BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c50544_g1_i1 len=682 path=[660:0-681]

Length=682
                                                                      Score     E

ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...    135   2e-36   
ref|XP_009594799.1|  PREDICTED: non-specific lipid-transfer prote...    132   5e-35   
ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...    131   3e-34   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...    129   5e-34   
ref|XP_009631015.1|  PREDICTED: non-specific lipid-transfer prote...    128   8e-34   
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...    129   2e-33   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...    126   1e-32   
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...    125   1e-32   
emb|CDP12680.1|  unnamed protein product                                116   4e-29   
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...    113   9e-28   
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...    112   1e-27   
gb|AAL27855.1|  lipid transfer protein precursor                        112   2e-27   Davidia involucrata
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...    111   3e-27   
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...    111   4e-27   
emb|CDP15101.1|  unnamed protein product                                111   5e-27   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg                110   6e-27   
gb|ABY21307.1|  pollen allergen Pla o 3                                 110   8e-27   Platanus orientalis
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...    110   1e-26   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...    109   2e-26   
emb|CAL07989.1|  lipid transfer protein                                 109   3e-26   Platanus x hispanica [London plane tree]
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...    109   3e-26   
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...    109   3e-26   
ref|NP_001055844.2|  Os05g0477900                                       109   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...    108   4e-26   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...    108   4e-26   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor     108   5e-26   
gb|ACQ42221.1|  lipid transfer protein                                  108   5e-26   Chimonanthus praecox [wintersweet]
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...    107   9e-26   
gb|ACZ06858.1|  lipid transfer protein                                  107   1e-25   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...    107   1e-25   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein           107   1e-25   Retama raetam [retem]
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...    107   1e-25   
gb|AAT01364.1|  unknown protein                                         107   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...    106   3e-25   
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...    106   4e-25   
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...    105   5e-25   
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg                105   7e-25   
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...    105   7e-25   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...    105   8e-25   Lens culinaris
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...    105   9e-25   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor     105   9e-25   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...    105   9e-25   
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...    105   1e-24   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...    105   1e-24   Lens culinaris
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg                104   1e-24   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...    104   1e-24   
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g             104   2e-24   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...    104   2e-24   
emb|CDY00655.1|  BnaC03g36390D                                          103   3e-24   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...    103   3e-24   Lens culinaris
gb|AFM35695.1|  nonspecific lipid transfer protein                      103   3e-24   
ref|XP_009396870.1|  PREDICTED: non-specific lipid-transfer prote...    103   4e-24   
ref|XP_009396875.1|  PREDICTED: non-specific lipid-transfer prote...    103   4e-24   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...    103   4e-24   Lens culinaris
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...    103   5e-24   
ref|XP_008792224.1|  PREDICTED: non-specific lipid-transfer prote...    103   6e-24   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg             103   6e-24   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...    103   7e-24   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...    102   9e-24   
emb|CDX73941.1|  BnaA03g31060D                                          102   1e-23   
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...    102   1e-23   
ref|XP_010931359.1|  PREDICTED: non-specific lipid-transfer prote...    102   1e-23   
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...    102   1e-23   
gb|ACP43542.1|  lipid transfer protein                                  102   2e-23   Chimonanthus praecox [wintersweet]
gb|AAQ96338.1|  lipid transfer protein                                  101   2e-23   Vitis aestivalis
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...    101   2e-23   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...    101   2e-23   
gb|AAY84146.1|  lipid transfer protein                                  101   3e-23   Catharanthus roseus [chatas]
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...    101   3e-23   Leonurus japonicus [Chinese motherwort]
gb|AAT68264.1|  lipid transfer protein                                  100   4e-23   Nicotiana glauca [glaucous tobacco]
gb|AAT68262.1|  lipid transfer protein                                  100   5e-23   Nicotiana glauca [glaucous tobacco]
