BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c50963_g1_i1 len=332 path=[310:0-331]

Length=332
                                                                      Score     E

ref|XP_009594483.1|  PREDICTED: uncharacterized protein LOC104090969  79.3    2e-16   
ref|XP_009786038.1|  PREDICTED: uncharacterized protein LOC104234204  79.7    3e-15   
ref|XP_009627032.1|  PREDICTED: uncharacterized protein LOC104117664  75.1    1e-13   
ref|XP_007213486.1|  hypothetical protein PRUPE_ppa022696mg           73.2    7e-13   
ref|XP_007217848.1|  hypothetical protein PRUPE_ppa024192mg           73.6    1e-12   
ref|XP_007207920.1|  hypothetical protein PRUPE_ppa018940mg           72.4    2e-12   
ref|XP_007212994.1|  hypothetical protein PRUPE_ppa022760mg           68.9    7e-12   
ref|XP_007207754.1|  hypothetical protein PRUPE_ppa026862mg           71.2    8e-12   
ref|XP_007204932.1|  hypothetical protein PRUPE_ppa016960mg           69.3    1e-11   
ref|XP_007207873.1|  hypothetical protein PRUPE_ppa021382mg           69.7    1e-11   
ref|XP_007212530.1|  hypothetical protein PRUPE_ppa019343mg           69.7    2e-11   
ref|XP_007199214.1|  hypothetical protein PRUPE_ppa021857mg           69.3    3e-11   
ref|XP_007210252.1|  hypothetical protein PRUPE_ppa014925mg           68.9    6e-11   
ref|XP_008342753.1|  PREDICTED: uncharacterized protein LOC103405520  68.2    1e-10   
ref|XP_007201656.1|  hypothetical protein PRUPE_ppa022059mg           67.0    2e-10   
gb|ADN34118.1|  hypothetical protein                                  65.9    2e-10   
ref|XP_009343023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.4    3e-10   
ref|XP_007212521.1|  hypothetical protein PRUPE_ppa017902mg           64.7    1e-09   
gb|KDP33400.1|  hypothetical protein JCGZ_12856                       64.7    1e-09   
emb|CAN74865.1|  hypothetical protein VITISV_043090                   64.7    1e-09   Vitis vinifera
ref|XP_007203322.1|  hypothetical protein PRUPE_ppa020000mg           62.4    3e-09   
ref|XP_007225062.1|  hypothetical protein PRUPE_ppa025425mg           62.8    5e-09   
ref|XP_007208747.1|  hypothetical protein PRUPE_ppa015409mg           61.6    1e-08   
ref|XP_009378244.1|  PREDICTED: uncharacterized protein LOC103966764  59.3    3e-08   
ref|XP_009790290.1|  PREDICTED: uncharacterized protein LOC104237764  60.1    5e-08   
ref|XP_006377155.1|  hypothetical protein POPTR_0011s01240g           57.8    3e-07   
ref|XP_011002234.1|  PREDICTED: uncharacterized protein LOC105109284  57.4    5e-07   
ref|XP_006373173.1|  hypothetical protein POPTR_0017s09350g           57.4    6e-07   
ref|XP_006376080.1|  hypothetical protein POPTR_0013s08970g           53.5    4e-06   
ref|XP_002535994.1|  conserved hypothetical protein                   48.5    3e-05   Ricinus communis
ref|XP_002538435.1|  conserved hypothetical protein                   48.5    4e-05   Ricinus communis
ref|XP_009374098.1|  PREDICTED: uncharacterized protein LOC103963041  50.8    5e-05   
ref|XP_008374278.1|  PREDICTED: uncharacterized protein LOC103437571  50.4    8e-05   
ref|XP_007224673.1|  hypothetical protein PRUPE_ppa025899mg           49.7    1e-04   
gb|KDP38611.1|  hypothetical protein JCGZ_05318                       47.4    7e-04   



