BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c51365_g1_i1 len=115 path=[93:0-114]

Length=115
                                                                      Score     E

gb|AEH41439.1|  plasma membrane H+-ATPase                             70.9    1e-13   
gb|AAB84203.1|  plasma membrane H+-ATPase                             69.3    3e-13   Kosteletzkya pentacarpos [seashore mallow]
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                  72.0    4e-13   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like  72.0    4e-13   
gb|AFC88896.1|  plasma membrane H+-ATPase                             72.0    5e-13   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3              71.6    7e-13   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like         71.6    7e-13   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type       71.2    7e-13   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1   71.2    7e-13   
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg             70.9    9e-13   
dbj|BAD16689.1|  plasma membrane H+-ATPase                            70.9    1e-12   Daucus carota [carrots]
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                          70.5    1e-12   
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                          70.5    2e-12   
ref|XP_008346827.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  69.7    2e-12   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type       70.1    2e-12   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1   70.1    2e-12   Vitis vinifera
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type       69.7    3e-12   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type       69.7    3e-12   
gb|KHN05623.1|  Plasma membrane ATPase 2                              67.4    3e-12   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  69.3    3e-12   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like  69.3    3e-12   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g           69.3    4e-12   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g           69.3    4e-12   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3              69.3    4e-12   
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3              69.3    4e-12   
gb|KDP45466.1|  hypothetical protein JCGZ_09715                       69.3    4e-12   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1              69.3    4e-12   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3              69.3    4e-12   
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...  69.3    4e-12   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|EPS66977.1|  hypothetical protein M569_07799                       69.3    4e-12   
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...  68.9    5e-12   Solanum lycopersicum
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  68.9    5e-12   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg           68.6    6e-12   
emb|CDP14881.1|  unnamed protein product                              68.6    6e-12   
dbj|BAD16686.1|  plasma membrane H+-ATPase                            68.6    6e-12   Daucus carota [carrots]
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...  68.9    7e-12   
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type       68.6    7e-12   
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                   68.6    8e-12   
gb|AAA20600.1|  plasma-membrane H+ ATPase                             67.0    8e-12   Zea mays [maize]
gb|AAA20601.1|  plasma-membrane H+ ATPase                             67.0    8e-12   Zea mays [maize]
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                   68.6    8e-12   
dbj|BAM20990.1|  plasma membrane H+-ATPase                            68.2    9e-12   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like   68.2    9e-12   
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...  68.2    9e-12   
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3              68.2    1e-11   
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type        68.2    1e-11   Vitis vinifera
emb|CAC28224.1|  p-type H+-ATPase                                     65.1    1e-11   Sesbania rostrata
ref|NP_001274861.1|  plasma membrane ATPase 1-like                    67.8    1e-11   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like         67.8    1e-11   
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2              67.8    1e-11   
ref|NP_001234477.1|  plasma membrane H+-ATPase                        67.8    1e-11   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2              67.8    1e-11   
gb|AAA34052.1|  H+-translocating ATPase                               67.8    1e-11   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACN34067.1|  unknown                                               67.4    1e-11   Zea mays [maize]
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570        67.4    2e-11   
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...  67.4    2e-11   
dbj|BAA06629.1|  plasma membrane H+-ATPase                            67.4    2e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA94374.1|  plasma membrane H+-ATPase                            64.3    2e-11   Nepenthes alata
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like  67.4    2e-11   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg           67.4    2e-11   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like         67.4    2e-11   
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                        67.0    2e-11   
gb|EEC81667.1|  hypothetical protein OsI_25220                        67.0    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like         67.0    2e-11   
ref|NP_001059093.1|  Os07g0191200                                     67.0    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                  67.0    2e-11   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                 66.6    3e-11   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1              67.0    3e-11   
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg           67.0    3e-11   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440        67.0    3e-11   Sorghum bicolor [broomcorn]
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                 66.6    3e-11   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like         67.0    3e-11   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like         67.0    3e-11   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like         67.0    3e-11   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...  67.0    3e-11   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg           67.0    3e-11   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg              66.6    3e-11   
ref|XP_009804763.1|  PREDICTED: plasma membrane ATPase 2-like         63.5    3e-11   
ref|XP_010096524.1|  ATPase 10, plasma membrane-type                  67.0    3e-11   
ref|XP_011089588.1|  PREDICTED: plasma membrane ATPase 1              66.6    3e-11   
dbj|BAA94376.1|  plasma membrane H+-ATPase                            63.9    3e-11   Nepenthes alata
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  66.6    3e-11   
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like         66.6    3e-11   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like   66.6    3e-11   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type        66.6    3e-11   
emb|CAC28221.1|  p-type H+-ATPase                                     63.9    4e-11   Sesbania rostrata
dbj|BAA94377.1|  plasma membrane H+-ATPase                            63.5    4e-11   Nepenthes alata
dbj|BAA94373.1|  plasma membrane H+-ATPase                            63.5    4e-11   Nepenthes alata
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  66.6    4e-11   
dbj|BAC77532.1|  plasma membrane H+-ATPase                            66.2    4e-11   Sesbania rostrata
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1   66.2    4e-11   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg           66.2    5e-11   
ref|XP_010053511.1|  PREDICTED: ATPase 11, plasma membrane-type-like  66.2    5e-11   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  66.2    5e-11   
gb|KGN52442.1|  hypothetical protein Csa_5G635370                     65.9    5e-11   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...  66.2    5e-11   
ref|NP_001234775.1|  plasma membrane ATPase 1                         66.2    5e-11   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                       65.9    5e-11   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2   65.9    5e-11   
emb|CDP10016.1|  unnamed protein product                              65.9    5e-11   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type       65.9    6e-11   
gb|KEH24964.1|  plasma membrane H+-ATPase                             65.9    6e-11   
emb|CAN80223.1|  hypothetical protein VITISV_027896                   65.9    6e-11   Vitis vinifera
ref|XP_010654358.1|  PREDICTED: ATPase 10, plasma membrane-type       65.9    6e-11   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...  65.9    6e-11   
emb|CBI35782.3|  unnamed protein product                              65.9    6e-11   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.9    6e-11   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.9    7e-11   
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                   65.9    7e-11   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.5    8e-11   
gb|AAQ19038.1|  P-type H+-ATPase                                      63.2    8e-11   Vicia faba [broad bean]
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type       65.5    8e-11   
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                   65.5    8e-11   
gb|KHN16390.1|  ATPase 10, plasma membrane-type                       65.5    8e-11   
ref|XP_009799962.1|  PREDICTED: plasma membrane ATPase 1-like         65.5    8e-11   
ref|XP_009609422.1|  PREDICTED: plasma membrane ATPase 1-like         65.5    8e-11   
gb|AAD46187.1|  plasma membrane proton ATPase                         65.5    8e-11   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g           65.5    8e-11   
ref|XP_006426821.1|  hypothetical protein CICLE_v10024879mg           65.5    8e-11   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                  65.5    9e-11   
emb|CAB85496.1|  H+-ATPase                                            63.2    9e-11   Medicago truncatula
ref|XP_004499907.1|  PREDICTED: plasma membrane ATPase 1-like         62.4    9e-11   
emb|CDP14275.1|  unnamed protein product                              65.1    1e-10   
gb|KDP28822.1|  hypothetical protein JCGZ_14593                       65.5    1e-10   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like   65.1    1e-10   
ref|XP_002304299.1|  H+-ATPase family protein                         65.1    1e-10   Populus trichocarpa [western balsam poplar]
emb|CBI16656.3|  unnamed protein product                              65.1    1e-10   
dbj|BAA94378.1|  plasma membrane H+-ATPase                            62.0    1e-10   Nepenthes alata
ref|XP_011031935.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.1    1e-10   
ref|XP_003633895.1|  PREDICTED: plasma membrane ATPase 1              65.1    1e-10   
ref|XP_002864812.1|  AHA11-ATPASE 11                                  65.1    1e-10   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg           65.1    1e-10   
gb|ACL37322.1|  plasma membrane H+-ATPase                             63.5    1e-10   Eichhornia crassipes
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.1    1e-10   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg           65.1    1e-10   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...  65.1    1e-10   
emb|CAB41144.1|  H+-transporting ATPase-like protein                  65.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...  65.1    1e-10   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg           65.1    1e-10   
emb|CAB85497.1|  H+-ATPase                                            62.8    1e-10   Medicago truncatula
ref|NP_201073.1|  H(+)-ATPase 11                                      65.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190378.2|  H(+)-ATPase 4                                       65.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  65.1    1e-10   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.1    1e-10   
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like         65.1    1e-10   
ref|XP_009333698.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.1    1e-10   
ref|XP_010497263.1|  PREDICTED: ATPase 8, plasma membrane-type-like   61.6    1e-10   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like           65.1    1e-10   
gb|AAQ55291.1|  plasma membrane H+-ATPase                             65.1    1e-10   Juglans regia
gb|KDP39917.1|  hypothetical protein JCGZ_03448                       65.1    1e-10   
emb|CDP02191.1|  unnamed protein product                              65.1    1e-10   
ref|NP_001105360.1|  membrane H(+)-ATPase1                            65.1    1e-10   Zea mays [maize]
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like         65.1    1e-10   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  65.1    1e-10   
ref|XP_008369421.1|  PREDICTED: ATPase 11, plasma membrane-type-like  65.1    1e-10   
ref|XP_003521833.1|  PREDICTED: ATPase 10, plasma membrane-type-like  64.7    1e-10   
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                64.7    1e-10   
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                64.7    1e-10   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type       64.7    1e-10   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210        64.7    1e-10   
ref|XP_008238415.1|  PREDICTED: ATPase 11, plasma membrane-type-like  64.7    1e-10   
ref|XP_008369420.1|  PREDICTED: ATPase 11, plasma membrane-type-like  64.7    2e-10   
