Sbjct  453  GVGMILANSRAGD  465



>ref|XP_007136109.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
 gb|ESW08103.1| hypothetical protein PHAVU_009G018600g [Phaseolus vulgaris]
Length=768

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 42/86 (49%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  Y L  G + K  NA+ + A  C P SLD  K KGKI+LC+ R+        I  VK 
Sbjct  372  SAQYSLVFGETSKASNASLAEASQCQPDSLDGNKVKGKIVLCDGRNDEYSTSEIIDTVKA  431

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
              G+ ++ ++   E   +A   G FP
Sbjct  432  VGGIGLVHIT--DEYGAIASYYGDFP  455



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 43/85 (51%), Gaps = 3/85 (4%)
 Frame = -2

Query  259  YPLATGASVKLENA--TKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNA  86
            YPL TGA+ K  +   T S +  C P +LD  K +GKI+LC    S +   +K  E+++A
Sbjct  409  YPLITGAAAKSSSVSDTDSASSHCEPGTLDSSKIRGKIVLCHHSQSDTSKLVKADELQSA  468

Query  85   NGVAVILVSPDPEDRIMALKLGGFP  11
                 ILV  D E  +    L  FP
Sbjct  469  GAAGCILVMNDNESSVATAYL-DFP  492



>ref|XP_002299063.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
 gb|EEE83868.2| hypothetical protein POPTR_0001s47290g [Populus trichocarpa]
Length=786

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 2/68 (3%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNAN  83
            +YPL  GA   L  AT  +A+ CL  +LDP K  GKIILC    S      K YE + A 
Sbjct  392  LYPLINGAEAALAEATPRDAQLCLDGTLDPNKVSGKIILCLRGQSPRLP--KGYEAERAG  449

Query  82   GVAVILVS  59
             V +IL +
Sbjct  450  AVGMILAN  457



>ref|XP_008357123.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=794

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S VYPL    S +  +  + +AR C   S++ EK KGKI+LC++ D   +   +I  V +
Sbjct  399  SPVYPLIYALSARKADGNEHSARYCEEDSMEAEKIKGKIVLCDSGD--YWRSSQIDAVTS  456

Query  88   ANGVAVILVSPDPEDRIMALKLGGFPGSI  2
              GV VI    +P   ++A   G FP ++
Sbjct  457  LGGVGVIFQVENPG--VVASTYGEFPATV  483



>ref|XP_002306266.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
 gb|EEE93262.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
Length=759

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 35/65 (54%), Gaps = 2/65 (3%)
 Frame = -2

Query  259  YPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKNANG  80
            YPL     VK  N +   A+ CL  SLDP K KGKI+ C TRD   + G K   V  + G
Sbjct  370  YPLINSVDVKAANVSSHLAKHCLVGSLDPVKVKGKIVYC-TRDEV-FDGEKSLVVAQSGG  427

Query  79   VAVIL  65
            V +IL
Sbjct  428  VGMIL  432



>ref|XP_008384293.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=775

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILC  143
             YPL TGA  K +NA+  +A  CL  SLDP+K KGKI+ C
Sbjct  380  FYPLITGAQAKADNASAKDAMLCLGGSLDPKKVKGKILAC  419



>gb|EEE69927.1| hypothetical protein OsJ_29791 [Oryza sativa Japonica Group]
Length=468

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKS-NARDCLPMSLDPEKAKGKIILC-ETRDSTSYIGLKIYEV  95
            S  YPL TG S K  + + + +A  C P +LD  K KGKI+LC  +R+S +    K+ E+
Sbjct  360  SPKYPLITGESAKSSSVSDTESASHCEPGTLDASKIKGKIVLCHHSRNSDTPKTEKVGEL  419

Query  94   KNANGVAVILVSPDPEDRIMALKLGGFP  11
            K+A  V  +LV  D  ++ +A     FP
Sbjct  420  KSAGAVGAVLV--DDLEKAVATAYIDFP  445



>ref|XP_002273703.1| PREDICTED: CO(2)-response secreted protease [Vitis vinifera]
 emb|CBI29159.3| unnamed protein product [Vitis vinifera]
Length=777

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S  YPLA    V       S+AR C P SLDP+K +GKII+C + D ++   ++   V++
Sbjct  383  SKTYPLARSEDVAAAFTPSSDARSCYPGSLDPKKVRGKIIVC-SGDGSNPRRIQKLVVED  441

Query  88   ANGVAVILV  62
            A  + +IL+
Sbjct  442  AKAIGMILI  450



>ref|XP_003545787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 42/86 (49%), Gaps = 2/86 (2%)
 Frame = -2

Query  268  STVYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILCETRDSTSYIGLKIYEVKN  89
            S ++ L  G  V  +    S AR+C P SLD  K  G I++C   D T    +K   V++
Sbjct  381  SKMHRLVFGEQVAAKFVPASEARNCFPGSLDFNKTAGSIVVCVNDDPTVSRQIKKLVVQD  440

Query  88   ANGVAVILVSPDPEDRIMALKLGGFP  11
            A  + +IL++ D +D       G FP
Sbjct  441  ARAIGIILINEDNKD--APFDAGAFP  464



>ref|XP_011005797.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=773

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -2

Query  262  VYPLATGASVKLENATKSNARDCLPMSLDPEKAKGKIILC  143
             YPL TG   K  NA+ ++A  C P SLD EKAKGK+++C
Sbjct  380  FYPLITGEQAKAANASTADALLCKPKSLDHEKAKGKVVVC  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515610070954