>ref|XP_009594483.1| PREDICTED: uncharacterized protein LOC104090969 [Nicotiana tomentosiformis]
Length=420

 Score = 79.3 bits (194),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FKM S+MA+ R ++  + VLASIY GLN IS SS    A  CFPIHYVYGWL+ Y  TH+
Sbjct  96   FKMASMMASRRKISFAVPVLASIYHGLNKISSSSQLDEAKVCFPIHYVYGWLAHYLKTHY  155


 Score = 32.7 bits (73),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 13/31 (42%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +1

Query  202  PLLRLMITYLGEGGARYYGQVEAHRKIFIAD  294
            P + LM+ Y GEG ARY+ + +A ++I   D
Sbjct  161  PSVPLMVAYSGEGAARYFDKKDARKRIHNGD  191



>ref|XP_009786038.1| PREDICTED: uncharacterized protein LOC104234204 [Nicotiana sylvestris]
Length=930

 Score = 79.7 bits (195),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFKM S+MA GR ++L + VLASIY GLN IS+SS        FPIHYVYGWL+ YF TH
Sbjct  328  TFKMASMMAGGRQISLIVPVLASIYHGLNKISRSSQLDQVKVSFPIHYVYGWLAHYFKTH  387

Query  183  F  185
            +
Sbjct  388  Y  388


 Score = 28.1 bits (61),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +1

Query  214  LMITYLGEGGARYYGQVEAHRKI  282
            LM+ Y GEG ARY+ + +  ++I
Sbjct  398  LMVAYSGEGVARYFDEKDGRKRI  420



>ref|XP_009627032.1| PREDICTED: uncharacterized protein LOC104117664 [Nicotiana tomentosiformis]
Length=397

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFKM S+MA+GR ++L + VLASIY GLN IS SS        F IHYVYGWL+ YF TH
Sbjct  183  TFKMASMMASGRKISLAVPVLASIYHGLNKISCSSQLDQVKVYFHIHYVYGWLAHYFKTH  242

Query  183  FANDLTSASPF  215
            +     S+ P 
Sbjct  243  YPLAKGSSVPL  253



>ref|XP_007213486.1| hypothetical protein PRUPE_ppa022696mg, partial [Prunus persica]
 gb|EMJ14685.1| hypothetical protein PRUPE_ppa022696mg, partial [Prunus persica]
Length=374

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G +  L + VLASIY GLN IS +  PG   +  P HYVYGWL  YF+THF
Sbjct  163  FKVASRMAHGVSFGLAVPVLASIYKGLNNISSADDPGNCTTVLPFHYVYGWLGEYFDTHF  222

Query  186  ANDLTSASP  212
             +    + P
Sbjct  223  TSSSEKSIP  231



>ref|XP_007217848.1| hypothetical protein PRUPE_ppa024192mg [Prunus persica]
 gb|EMJ19047.1| hypothetical protein PRUPE_ppa024192mg [Prunus persica]
Length=797

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G + +L + VLASIY GLN IS +  PG   +  P HYVYGWL  YF+THF
Sbjct  251  FKVASRMAHGVSFSLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFDTHF  310

Query  186  ANDLTSASP  212
             +    + P
Sbjct  311  TSSSERSIP  319



>ref|XP_007207920.1| hypothetical protein PRUPE_ppa018940mg, partial [Prunus persica]
 gb|EMJ09119.1| hypothetical protein PRUPE_ppa018940mg, partial [Prunus persica]
Length=458

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK  S MA G + +L + VLASIY GLN IS ++ PG   +  P HYVYGWL  YF+THF
Sbjct  180  FKFASRMAHGVSFSLAVPVLASIYKGLNDISSANDPGNYTTVLPFHYVYGWLGEYFDTHF  239

Query  186  ANDLTSASP  212
             +    + P
Sbjct  240  TSSSEKSIP  248



>ref|XP_007212994.1| hypothetical protein PRUPE_ppa022760mg, partial [Prunus persica]
 gb|EMJ14193.1| hypothetical protein PRUPE_ppa022760mg, partial [Prunus persica]
Length=233