ref|XP_007210973.1|  hypothetical protein PRUPE_ppa021822mg           64.7    2e-10   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type        64.7    2e-10   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like   64.7    2e-10   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like   64.7    2e-10   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...  64.7    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like         64.7    2e-10   
gb|ACL37321.1|  plasma membrane H+-ATPase                             63.2    2e-10   Eichhornia crassipes
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg              64.7    2e-10   
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like         64.7    2e-10   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like         64.7    2e-10   
ref|XP_006375124.1|  H+-ATPase family protein                         64.7    2e-10   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like   64.7    2e-10   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like         64.3    2e-10   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  64.3    2e-10   
emb|CDP14278.1|  unnamed protein product                              64.7    2e-10   
ref|XP_009333704.1|  PREDICTED: ATPase 11, plasma membrane-type-like  64.3    2e-10   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like           64.3    2e-10   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1               64.3    2e-10   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2               64.3    2e-10   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3               64.3    2e-10   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like         64.3    2e-10   
gb|AAD20330.1|  plasma membrane proton-ATPase gene OSA3               62.0    2e-10   Oryza sativa [red rice]
dbj|BAA94375.1|  plasma membrane H+-ATPase                            61.2    2e-10   Nepenthes alata
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...  64.3    2e-10   
gb|AEQ27822.1|  PM H+-ATPase R                                        64.3    2e-10   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...  64.3    2e-10   
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg           64.3    2e-10   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg           64.3    2e-10   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type        64.3    2e-10   
ref|XP_010529048.1|  PREDICTED: ATPase 7, plasma membrane-type        64.3    2e-10   
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                   64.3    2e-10   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...  64.3    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like  64.3    2e-10   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type       64.3    2e-10   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type        64.3    2e-10   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like  64.3    2e-10   
ref|XP_009608472.1|  PREDICTED: ATPase 10, plasma membrane-type i...  64.3    2e-10   
gb|EMS68513.1|  hypothetical protein TRIUR3_07571                     62.4    2e-10   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4              63.9    2e-10   
emb|CAC28220.1|  p-type H+-ATPase                                     61.6    2e-10   Sesbania rostrata
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like         63.9    3e-10   
ref|XP_004515361.1|  PREDICTED: plasma membrane ATPase 1-like         63.9    3e-10   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...  63.9    3e-10   
ref|XP_010029522.1|  PREDICTED: ATPase 10, plasma membrane-type       63.9    3e-10   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                       63.9    3e-10   
gb|EMT24919.1|  Putative ATPase, plasma membrane-like protein         63.9    3e-10   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240        63.9    3e-10   Sorghum bicolor [broomcorn]
emb|CBI34653.3|  unnamed protein product                              64.3    3e-10   
ref|XP_003529039.1|  PREDICTED: plasma membrane ATPase 1-like iso...  63.9    3e-10   
gb|KDP40607.1|  hypothetical protein JCGZ_24606                       63.9    3e-10   
gb|KHN17608.1|  Plasma membrane ATPase 4                              63.9    3e-10   
gb|AEQ27823.1|  PM H+-ATPase L                                        63.9    3e-10   
gb|KEH31901.1|  plasma membrane H+-ATPase                             63.9    3e-10   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...  63.9    3e-10   
ref|XP_010089311.1|  Plasma membrane ATPase 1                         63.9    3e-10   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...  63.9    3e-10   
ref|XP_006602560.1|  PREDICTED: ATPase 11, plasma membrane-type-like  59.7    3e-10   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like   63.9    3e-10   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                63.9    3e-10   
gb|AAY42949.1|  plasma membrane H+ ATPase                             63.9    3e-10   Lupinus albus
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...  63.9    3e-10   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150           63.9    3e-10   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4              63.9    3e-10   
gb|KHN16462.1|  Plasma membrane ATPase 4                              63.9    3e-10   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                63.9    3e-10   
ref|XP_007139050.1|  hypothetical protein PHAVU_009G260800g           63.9    3e-10   
gb|KHN22686.1|  Plasma membrane ATPase 4                              63.9    3e-10   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g           63.9    3e-10   
ref|XP_009608474.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.9    3e-10   
gb|KHN34527.1|  Plasma membrane ATPase 1                              63.9    3e-10   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1    63.9    3e-10   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                        63.9    3e-10   
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like         63.9    3e-10   
gb|KEH35952.1|  plasma membrane H+-ATPase                             63.9    3e-10   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like         63.9    3e-10   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like         63.9    3e-10   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4              63.9    3e-10   
gb|KHN15309.1|  Plasma membrane ATPase 4                              63.9    3e-10   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...  63.9    3e-10   
ref|XP_010094202.1|  Plasma membrane ATPase 4                         63.9    3e-10   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like           63.9    3e-10   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like           63.9    3e-10   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380        63.9    3e-10   
gb|AAN87804.1|  plasma membrane H+ ATPase                             61.2    3e-10   Populus alba [abele]
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690           63.9    3e-10   
ref|XP_010545150.1|  PREDICTED: ATPase 7, plasma membrane-type        63.9    3e-10   
emb|CDP09440.1|  unnamed protein product                              63.9    3e-10   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...  63.9    3e-10   
gb|KHN13245.1|  Plasma membrane ATPase 1                              63.9    3e-10   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like           63.9    3e-10   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...  63.9    3e-10   
ref|XP_010937231.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.5    3e-10   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                63.5    3e-10   
ref|XP_010937229.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.5    3e-10   
ref|XP_010937230.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.5    3e-10   
ref|XP_010937232.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.5    3e-10   
gb|EPS57651.1|  hypothetical protein M569_17165                       63.5    3e-10   
gb|ABR18001.1|  unknown                                               63.5    4e-10   Picea sitchensis
ref|XP_010473819.1|  PREDICTED: uncharacterized protein LOC104753235  62.0    4e-10   
ref|XP_010937233.1|  PREDICTED: ATPase 10, plasma membrane-type i...  63.5    4e-10   
gb|ABW25091.1|  plasma membrane proton pump                           63.5    4e-10   Cucumis sativus [cucumbers]
ref|NP_001050947.1|  Os03g0689300                                     63.5    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                 63.2    4e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMS46830.1|  ATPase 9, plasma membrane-type                        63.2    4e-10   
gb|EEC75974.1|  hypothetical protein OsI_13084                        63.5    4e-10   Oryza sativa Indica Group [Indian rice]
gb|AAF97591.1|AF263917_1  plasma membrane proton ATPase               62.0    4e-10   Solanum lycopersicum
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  63.5    4e-10   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like           63.5    4e-10   
gb|KGN63646.1|  hypothetical protein Csa_1G008520                     63.5    4e-10   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g           63.5    4e-10   
dbj|BAG94605.1|  unnamed protein product                              63.5    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245804.1|  PREDICTED: plasma membrane ATPase 1-like         63.5    4e-10   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460        63.5    4e-10   
gb|ACL54575.1|  unknown                                               63.5    4e-10   Zea mays [maize]
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like         63.5    4e-10   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1     63.5    4e-10   
ref|XP_006359241.1|  PREDICTED: plasma membrane ATPase 1-like         63.5    4e-10   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like           63.5    4e-10   
gb|AEO22063.1|  plasma membrane H+-ATPase                             63.5    4e-10   
ref|XP_004306988.1|  PREDICTED: plasma membrane ATPase 1-like         63.5    4e-10   
ref|NP_001054118.1|  Os04g0656100                                     63.5    4e-10   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2     63.5    4e-10   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein   63.5    4e-10   
gb|ABC59935.1|  P-type ATPase                                         63.5    5e-10   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                        63.5    5e-10   
gb|AAG01028.1|  plasma membrane H+-ATPase                             62.8    5e-10   
dbj|BAL41366.1|  plasma membrane H+-ATPase                            63.2    5e-10   
gb|KDO53736.1|  hypothetical protein CISIN_1g003313mg                 63.2    5e-10   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1              63.2    5e-10   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like           63.2    5e-10   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like         63.2    5e-10   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4              63.2    5e-10   
emb|CAN64375.1|  hypothetical protein VITISV_014422                   63.2    5e-10   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                63.2    5e-10   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4              63.2    5e-10   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like         63.2    5e-10   
emb|CDY30730.1|  BnaA02g33520D                                        63.2    5e-10   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                        63.2    5e-10   
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1              63.2    5e-10   
ref|XP_003521073.2|  PREDICTED: plasma membrane ATPase 1-like iso...  63.2    5e-10   
gb|EEC69747.1|  hypothetical protein OsI_39279                        63.2    5e-10   
gb|ACE77057.1|  plasma membrane proton pump                           63.2    5e-10   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                         62.8    5e-10   
gb|AAQ19040.1|  P-type H+-ATPase                                      60.8    5e-10   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like         63.2    5e-10   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1              63.2    5e-10   
emb|CDX93092.1|  BnaA03g38140D                                        63.2    5e-10   
gb|EPS63245.1|  hypothetical protein M569_11541                       63.2    5e-10   
ref|XP_010273791.1|  PREDICTED: plasma membrane ATPase-like isofo...  63.2    5e-10   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like           63.2    5e-10   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like         63.2    5e-10   
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g           63.2    5e-10   
dbj|BAK04567.1|  predicted protein                                    63.2    5e-10   
dbj|BAJ92653.1|  predicted protein                                    63.2    6e-10   
emb|CAB85495.1|  H+-ATPase                                            63.2    6e-10   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  63.2    6e-10   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070        63.2    6e-10   
ref|XP_007134481.1|  hypothetical protein PHAVU_010G050900g           63.2    6e-10   
emb|CAB85494.1|  H+-ATPase                                            63.2    6e-10   
gb|KEH17835.1|  plasma membrane H+-ATPase                             63.2    6e-10   
emb|CDY50939.1|  BnaC03g74390D                                        63.2    6e-10   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like  63.2    6e-10   
ref|NP_001067382.1|  Os12g0638700                                     63.2    6e-10   