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ + MA G +  L I VLASIY GLN IS +  PG   +  P HYVYGWL  YF+TH
Sbjct  161  VFKVANRMAHGVSFGLAIPVLASIYKGLNDISSADDPGNWTTILPFHYVYGWLGEYFDTH  220

Query  183  FANDLTSASPF  215
            F +    + P 
Sbjct  221  FTSSSEKSIPI  231



>ref|XP_007207754.1| hypothetical protein PRUPE_ppa026862mg [Prunus persica]
 gb|EMJ08953.1| hypothetical protein PRUPE_ppa026862mg [Prunus persica]
Length=652

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S MA G + +L + VLASIY GLN IS +  PG   +  P HYVYGWL  YF+TH
Sbjct  250  VFKVASRMAHGVSFSLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFDTH  309

Query  183  FANDLTSASPF  215
            F +    + P 
Sbjct  310  FTSSSERSIPI  320



>ref|XP_007204932.1| hypothetical protein PRUPE_ppa016960mg, partial [Prunus persica]
 gb|EMJ06131.1| hypothetical protein PRUPE_ppa016960mg, partial [Prunus persica]
Length=339

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA   + +L + VLASIY GLN IS +  PG      P HYVYGWL  YF+THF
Sbjct  162  FKVASRMAHDVSFSLAVPVLASIYKGLNDISSADDPGNCTIILPFHYVYGWLGEYFDTHF  221

Query  186  ANDLTSASP  212
             +    + P
Sbjct  222  TSSPEKSIP  230



>ref|XP_007207873.1| hypothetical protein PRUPE_ppa021382mg, partial [Prunus persica]
 gb|EMJ09072.1| hypothetical protein PRUPE_ppa021382mg, partial [Prunus persica]
Length=394

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G + +L + VLASIY GLN IS +  P    +  P HYVYGWL  YF+THF
Sbjct  290  FKVASRMAYGVSFSLAVPVLASIYKGLNDISSADDPRNCTTVLPCHYVYGWLGEYFDTHF  349

Query  186  ANDLTSASP  212
             +    + P
Sbjct  350  TSSSEKSIP  358



>ref|XP_007212530.1| hypothetical protein PRUPE_ppa019343mg [Prunus persica]
 gb|EMJ13729.1| hypothetical protein PRUPE_ppa019343mg [Prunus persica]
Length=475

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S MA G +  L + VLASIY GLN IS +  PG   +  P HYVYGWL  YFNT+
Sbjct  164  VFKVASRMAHGVSFGLAVPVLASIYKGLNDISSADDPGNCTTVLPFHYVYGWLGEYFNTY  223

Query  183  FANDLTSASPF  215
            F +    + P 
Sbjct  224  FTSSSEKSIPI  234



>ref|XP_007199214.1| hypothetical protein PRUPE_ppa021857mg [Prunus persica]
 gb|EMJ00413.1| hypothetical protein PRUPE_ppa021857mg [Prunus persica]
Length=504

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S +A G + +L + VLASIY GLN IS ++ PG      P HYVYGWL  YF+THF
Sbjct  162  FKVASRIAHGVSFSLAVPVLASIYKGLNDISSTNDPGNCTIVLPFHYVYGWLGEYFDTHF  221

Query  186  AN  191
             +
Sbjct  222  TS  223



>ref|XP_007210252.1| hypothetical protein PRUPE_ppa014925mg [Prunus persica]
 gb|EMJ11451.1| hypothetical protein PRUPE_ppa014925mg [Prunus persica]
Length=657

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA   + +L + VLA+IY GLN IS    PG   +  P HYVYGWL  YF+THF
Sbjct  275  FKVASRMAHSVSFSLAVPVLANIYKGLNDISSVDDPGNCTTVLPFHYVYGWLGEYFDTHF  334

Query  186  ANDLTSASP  212
             +    + P
Sbjct  335  TSSSEKSIP  343



>ref|XP_008342753.1| PREDICTED: uncharacterized protein LOC103405520 [Malus domestica]
Length=1161

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G + +L I VLA+IY GL V+S  ++    D+  P HYVYGWL  YF THF
Sbjct  276  FKVSSKMAAGESFSLAIPVLANIYDGLRVVSDLASTEDRDAVLPYHYVYGWLGEYFGTHF  335

Query  186  ANDLTSAS  209
            ++     S
Sbjct  336  SSSTLDKS  343



>ref|XP_007201656.1| hypothetical protein PRUPE_ppa022059mg, partial [Prunus persica]
 gb|EMJ02855.1| hypothetical protein PRUPE_ppa022059mg, partial [Prunus persica]
Length=487

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S MA G +  L + VLASIY G N IS +  PG   +  P HYVYGWL  YF+TH
Sbjct  328  VFKVASRMAHGVSFGLAVLVLASIYKGPNNISSADDPGNCKTALPFHYVYGWLGEYFDTH  387

Query  183  F  185
            F
Sbjct  388  F  388



>gb|ADN34118.1| hypothetical protein [Cucumis melo subsp. melo]
Length=701

 Score = 65.9 bits (159),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTP-GLADSCFPIHYVYGWLSFYFNTH  182
            F+  SLMA G   +L + VLA+IY GL +I+++S P    D  FP+HYV+GWL+ YF TH
Sbjct  81   FRAASLMAAGTIYSLAVLVLANIYHGLGLITKASNPIRCMDFHFPMHYVHGWLAHYFGTH  140

Query  183  F  185
            +
Sbjct  141  Y  141


 Score = 25.8 bits (55),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +1

Query  217  MITYLGEGGARYYGQVEAHRKI  282
            M  + GEGG+ Y+G+ EA   I
Sbjct  152  MTNFSGEGGSIYFGEYEARELI  173



>ref|XP_009343023.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103934981 
[Pyrus x bretschneideri]
Length=3189

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S MA G + +L I VLA+IY+GL+V+S S+      +  P HYVYGWL  YF TH
Sbjct  197  VFKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTH  256

Query  183  F  185
            F
Sbjct  257  F  257


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S MA G + +L I VLA+IY+GL+V+S S+      +  P HYVYGWL  YF TH
Sbjct  889  VFKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTH  948

Query  183  F  185
            F
Sbjct  949  F  949


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  3     TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
              FK+ S MA G + +L I VLA+IY+GL+V+S S+      +  P HYVYGWL  YF TH
Sbjct  2069  VFKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTH  2128

Query  183   F  185
             F
Sbjct  2129  F  2129


 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  3     TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
              FK+ S MA G + +L I VLA+IY+GL+V+S S+      +  P HYVYGWL  YF TH
Sbjct  2761  VFKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYGWLGEYFGTH  2820

Query  183   F  185
             F
Sbjct  2821  F  2821



>ref|XP_007212521.1| hypothetical protein PRUPE_ppa017902mg, partial [Prunus persica]
 gb|EMJ13720.1| hypothetical protein PRUPE_ppa017902mg, partial [Prunus persica]
Length=507

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G +  L + VLASIY+ LN IS +  P    +  P HYVYGWL  Y +THF
Sbjct  192  FKVASQMAYGVSFGLAVPVLASIYTRLNNISSADDPENCTTVLPFHYVYGWLGEYLDTHF  251

Query  186  ANDLTSASP  212
             +    + P
Sbjct  252  TSSSEKSIP  260



>gb|KDP33400.1| hypothetical protein JCGZ_12856 [Jatropha curcas]
Length=469

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFK+ S++A+G   +L I +LASIY GL VIS ++T    +   P HYVY WL+   N H
Sbjct  167  TFKIASIIASGEIFSLAIPILASIYRGLQVISTATTLNRCEVPLPFHYVYAWLA---NMH  223