gb|AAR32129.2|  proton P-ATPase                                       63.2    6e-10   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type        63.2    6e-10   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...  63.2    6e-10   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like           63.2    6e-10   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg              63.2    6e-10   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                 63.2    6e-10   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg           63.2    6e-10   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg           62.8    6e-10   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...  62.8    6e-10   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...  62.8    6e-10   
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like         62.8    6e-10   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...  62.8    6e-10   
gb|KHN44553.1|  Plasma membrane ATPase 1                              62.8    6e-10   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                        63.2    6e-10   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein         62.8    6e-10   
ref|XP_004494890.1|  PREDICTED: ATPase 10, plasma membrane-type-like  62.8    6e-10   
ref|XP_010273789.1|  PREDICTED: ATPase 10, plasma membrane-type-l...  62.8    6e-10   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...  62.8    6e-10   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525            62.8    7e-10   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...  62.8    7e-10   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  62.8    7e-10   
ref|XP_002533320.1|  H(\+)-transporting atpase plant/fungi plasma...  62.8    7e-10   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like           62.8    7e-10   
ref|XP_007039740.1|  H(+)-ATPase 11 isoform 1                         62.8    7e-10   
gb|EMT31912.1|  Plasma membrane ATPase 1                              62.8    7e-10   
emb|CDY45757.1|  BnaC02g42250D                                        62.8    7e-10   
ref|XP_004300356.1|  PREDICTED: plasma membrane ATPase 1-like         62.8    7e-10   
ref|XP_008228092.1|  PREDICTED: ATPase 10, plasma membrane-type       62.8    7e-10   
ref|XP_008232467.1|  PREDICTED: plasma membrane ATPase 1-like iso...  62.8    7e-10   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...  62.8    7e-10   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...  62.8    7e-10   
ref|XP_007217692.1|  hypothetical protein PRUPE_ppa000950mg           62.8    7e-10   
ref|XP_009782785.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.8    7e-10   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like         62.8    7e-10   
ref|XP_007039741.1|  H(\\+)-transporting atpase plant/fungi plasm...  62.8    7e-10   
emb|CDO97775.1|  unnamed protein product                              62.8    7e-10   
ref|NP_189850.1|  H(+)-ATPase 8                                       62.8    7e-10   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...  62.8    7e-10   
dbj|BAC77530.1|  plasma membrane H+-ATPase                            62.8    7e-10   
ref|XP_007024799.1|  Autoinhibited H(+)-ATPase isoform 2              62.8    7e-10   
ref|XP_008232466.1|  PREDICTED: plasma membrane ATPase 1-like iso...  62.8    8e-10   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like   62.8    8e-10   
ref|XP_011035514.1|  PREDICTED: ATPase 10, plasma membrane-type-like  62.8    8e-10   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2   62.8    8e-10   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  62.8    8e-10   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g           62.8    8e-10   
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like   62.0    8e-10   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg              62.8    8e-10   
gb|ABA18112.1|  putative plasma membrane ATPase                       62.8    8e-10   
ref|XP_006369068.1|  putative plasma membrane H+ ATPase family pr...  62.8    8e-10   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like         62.8    8e-10   
ref|XP_009782787.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.4    8e-10   
ref|XP_010459299.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.8    8e-10   
ref|XP_010459298.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.8    8e-10   
gb|ABA18090.1|  putative plasma membrane ATPase                       62.8    8e-10   
gb|AAY42948.1|  plasma membrane H+ ATPase                             62.8    8e-10   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like   62.4    8e-10   
ref|XP_010111939.1|  Plasma membrane ATPase 4                         62.4    8e-10   
gb|AAB41898.1|  H+-transporting ATPase                                62.4    8e-10   
gb|AAN87803.1|  plasma membrane H+ ATPase                             60.1    8e-10   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like         62.4    8e-10   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like   62.4    8e-10   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like         62.8    9e-10   
ref|XP_006426822.1|  hypothetical protein CICLE_v100248072mg          62.4    9e-10   
ref|XP_010459301.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.4    9e-10   
gb|AAY42950.1|  plasma membrane H+ ATPase                             62.4    9e-10   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                62.4    9e-10   
dbj|BAA01058.1|  H-ATPase                                             62.4    9e-10   
ref|XP_010459300.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.4    9e-10   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                   62.4    9e-10   
ref|XP_010660580.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 11, p...  62.4    9e-10   
ref|XP_006836570.1|  hypothetical protein AMTR_s00131p00073280        62.4    9e-10   
emb|CAC29436.1|  P-type H+-ATPase                                     62.4    9e-10   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like   62.4    9e-10   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type        62.4    9e-10   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4              62.4    9e-10   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like         62.4    9e-10   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like         62.4    9e-10   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like   62.4    9e-10   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                 62.4    1e-09   
emb|CAN76454.1|  hypothetical protein VITISV_043399                   62.4    1e-09   
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                 62.4    1e-09   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg           62.4    1e-09   
ref|NP_178762.1|  H(+)-ATPase 6                                       62.4    1e-09   
gb|EMS60138.1|  ATPase 6, plasma membrane-type                        62.0    1e-09   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like         62.4    1e-09   
ref|XP_008798790.1|  PREDICTED: plasma membrane ATPase 1 isoform X1   62.4    1e-09   
ref|XP_008798791.1|  PREDICTED: plasma membrane ATPase 1 isoform X2   62.4    1e-09   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like           62.4    1e-09   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg           62.4    1e-09   
gb|KDO53735.1|  hypothetical protein CISIN_1g002768mg                 62.4    1e-09   
ref|XP_006465724.1|  PREDICTED: ATPase 10, plasma membrane-type-l...  62.4    1e-09   
gb|KHN19619.1|  Plasma membrane ATPase 4                              59.3    1e-09   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                 62.4    1e-09   
ref|XP_004966679.1|  PREDICTED: ATPase 6, plasma membrane-type-like   62.4    1e-09   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                 62.4    1e-09   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g           62.4    1e-09   
ref|XP_009348377.1|  PREDICTED: plasma membrane ATPase 1-like         62.4    1e-09   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like         62.4    1e-09   
ref|XP_004987141.1|  PREDICTED: ATPase 10, plasma membrane-type-like  62.4    1e-09   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                       62.4    1e-09   
ref|XP_006465725.1|  PREDICTED: ATPase 10, plasma membrane-type-l...  62.4    1e-09   
emb|CAC29435.1|  P-type H+-ATPase                                     62.0    1e-09   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500        62.0    1e-09   
ref|XP_010685193.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.0    1e-09   
ref|XP_008378468.1|  PREDICTED: plasma membrane ATPase 1-like         62.0    1e-09   
ref|XP_006477127.1|  PREDICTED: ATPase 11, plasma membrane-type-like  62.0    1e-09   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg              62.0    1e-09   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  62.0    1e-09   
ref|XP_009350895.1|  PREDICTED: plasma membrane ATPase 2-like         62.0    1e-09   
ref|XP_006440236.1|  hypothetical protein CICLE_v10018727mg           62.0    1e-09   
gb|KDO61318.1|  hypothetical protein CISIN_1g002151mg                 62.0    1e-09   
gb|AHK23067.1|  plasma membrane ATPase 4                              62.0    1e-09   
gb|EYU19268.1|  hypothetical protein MIMGU_mgv1a024366mg              62.0    1e-09   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...  62.0    1e-09   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                        62.0    1e-09   
ref|XP_010685192.1|  PREDICTED: ATPase 10, plasma membrane-type i...  62.0    1e-09   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type        62.0    1e-09   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                 62.0    1e-09   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...  62.0    1e-09   
gb|AAD46188.1|  plasma membrane proton ATPase                         62.0    1e-09   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like         62.0    1e-09   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like         62.0    1e-09   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like         62.0    1e-09   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4              62.0    1e-09   
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like           62.0    1e-09   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like   62.0    1e-09   
gb|KEH24965.1|  plasma membrane H+-ATPase                             62.0    1e-09   
dbj|BAK05828.1|  predicted protein                                    62.0    2e-09   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g           61.6    2e-09   
emb|CAC28222.1|  p-type H+-ATPase                                     59.3    2e-09   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like           61.6    2e-09   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g           61.6    2e-09   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                 61.6    2e-09   
emb|CAA59799.1|  H(+)-transporting ATPase                             61.6    2e-09   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4              61.6    2e-09   
gb|EYU45222.1|  hypothetical protein MIMGU_mgv1a026587mg              60.8    2e-09   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg           61.6    2e-09   
ref|XP_003594954.1|  Plasma membrane ATPase                           61.6    2e-09   
ref|NP_001182902.1|  uncharacterized protein LOC100501185             61.2    2e-09   
emb|CAC28223.1|  p-type H+-ATPase                                     59.3    2e-09   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...  61.6    2e-09   
ref|XP_002324397.1|  H+-ATPase family protein                         61.6    2e-09   
emb|CAN61424.1|  hypothetical protein VITISV_027272                   61.6    2e-09   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1   61.6    2e-09   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4              61.6    2e-09   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...  61.6    2e-09   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...  61.6    2e-09   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like         61.6    2e-09   
gb|AFM52333.1|  plasma membrane H+-ATPase                             61.6    2e-09   
ref|XP_006382164.1|  H+-ATPase family protein                         61.6    2e-09   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...  61.6    2e-09   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like         61.6    2e-09   
emb|CDX76810.1|  BnaC08g33960D                                        61.6    2e-09   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...  61.6    2e-09   
ref|XP_009386770.1|  PREDICTED: ATPase 10, plasma membrane-type-like  61.6    2e-09   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                        61.6    2e-09   
emb|CDO98206.1|  unnamed protein product                              61.6    2e-09   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1   61.6    2e-09   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4              61.6    2e-09   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...  61.2    2e-09   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like         61.2    2e-09   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type        61.2    2e-09   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2   61.2    2e-09   
ref|XP_011081303.1|  PREDICTED: plasma membrane ATPase 1-like         61.2    2e-09   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470        61.2    2e-09   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like           61.2    2e-09   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like         61.2    2e-09   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1   61.2    2e-09   
ref|XP_006848754.1|  hypothetical protein AMTR_s00026p00031910        60.5    2e-09   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like         61.2    2e-09   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg           61.2    2e-09   
gb|EPS65442.1|  hypothetical protein M569_09334                       61.2    2e-09   
ref|XP_002465744.1|  hypothetical protein SORBIDRAFT_01g045000        61.2    2e-09   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type        61.2    2e-09   



>gb|AEH41439.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=268

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASRTENQDAID AIV MLADPKEAR+
Sbjct  30   VDPDTVVLMAARASRTENQDAIDSAIVGMLADPKEARS  67



>gb|AAB84203.1| plasma membrane H+-ATPase [Kosteletzkya virginica]
Length=241

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPD+VVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  25   VDPDSVVLMAARASRTENQDAIDPAIVGMLADPKEARA  62



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  351  VDPDTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  388



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=957

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDPDTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  395



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASRTENQDAID AIV MLADPKEAR+
Sbjct  357  VDPDTVVLMAARASRTENQDAIDSAIVGMLADPKEARS  394



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V PDTV+LMAARASRTENQDAID AIVNMLADPKEARA
Sbjct  357  VTPDTVILMAARASRTENQDAIDTAIVNMLADPKEARA  394



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V PDTV+LMAARASRTENQDAID AIVNMLADPKEARA
Sbjct  357  VTPDTVILMAARASRTENQDAIDTAIVNMLADPKEARA  394



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V PDTV+LMAARASRTENQDAID AIVNMLADPKEARA
Sbjct  357  VTPDTVILMAARASRTENQDAIDTAIVNMLADPKEARA  394



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V PDTV+LMAARASRTENQDAID AIVNMLADPKEARA
Sbjct  357  VTPDTVILMAARASRTENQDAIDTAIVNMLADPKEARA  394