Query  183  FANDL  197
            F +D+
Sbjct  224  FTHDV  228



>emb|CAN74865.1| hypothetical protein VITISV_043090 [Vitis vinifera]
Length=693

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 13/85 (15%)
 Frame = +3

Query  6    FKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF  185
            FK+ S MA G T +L + VLA++Y+GLN I+ SS      S FPIH++YGWL  YF+T+F
Sbjct  202  FKVASKMAQGETFSLVVPVLANMYNGLNEIACSSKLETNASIFPIHFLYGWLGEYFDTYF  261

Query  186  AN-------------DLTSASPFDD  221
             +             D  SA  FDD
Sbjct  262  ISPSWNHPTRMTYYADEFSAKCFDD  286



>ref|XP_007203322.1| hypothetical protein PRUPE_ppa020000mg, partial [Prunus persica]
 gb|EMJ04521.1| hypothetical protein PRUPE_ppa020000mg, partial [Prunus persica]
Length=320

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK  S MA G + +L + VLASIY GLN IS +   G   +  P HYVY WL  YF+T+
Sbjct  138  VFKFASRMAHGVSFSLAVPVLASIYKGLNDISSADDSGNCTTVLPFHYVYRWLGEYFDTY  197

Query  183  FANDLTSASP  212
            F +    + P
Sbjct  198  FTSSSEKSLP  207



>ref|XP_007225062.1| hypothetical protein PRUPE_ppa025425mg, partial [Prunus persica]
 gb|EMJ26261.1| hypothetical protein PRUPE_ppa025425mg, partial [Prunus persica]
Length=548

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  15   VSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHFAND  194
            V+L+  G      I VLASIY GLN IS ++  G   +  P HYVYGWL  YF+THF + 
Sbjct  156  VTLIRPGVFKVAAIPVLASIYKGLNDISSANDLGNCATILPFHYVYGWLGEYFDTHFTSS  215

Query  195  LTSASPFDDHLLG  233
               ++P     LG
Sbjct  216  SEKSTPIMTRFLG  228



>ref|XP_007208747.1| hypothetical protein PRUPE_ppa015409mg [Prunus persica]
 gb|EMJ09946.1| hypothetical protein PRUPE_ppa015409mg [Prunus persica]
Length=518

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +3

Query  45   NLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHFANDLTSASPFDDH  224
            +L + VLASIY GLN IS +  PG   +  P HYVYGWL  YF THF +    + P    
Sbjct  214  DLSVPVLASIYKGLNDISSADDPGNCTTILPFHYVYGWLGEYFGTHFTSSSEKSIPIMAR  273

Query  225  LLG  233
             LG
Sbjct  274  FLG  276



>ref|XP_009378244.1| PREDICTED: uncharacterized protein LOC103966764 [Pyrus x bretschneideri]
Length=300

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
             FK+ S M TG + +L I VLA+IY+GL+++S S++        P HYVY WL  YF  H
Sbjct  203  VFKVASKMVTGESFSLAIPVLANIYNGLSIVSNSASTEDHAVVLPYHYVYDWLVEYFGNH  262

Query  183  FAN  191
            F++
Sbjct  263  FSS  265



>ref|XP_009790290.1| PREDICTED: uncharacterized protein LOC104237764 [Nicotiana sylvestris]
Length=601

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  24   MATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            MA G   +L + VLASIY GL  IS S+    +D  FPIHYVYGW+  YF TH
Sbjct  1    MAHGVKFSLAVPVLASIYRGLREISTSNDLIASDVIFPIHYVYGWMGEYFETH  53



>ref|XP_006377155.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa]
 gb|ERP54952.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa]
Length=625

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFK+ SLMA GR  +L I VLASI+ GL  +  + +    D  FPIH++  WL+  F TH
Sbjct  238  TFKVASLMAAGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTH  297



>ref|XP_011002234.1| PREDICTED: uncharacterized protein LOC105109284 [Populus euphratica]
Length=997