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASRTENQDAIDGAIV MLADPKEARA
Sbjct  358  IDADTVVLMAARASRTENQDAIDGAIVGMLADPKEARA  395



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIVNMLADPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVNMLADPKEARA  394



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_008346827.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like, 
partial [Malus domestica]
Length=553

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  117  VDPDTVVLMAARASRLENQDAIDTAIVGMLADPKEARA  154



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRVENQDAIDTAIVGMLADPKEARA  394



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVVLMAARASRLENQDAIDTAIVGMLADPKEARA  394



>gb|KHN05623.1| Plasma membrane ATPase 2 [Glycine soja]
Length=306

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV +LADPKEARA
Sbjct  178  VDPDTVILMAARASRLENQDAIDTAIVGILADPKEARA  215



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVILMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVILMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVILMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDPDTVILMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDTDTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  394



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  394



>gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+PD VVLMAARASR ENQDAID AIVNMLADPKEARA
Sbjct  357  VNPDAVVLMAARASRVENQDAIDAAIVNMLADPKEARA  394



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  394



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  394



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  354  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  391



>sp|P23980.1|PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2; AltName: Full=Proton 
pump 2, partial [Solanum lycopersicum]
Length=704

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  105  VDADTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  142



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  353  VDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  390



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +DPDTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  MDPDTVVLMAARASRVENQDAIDTAIVGMLADPKEARA  394



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  351  IDADTVVLMAARASRTENQDAIDAAIVGMLADPKEARA  388



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIVNMLADPKEARA
Sbjct  357  VDADTVVLMAARASRIENQDAIDTAIVNMLADPKEARA  394



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDSAIVGMLADPKEARA  394



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVV+MAARASRTENQDAID AIV  LADPKEARA
Sbjct  357  VDPDTVVVMAARASRTENQDAIDAAIVGTLADPKEARA  394



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVV+MAARASRTENQDAID AIV  LADPKEARA
Sbjct  357  VDPDTVVVMAARASRTENQDAIDAAIVGTLADPKEARA  394



>gb|AAA20600.1| plasma-membrane H+ ATPase, partial [Zea mays]
Length=347

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  237  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  274



>gb|AAA20601.1| plasma-membrane H+ ATPase, partial [Zea mays]
Length=347

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  237  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  274



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTVV+MAARASRTENQDAID AIV  LADPKEARA
Sbjct  357  VDPDTVVVMAARASRTENQDAIDAAIVGTLADPKEARA  394



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID AIVNMLADPKEARA
Sbjct  359  VDKDMVVLLAARASRTENQDAIDAAIVNMLADPKEARA  396



>ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus]
Length=959

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  360  VDVDTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  397



>ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like 
[Cucumis sativus]
Length=959

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  360  VDVDTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  397



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  360  VDVDTVVLMAARASRTENQDAIDTAIVGMLADPKEARA  397



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPDTV+LMAARASR ENQDAID AIV MLADP+EARA
Sbjct  357  VDPDTVILMAARASRLENQDAIDTAIVGMLADPREARA  394



>emb|CAC28224.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  14   VDADTVVLMAARASRLENQDAIDTAIVGMLADPKEARA  51



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  357  VDADTVVLMAARASRTENQDAIDTAIVGMLSDPKEARA  394



>gb|ACN34067.1| unknown [Zea mays]
Length=698

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  99   VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  136



>ref|XP_006837363.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
 gb|ERN00217.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
Length=1007

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASRTENQDAID AIV ML+DPKEARA
Sbjct  401  IDKDTVVLMAARASRTENQDAIDAAIVAMLSDPKEARA  438



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>dbj|BAA94374.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=190

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTVVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  33   DADTVVLIAARASRTENQDAIDTAIVGMLADPKEARA  69



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRTENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRTENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>tpg|DAA42486.1| TPA: H(+)-transporting ATPase [Zea mays]
Length=949

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  360  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  397



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  351  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  388



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+L++ARASRTENQDAID +IVNML DPKEARA
Sbjct  356  VDKDTVILLSARASRTENQDAIDASIVNMLGDPKEARA  393



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRTENQDAIDAAIVGMLADPKEARA  394



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDADMVVLMAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRMENQDAIDAAIVGMLADPKEARA  394



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTV+LMAARASRTENQDAID  IV MLADPKEARA
Sbjct  357  IDQDTVILMAARASRTENQDAIDATIVGMLADPKEARA  394



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASRTENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRTENQDAIDAAIVGMLADPKEARA  394



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRMENQDAIDAAIVGMLADPKEARA  394



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  360  VDADTVVLMAARASRMENQDAIDAAIVGMLADPKEARA  397



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRMENQDAIDAAIVGMLADPKEARA  394



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDADMVVLMAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRIENQDAIDAAIVGMLADPKEARA  394



>ref|XP_009804763.1| PREDICTED: plasma membrane ATPase 2-like [Nicotiana sylvestris]
 ref|XP_009804764.1| PREDICTED: plasma membrane ATPase 2-like [Nicotiana sylvestris]
Length=145

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR EN+DAID AI  MLADPKEARA
Sbjct  41   VDVDTVVLMAARASRVENEDAIDAAIAGMLADPKEARA  78



>ref|XP_010096524.1| ATPase 10, plasma membrane-type [Morus notabilis]
 gb|EXB64644.1| ATPase 10, plasma membrane-type [Morus notabilis]
Length=1260

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DT+VL+AARASR ENQDAID A++NMLADPKEARA
Sbjct  344  MDKDTIVLLAARASRLENQDAIDAAVINMLADPKEARA  381



>ref|XP_011089588.1| PREDICTED: plasma membrane ATPase 1 [Sesamum indicum]
Length=964

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDTVVLMAARASRLENQDAIDTAIVSMLADPKEARA  394



>dbj|BAA94376.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=201

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D +TVVLMAARASRTENQDAID AIV  LADPKEARA
Sbjct  23   IDANTVVLMAARASRTENQDAIDAAIVGTLADPKEARA  60



>ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=979

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D+VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  359  VDADSVVLMAARASRLENQDAIDTAIVGMLADPKEARA  396



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like [Fragaria vesca subsp. 
vesca]
Length=956

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDVDTVVLMAARASRIENQDAIDAAIVGMLADPKEARA  394



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTV+L+AARASRTENQDAID +IVNML+DPKEARA
Sbjct  357  DKDTVILLAARASRTENQDAIDASIVNMLSDPKEARA  393



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+L++ARASRTENQDAID +IVNML DPKEARA
Sbjct  356  VDKDTVILLSARASRTENQDAIDASIVNMLGDPKEARA  393



>emb|CAC28221.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEAR  112
            VD DTVVLMAARASR ENQDAID AIV MLADPKEAR
Sbjct  14   VDADTVVLMAARASRLENQDAIDTAIVGMLADPKEAR  50



>dbj|BAA94377.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=191

 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D +TVVLMAARASRTENQDAID AIV  LADPKEARA
Sbjct  24   IDANTVVLMAARASRTENQDAIDAAIVGTLADPKEARA  61



>dbj|BAA94373.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=198

 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D +TVVLMAARASRTENQDAID AIV  LADPKEARA
Sbjct  32   IDANTVVLMAARASRTENQDAIDAAIVGTLADPKEARA  69



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVL+AARASR ENQDAID +IVNML+DPKEARA
Sbjct  356  VDADTVVLLAARASRIENQDAIDASIVNMLSDPKEARA  393



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAARASRLENQDAIDTAIVGMLADPKEARA  394



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTV+LMAARASRTENQDAID AIV MLADPKEARA
Sbjct  362  VSQDTVILMAARASRTENQDAIDTAIVGMLADPKEARA  399



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+L++ARASRTENQDAID  IVNML DPKEARA
Sbjct  356  VDKDTVILLSARASRTENQDAIDACIVNMLGDPKEARA  393



>ref|XP_010053511.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW77823.1| hypothetical protein EUGRSUZ_D02110 [Eucalyptus grandis]
Length=961

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VEKDTVVLMAARASRLENQDAIDAAIVSMLADPKEARA  394



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVL+AARASR ENQDAID +IVNML+DPKEARA
Sbjct  356  VDADTVVLLAARASRIENQDAIDASIVNMLSDPKEARA  393



>gb|KGN52442.1| hypothetical protein Csa_5G635370 [Cucumis sativus]
Length=802

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV ML+DPKEARA
Sbjct  203  VDVDTVVLMAARASRVENQDAIDAAIVGMLSDPKEARA  240



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  +V MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATMVGMLADPKEARA  394



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  IDADTVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID AIV  LADPKEARA
Sbjct  357  VDADTVILMAARASRTENQDAIDSAIVGTLADPKEARA  394



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTV+LMAARASRTENQDAID AIV MLADPKEARA
Sbjct  362  VSQDTVILMAARASRTENQDAIDTAIVGMLADPKEARA  399



>emb|CDP10016.1| unnamed protein product [Coffea canephora]
Length=966

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV+ML DPKEARA
Sbjct  359  VDKDTVVLMAARASRLENQDAIDTAIVSMLGDPKEARA  396



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  IDADTVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV ML DPKEARA
Sbjct  357  VDADTVVLMAARASRVENQDAIDAAIVGMLGDPKEARA  394



>emb|CAN80223.1| hypothetical protein VITISV_027896 [Vitis vinifera]
Length=938

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  373  MDKDTVVLLAARASRLENQDAIDTAIINMLADPKEARA  410



>ref|XP_010654358.1| PREDICTED: ATPase 10, plasma membrane-type [Vitis vinifera]
Length=949

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  361  MDKDTVVLLAARASRLENQDAIDTAIINMLADPKEARA  398



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  +V MLADPKEARA
Sbjct  357  VDQDTVILMAARASRTENQDAIDATMVGMLADPKEARA  394



>emb|CBI35782.3| unnamed protein product [Vitis vinifera]
Length=970

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  361  MDKDTVVLLAARASRLENQDAIDTAIINMLADPKEARA  398



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004162585.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV ML+DPKEARA
Sbjct  357  VDVDTVVLMAARASRVENQDAIDAAIVGMLSDPKEARA  394



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV ML+DPKEARA
Sbjct  357  VDVDTVVLMAARASRVENQDAIDAAIVGMLSDPKEARA  394



>gb|KCW83495.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=924

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD +TVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDKETVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DT+VLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  IDADTIVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>gb|AAQ19038.1| P-type H+-ATPase [Vicia faba]
Length=244

 Score = 63.2 bits (152),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  27   VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  64



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD +TVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDKETVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD +TVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDKETVVLMAARASRLENQDAIDAAIVGMLADPKEARA  394



>gb|KHN16390.1| ATPase 10, plasma membrane-type [Glycine soja]
Length=904

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARA+R ENQDAID A+VNMLADPKEARA
Sbjct  331  MDKDTVVLLAARAARLENQDAIDTAVVNMLADPKEARA  368



>ref|XP_009799962.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana sylvestris]
Length=966

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  359  VEKDTVVLMAARASRLENQDAIDTAIVSMLADPKEARA  396



>ref|XP_009609422.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana tomentosiformis]
 ref|XP_009609423.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana tomentosiformis]
Length=966

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  359  VEKDTVVLMAARASRLENQDAIDTAIVSMLADPKEARA  396



>gb|AAD46187.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=966

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  359  VEKDTVVLMAARASRLENQDAIDTAIVSMLADPKEARA  396



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  359  VDKDHVILLAARASRTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_006426821.1| hypothetical protein CICLE_v10024879mg [Citrus clementina]
 gb|ESR40061.1| hypothetical protein CICLE_v10024879mg [Citrus clementina]
Length=859

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DT+VL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  361  MDKDTLVLLAARASRLENQDAIDAAIINMLADPKEARA  398



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTV+L++ARASRTENQDAID +IVNMLADPKEARA
Sbjct  357  DKDTVMLLSARASRTENQDAIDASIVNMLADPKEARA  393



>emb|CAB85496.1| H+-ATPase [Medicago truncatula]
Length=268

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  27   VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  64



>ref|XP_004499907.1| PREDICTED: plasma membrane ATPase 1-like [Cicer arietinum]
Length=163

 Score = 62.4 bits (150),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D  VLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  40   VDKDVTVLMAARASRLENQDAIDCAIVSMLADPKEARA  77



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D+VVL AARASRTENQDAID +IVNML+DPKEARA
Sbjct  40   MDKDSVVLYAARASRTENQDAIDASIVNMLSDPKEARA  77



>gb|KDP28822.1| hypothetical protein JCGZ_14593 [Jatropha curcas]
Length=966

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  394



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASR ENQDAID A+V MLADPKEARA
Sbjct  356  VDIDTVILMAARASRVENQDAIDTAVVGMLADPKEARA  393



>ref|XP_002304299.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEE79278.1| H+-ATPase family protein [Populus trichocarpa]
Length=961

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  394



>emb|CBI16656.3| unnamed protein product [Vitis vinifera]
Length=958

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  358  VDKDMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  395



>dbj|BAA94378.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=182

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
             D +TVVLMAARASRTENQDAID AIV  LADPKEARA
Sbjct  27   TDANTVVLMAARASRTENQDAIDAAIVGTLADPKEARA  64



>ref|XP_011031935.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=962

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  394



>ref|XP_003633895.1| PREDICTED: plasma membrane ATPase 1 [Vitis vinifera]
Length=968

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  358  VDKDMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  395



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>gb|ACL37322.1| plasma membrane H+-ATPase [Eichhornia crassipes]
Length=308

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  92   VDKDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  129



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPK+ARA
Sbjct  361  VDADTVVLMAARASRLENQDAIDAAIVGMLADPKDARA  398



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRVENQDAIDAAIVGMLADPKEARA  394



>emb|CAB85497.1| H+-ATPase [Medicago truncatula]
Length=266

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  27   VDADAVVLMAARASRLENQDAIDTAIVGMLADPKEARA  64



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV MLADPK+ARA
Sbjct  361  VDADTVVLMAARASRLENQDAIDAAIVGMLADPKDARA  398



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D+VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  359  VDADSVVLMAARASRLENQDAIDTAIVGMLADPKEARA  396



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VHADTVVLMAARASRVENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRVENQDAIDAAIVGMLADPKEARA  394



>ref|XP_009333698.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=981

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  365  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  402



>ref|XP_010497263.1| PREDICTED: ATPase 8, plasma membrane-type-like, partial [Camelina 
sativa]
Length=135

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D+VVLMAARASR ENQDAID +IV ML DPKEARA
Sbjct  37   MDTDSVVLMAARASRIENQDAIDASIVGMLGDPKEARA  74



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  358  VDKDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  395



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRVENQDAIDSAIVGMLADPKEARA  394



>gb|KDP39917.1| hypothetical protein JCGZ_03448 [Jatropha curcas]
Length=964

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDMVVLMAARASRLENQDAIDTAIVSMLADPKEARA  394



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARA+R ENQDAID AIV MLADPKEARA
Sbjct  357  VDVDTVVLMAARAARLENQDAIDAAIVGMLADPKEARA  394



>ref|NP_001105360.1| membrane H(+)-ATPase1 [Zea mays]
 gb|AAB60276.1| H(+)-transporting ATPase [Zea mays]
Length=949

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+LMAARASRTENQDAID  IV MLADP EARA
Sbjct  360  VDQDTVILMAARASRTENQDAIDATIVGMLADPTEARA  397



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTV+LMAARASRTENQDAID AIV MLADP+EARA
Sbjct  357  VSQDTVILMAARASRTENQDAIDTAIVGMLADPREARA  394



>ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=960

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D+VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  359  VDADSVVLMAARASRLENQDAIDTAIVGMLADPKEARA  396