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFK+ S+MA GR  +L I VLASI+ GL  +  + +    D  FPIH++  WL+  F TH
Sbjct  332  TFKVASMMAVGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTH  391



>ref|XP_006373173.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa]
 gb|ERP50970.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa]
Length=946

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFK+ S+MA GR  +L I VLASI+ GL  +  + +    D  FPIH++  WL+  F TH
Sbjct  309  TFKVASMMAVGRQFSLAIPVLASIFKGLKEVQSALSVTARDIPFPIHFLSSWLAEKFGTH  368



>ref|XP_006376080.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa]
 gb|ERP53877.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa]
Length=334

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTH  182
            TFK+ S+MA GR  +L I VL SI+ GL  +  + +    D  FPIH++  WL+  F TH
Sbjct  93   TFKVASMMAVGRQFSLAIPVLTSIFKGLKEVQFALSVTARDIHFPIHFLSSWLAEKFGTH  152



>ref|XP_002535994.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26390.1| conserved hypothetical protein [Ricinus communis]
Length=110

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = +3

Query  12   MVSLMATGRTLNLGIHVLASIYSGLNVISQSST-PGLADSCFPIHYVYGWLSFYF  173
            M   +  G+ + +   VLASIY GL  ++Q    PG  ++ FP+HY Y WL  YF
Sbjct  1    MAGFLVQGKRVAIAPAVLASIYYGLGAVAQDKLGPGQCNAEFPVHYFYAWLDQYF  55



>ref|XP_002538435.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF23949.1| conserved hypothetical protein [Ricinus communis]
Length=112

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (2%)
 Frame = +3

Query  12   MVSLMATGRTLNLGIHVLASIYSGLNVISQSST-PGLADSCFPIHYVYGWLSFYF  173
            M   +  G+ + +   VLASIY GL  ++Q    PG  ++ FP+HY Y WL  YF
Sbjct  1    MAGFLVQGKRVAIAPAVLASIYYGLGAVAQDKLGPGQCNAEFPVHYFYAWLDQYF  55



>ref|XP_009374098.1| PREDICTED: uncharacterized protein LOC103963041 [Pyrus x bretschneideri]
Length=392

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYG  155
             FK+ S MA G + +L I VLA+IY+GL+V+S S+      +  P HYVYG
Sbjct  342  VFKVASKMAAGESFSLAIPVLANIYNGLSVVSNSANTADRAAVLPYHYVYG  392



>ref|XP_008374278.1| PREDICTED: uncharacterized protein LOC103437571 [Malus domestica]
Length=751

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  63   LASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHF-ANDLTSASPF  215
            L++IY GL V+S  ++    D+  P HYVYGWL  YF THF ++ L  + PF
Sbjct  270  LSNIYDGLRVVSDLASTEDRDAVLPYHYVYGWLGEYFGTHFXSSTLDKSGPF  321



>ref|XP_007224673.1| hypothetical protein PRUPE_ppa025899mg [Prunus persica]
 gb|EMJ25872.1| hypothetical protein PRUPE_ppa025899mg [Prunus persica]
Length=440

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  63   LASIYSGLNVISQSSTPGLADSCFPIHYVYGWLSFYFNTHFANDLTSASP  212
            +A IY GLN IS +   G   +  P +YVYGWL  YF+THF +    + P
Sbjct  220  MARIYKGLNDISSADDLGNCTTVLPFNYVYGWLGEYFDTHFTSSSEKSIP  269



>gb|KDP38611.1| hypothetical protein JCGZ_05318 [Jatropha curcas]
Length=523

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    TFKMVSLMATGRTLNLGIHVLASIYSGLNVISQSSTPGLADSCFPIHYVYG  155
            TFK+ S++A G   +L I +LA+IY GL  IS ++T    +   P HYVY 
Sbjct  267  TFKVASMIAFGEIFSLAIPILANIYRGLRAISTATTLKRCEVPLPFHYVYA  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688