>ref|XP_008369421.1| PREDICTED: ATPase 11, plasma membrane-type-like [Malus domestica]
Length=967

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  360  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  397



>ref|XP_003521833.1| PREDICTED: ATPase 10, plasma membrane-type-like [Glycine max]
Length=934

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARA+R ENQDAID A+VNMLADPKEARA
Sbjct  361  MDKDTVVLLAARAARLENQDAIDTAVVNMLADPKEARA  398



>gb|KDO72464.1| hypothetical protein CISIN_1g0021762mg [Citrus sinensis]
Length=875

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRVENQDAIDAAIVGMLADPKEARA  394



>gb|KDO72462.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
 gb|KDO72463.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
Length=924

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRVENQDAIDAAIVGMLADPKEARA  394



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  IDADTVVLMAAQASRVENQDAIDAAIVGMLADPKEARA  394



>ref|XP_006838797.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD +TV+LMAARASRTENQDAID AIV  LADPKEARA
Sbjct  357  VDKETVILMAARASRTENQDAIDAAIVGTLADPKEARA  394



>ref|XP_008238415.1| PREDICTED: ATPase 11, plasma membrane-type-like [Prunus mume]
Length=961

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  355  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  392



>ref|XP_008369420.1| PREDICTED: ATPase 11, plasma membrane-type-like [Malus domestica]
Length=959

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  352  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  389



>ref|XP_007210973.1| hypothetical protein PRUPE_ppa021822mg [Prunus persica]
 gb|EMJ12172.1| hypothetical protein PRUPE_ppa021822mg [Prunus persica]
Length=942

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  355  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  392



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTVVL+AARASR ENQDAID +IVNML DPKEARA
Sbjct  357  DKDTVVLLAARASRIENQDAIDASIVNMLGDPKEARA  393



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTVVL+AARASR ENQDAID +IVNML DPKEARA
Sbjct  357  DKDTVVLLAARASRIENQDAIDASIVNMLGDPKEARA  393



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTVVL+AARASR ENQDAID +IVNML DPKEARA
Sbjct  357  DKDTVVLLAARASRIENQDAIDASIVNMLGDPKEARA  393



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  368  VDADTVVLMAAQASRIENQDAIDTAIVGMLADPKEARA  405



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ + V+L+AARASRTENQDAID AIVNMLADPKEARA
Sbjct  359  VEKEHVILLAARASRTENQDAIDAAIVNMLADPKEARA  396



>gb|ACL37321.1| plasma membrane H+-ATPase [Eichhornia crassipes]
Length=315

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTV+LMAARASRTENQDAID A V MLADPKEARA
Sbjct  99   VSQDTVILMAARASRTENQDAIDTATVGMLADPKEARA  136



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTV+L+AARASR ENQDAID +IVNML+DPKEARA
Sbjct  357  DKDTVILLAARASRVENQDAIDASIVNMLSDPKEARA  393



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAARASR ENQDAID AIV MLADP+EARA
Sbjct  357  IDADTVVLMAARASRIENQDAIDTAIVGMLADPQEARA  394



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEAR  112
            V  DTV+LMAARASRTENQDAID AIV MLADPKEAR
Sbjct  362  VSQDTVILMAARASRTENQDAIDTAIVGMLADPKEAR  398



>ref|XP_006375124.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP52921.1| H+-ATPase family protein [Populus trichocarpa]
Length=965

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDMVVLMAARASRLENQDAIDCAIVSMLADPKEARA  394



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D DTVVL+AARASR ENQDAID +IVNML+DPKEARA
Sbjct  357  DKDTVVLLAARASRIENQDAIDASIVNMLSDPKEARA  393



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  358  VDKDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  395



>ref|XP_011082991.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like 
[Sesamum indicum]
Length=951

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  353  IDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  390



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D+VVL AARASRTENQDAID +IVNML+DPKEARA
Sbjct  356  MDKDSVVLYAARASRTENQDAIDASIVNMLSDPKEARA  393


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D+VVL AARASRTENQDAID +IVNML+DPKEARA
Sbjct  702  MDKDSVVLYAARASRTENQDAIDASIVNMLSDPKEARA  739



>ref|XP_009333704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=942

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  352  VEKDTVVLMAARASRLENQDAIDAAIVAMLADPKEARA  389



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  358  VDKDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  395



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + VVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDKEHVVLLAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + VVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDKEHVVLLAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + VVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  289  VDKEHVVLLAARASRTENQDAIDAAIVGMLADPKEARA  326



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVLMAA+ASR ENQDAID AIV MLADPKEARA
Sbjct  357  IDADTVVLMAAQASRLENQDAIDAAIVGMLADPKEARA  394



>gb|AAD20330.1| plasma membrane proton-ATPase gene OSA3 [Oryza sativa Japonica 
Group]
Length=265

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +2

Query  11   DTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D V+LMAARASRTENQDAID AIV MLADPKEARA
Sbjct  30   DQVILMAARASRTENQDAIDTAIVGMLADPKEARA  64



>dbj|BAA94375.1| plasma membrane H+-ATPase [Nepenthes alata]
Length=186

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID A+V MLADPKEARA
Sbjct  27   VEKDHVILLAARASRTENQDAIDAAMVGMLADPKEARA  64



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VHADTVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  354  VDKDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  391



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTVVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VHADTVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>ref|XP_007204519.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
 gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
Length=965

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+LMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDKDQVILMAARASRLENQDAIDTAIVSMLADPKEARA  394



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+L++ARASR ENQDAID +IVNML DPKEARA
Sbjct  356  VDKDTVILLSARASRIENQDAIDTSIVNMLGDPKEARA  393



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL++ARASR ENQDAID +IVNMLADPKEARA
Sbjct  355  VDKDXVVLLSARASRVENQDAIDASIVNMLADPKEARA  392



>ref|XP_010529048.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=960

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+ML DPKEARA
Sbjct  357  VEKDTVVLMAARASRLENQDAIDTAIVSMLGDPKEARA  394



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV  LADPKEARA
Sbjct  357  VDADTVVLMAARASRMENQDAIDAAIVGTLADPKEARA  394



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  367  VDADAVVLMAARASRIENQDAIDTAIVGMLADPKEARA  404



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARASR ENQDAID AIV  LADPKEARA
Sbjct  357  VDADTVVLMAARASRMENQDAIDAAIVGTLADPKEARA  394



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTV+L++ARASR ENQDAID +IVNML DPKEARA
Sbjct  356  VDKDTVILLSARASRIENQDAIDTSIVNMLGDPKEARA  393



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  357  VDADAVVLMAARASRIENQDAIDTAIVGMLADPKEARA  394



>ref|XP_009608472.1| PREDICTED: ATPase 10, plasma membrane-type isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608473.1| PREDICTED: ATPase 10, plasma membrane-type isoform X1 [Nicotiana 
tomentosiformis]
Length=949

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D VVL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  361  MDKDMVVLLAARASRLENQDAIDAAIINMLADPKEARA  398



>gb|EMS68513.1| hypothetical protein TRIUR3_07571 [Triticum urartu]
Length=304

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  17   VVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+LMAARASRTENQDAID AIV MLADPKEARA
Sbjct  20   VILMAARASRTENQDAIDTAIVGMLADPKEARA  52



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASRTENQDAID A+V MLADPKEARA
Sbjct  358  VDKDHVILLAARASRTENQDAIDAAMVGMLADPKEARA  395



>emb|CAC28220.1| p-type H+-ATPase [Sesbania rostrata]
Length=245

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ + V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  14   VEKEYVILLAARASRTENQDAIDAAIVGMLADPKEARA  51



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_004515361.1| PREDICTED: plasma membrane ATPase 1-like [Cicer arietinum]
Length=965

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D +VLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  361  VDKDMIVLMAARASRLENQDAIDCAIVSMLADPKEARA  398



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_010029522.1| PREDICTED: ATPase 10, plasma membrane-type [Eucalyptus grandis]
 gb|KCW56443.1| hypothetical protein EUGRSUZ_I02171 [Eucalyptus grandis]
Length=952

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D +VL+AARASR ENQDAID AIVNMLADPKEARA
Sbjct  361  MDKDFIVLLAARASRMENQDAIDAAIVNMLADPKEARA  398



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDKEYVILLAARASRTENQDAIDAAIVGMLADPKEARA  395



>gb|EMT24919.1| Putative ATPase, plasma membrane-like protein [Aegilops tauschii]
Length=714

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL AARASRTENQDAID +IV MLADPKEARA
Sbjct  242  VDKDGVVLYAARASRTENQDAIDASIVGMLADPKEARA  279



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASRTENQDAID A+V MLADPKEARA
Sbjct  353  VDKDHVLLLAARASRTENQDAIDAAMVGMLADPKEARA  390



>emb|CBI34653.3| unnamed protein product [Vitis vinifera]
Length=1462

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    DPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            D + VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  952  DQEMVVLMAARASRLENQDAIDAAIVSMLADPKEARA  988



>ref|XP_003529039.1| PREDICTED: plasma membrane ATPase 1-like isoform 2 [Glycine max]
Length=966

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  363  VDNDMVVLMAARASRLENQDAIDCAIVSMLADPKEARA  400



>gb|KDP40607.1| hypothetical protein JCGZ_24606 [Jatropha curcas]
Length=952

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D +VL+AARASR ENQDAID AIVNMLADPKEARA
Sbjct  361  MDKDMIVLLAARASRLENQDAIDAAIVNMLADPKEARA  398



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  359  VEKDHVILLAARASRTENQDAIDAAIVGMLADPKEARA  396



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V  DTV+LMAARASRTENQDAID A V MLADPKEARA
Sbjct  357  VSQDTVILMAARASRTENQDAIDTATVGMLADPKEARA  394



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV MLADPKEARA
Sbjct  359  VDADAVVLMAARASRLENQDAIDTAIVGMLADPKEARA  396



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL++ARASR ENQDAID +IVNMLADPKEARA
Sbjct  355  VDKDGVVLLSARASRVENQDAIDASIVNMLADPKEARA  392



>ref|XP_010089311.1| Plasma membrane ATPase 1 [Morus notabilis]
 gb|EXB37636.1| Plasma membrane ATPase 1 [Morus notabilis]
Length=996

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+LMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  387  VDKDMVILMAARASRLENQDAIDTAIVSMLADPKEARA  424



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  359  VEKDHVILLAARASRTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_006602560.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
Length=77

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKE  106
            VD DTVVLMAA+ASR ENQDAID AIV MLADPKE
Sbjct  40   VDADTVVLMAAQASRLENQDAIDTAIVGMLADPKE  74



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL++ARASR ENQDAID +IVNMLADPKEARA
Sbjct  355  VDKDGVVLLSARASRVENQDAIDASIVNMLADPKEARA  392



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASRTENQDAID A+V MLADPKEARA
Sbjct  353  VDKDHVLLLAARASRTENQDAIDAAMVGMLADPKEARA  390



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL++ARASR ENQDAID +IVNMLADPKEARA
Sbjct  355  VDKDGVVLLSARASRVENQDAIDASIVNMLADPKEARA  392



>ref|XP_002991931.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii]
 gb|EFJ07042.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii]
Length=875

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + VVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  361  VDKEMVVLLAARASRTENQDAIDTAIVGMLADPKEARA  398



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VDPD V+L+AARASR ENQDAID AIV  LADPKEARA
Sbjct  355  VDPDHVLLLAARASRIENQDAIDAAIVGTLADPKEARA  392



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASRTENQDAID A+V MLADPKEARA
Sbjct  358  VDKDHVILLAARASRTENQDAIDAAMVGMLADPKEARA  395



>ref|XP_007139050.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
 ref|XP_007139051.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
 ref|XP_007139052.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
 gb|ESW11044.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
 gb|ESW11045.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
 gb|ESW11046.1| hypothetical protein PHAVU_009G260800g [Phaseolus vulgaris]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D DTVVL+AARA+R ENQDAID A+VNMLADPKEARA
Sbjct  361  MDKDTVVLLAARAARLENQDAIDTAVVNMLADPKEARA  398



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  359  VEKDHVILLAARASRTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARA+RTENQDAID AIV MLADPKEARA
Sbjct  359  VDKDHVILLAARAARTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_009608474.1| PREDICTED: ATPase 10, plasma membrane-type isoform X2 [Nicotiana 
tomentosiformis]
Length=891

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            +D D VVL+AARASR ENQDAID AI+NMLADPKEARA
Sbjct  361  MDKDMVVLLAARASRLENQDAIDAAIINMLADPKEARA  398



>gb|KHN34527.1| Plasma membrane ATPase 1 [Glycine soja]
Length=960

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+MLADPKEARA
Sbjct  357  VDNDMVVLMAARASRLENQDAIDCAIVSMLADPKEARA  394



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  355  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  392



>ref|XP_006595243.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=918

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD DTVVLMAARA+R ENQDAID AIV ML DPKEARA
Sbjct  319  VDVDTVVLMAARAARLENQDAIDAAIVGMLGDPKEARA  356



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  354  VEKDYVILLAARASRTENQDAIDAAIVGMLADPKEARA  391



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDKEQVILLAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARA+RTENQDAID AIV MLADPKEARA
Sbjct  359  VDKDHVILLAARAARTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VDKEHVILLAARASRTENQDAIDAAIVGMLADPKEARA  395



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARA+RTENQDAID AIV MLADPKEARA
Sbjct  359  VDKDHVILLAARAARTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARA+RTENQDAID AIV MLADPKEARA
Sbjct  359  VDKDHVILLAARAARTENQDAIDAAIVGMLADPKEARA  396



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ D V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  358  VEKDHVILLAARASRTENQDAIDAAIVGMLADPKEARA  395



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V ML+DPKEARA
Sbjct  358  VDKDHVVLLAARASRTENQDAIDAAMVGMLSDPKEARA  395



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASRTENQDAID A+V MLADPKEARA
Sbjct  357  VDRDHVVLLAARASRTENQDAIDAAMVGMLADPKEARA  394



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVL+AARASR ENQDAID AIVNMLADP+EARA
Sbjct  358  VDRDKVVLLAARASRVENQDAIDTAIVNMLADPQEARA  395



>gb|AAN87804.1| plasma membrane H+ ATPase [Populus alba]
Length=235

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D V+L+AARASR ENQDAID A+V MLADPKEARA
Sbjct  63   VDKDYVILLAARASRVENQDAIDAAMVGMLADPKEARA  100



>ref|XP_002979990.1| hypothetical protein SELMODRAFT_419690 [Selaginella moellendorffii]
 gb|EFJ18860.1| hypothetical protein SELMODRAFT_419690 [Selaginella moellendorffii]
Length=1144

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + VVL+AARASRTENQDAID AIV MLADPKEARA
Sbjct  361  VDKEMVVLLAARASRTENQDAIDTAIVGMLADPKEARA  398



>ref|XP_010545150.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=1175

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+ML DPKEARA
Sbjct  357  VEKDTVVLMAARASRLENQDAIDTAIVSMLGDPKEARA  394


 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            V+ DTVVLMAARASR ENQDAID AIV+ML DPKEARA
Sbjct  878  VEKDTVVLMAARASRLENQDAIDTAIVSMLGDPKEARA  915



>emb|CDP09440.1| unnamed protein product [Coffea canephora]
Length=966

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD D VVLMAARASR ENQDAID AIV+ML+DPKEARA
Sbjct  357  VDKDAVVLMAARASRIENQDAIDTAIVSMLSDPKEARA  394



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    VDPDTVVLMAARASRTENQDAIDGAIVNMLADPKEARA  115
            VD + V+L+AARASRTENQDAID AIV MLADPKEARA
Sbjct  335  VDKEHVILLAARASRTENQDAIDAAIVGMLADPKEARA  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984