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...    100   5e-23   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...    100   5e-23   Lens culinaris
ref|XP_009618455.1|  PREDICTED: non-specific lipid-transfer prote...    100   5e-23   
gb|AAT68263.1|  lipid transfer protein                                  100   5e-23   Nicotiana glauca [glaucous tobacco]
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...    100   9e-23   
emb|CDY27974.1|  BnaC05g43760D                                        99.4    1e-22   
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  99.8    1e-22   
ref|XP_003566138.1|  PREDICTED: non-specific lipid-transfer prote...  99.8    1e-22   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  99.0    1e-22   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          99.4    1e-22   Lactuca sativa [cultivated lettuce]
gb|AAS13435.1|  lipid-transfer protein                                99.0    2e-22   Nicotiana attenuata
gb|AEI70828.1|  non-specific lipid-transfer protein                   99.0    2e-22   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      99.0    2e-22   Avicennia marina
ref|XP_002872988.1|  predicted protein                                98.6    3e-22   
ref|XP_009146980.1|  PREDICTED: non-specific lipid-transfer prote...  98.6    3e-22   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      98.2    3e-22   Nicotiana glauca [glaucous tobacco]
emb|CBW38498.1|  lipid transfer protein                               97.8    3e-22   
gb|AGH32497.1|  non-specific lipid transfer protein                   98.2    3e-22   
emb|CDY36007.1|  BnaA05g29430D                                        98.2    3e-22   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  97.4    3e-22   
emb|CCJ09772.1|  putative non-specific lipid transfer protein         97.4    3e-22   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    4e-22   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            98.2    4e-22   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            98.2    4e-22   
gb|KEH29195.1|  Lipid transfer protein                                99.4    5e-22   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  97.4    6e-22   Helianthus annuus
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    97.4    6e-22   
gb|AGH13363.1|  lipid transfer protein                                97.1    7e-22   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    8e-22   
emb|CBW38501.1|  lipid transfer protein                               96.7    8e-22   
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  97.1    9e-22   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  97.1    1e-21   
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  96.7    1e-21   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  96.7    1e-21   
gb|ACQ42222.1|  lipid transfer protein 1                              96.7    1e-21   Chimonanthus praecox [wintersweet]
emb|CAA42832.1|  LTP 1                                                97.1    2e-21   Hordeum vulgare [barley]
gb|AAT68265.1|  lipid transfer protein precursor                      96.3    2e-21   Nicotiana glauca [glaucous tobacco]
emb|CBW38502.1|  lipid transfer protein                               95.9    2e-21   
gb|AEI70830.1|  non-specific lipid-transfer protein                   96.3    2e-21   
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  96.3    2e-21   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  96.3    2e-21   Hordeum vulgare [barley]
dbj|BAK05317.1|  predicted protein                                    96.3    2e-21   
gb|ABH03042.1|  non-specific lipid transfer protein                   95.9    2e-21   Solanum sogarandinum
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  96.3    2e-21   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  95.9    2e-21   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  95.1    3e-21   Morus nigra
gb|AEN70919.1|  lipid transfer protein                                95.9    3e-21   
gb|ABP01769.1|  lipid transfer protein 2                              95.9    3e-21   Salvia miltiorrhiza [Chinese salvia]
gb|ADV02773.1|  lipid transfer protein 1b                             95.1    3e-21   
dbj|BAC77694.1|  lipid transfer protein                               95.9    3e-21   Atriplex nummularia
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  95.9    3e-21   Solanum pennellii
ref|NP_001268074.1|  lipid transfer protein precursor                 95.9    3e-21   
ref|XP_002323667.1|  putative lipid transfer family protein           95.9    3e-21   Populus trichocarpa [western balsam poplar]
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 95.1    3e-21   
gb|AEI70827.1|  non-specific lipid-transfer protein                   95.5    3e-21   
gb|AGH32496.1|  non-specific lipid transfer protein                   95.5    3e-21   
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           95.5    3e-21   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        95.5    4e-21   Vitis cinerea var. helleri x Vitis vinifera
ref|XP_009778826.1|  PREDICTED: uncharacterized protein LOC104228120  98.2    4e-21   
gb|AHG99490.1|  lipid-transfer protein                                95.5    4e-21   
ref|NP_187489.1|  lipid-transfer protein 6                            95.5    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407744.1|  hypothetical protein EUTSA_v10021759mg           95.5    4e-21   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    5e-21   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  95.5    5e-21   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    5e-21   
gb|AEN70936.1|  lipid transfer protein                                95.1    5e-21   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    5e-21   
dbj|BAO51648.1|  lipid transfer protein                               95.1    6e-21   
ref|NP_001189842.1|  lipid-transfer protein 6                         95.1    6e-21   
ref|XP_010277659.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    6e-21   
gb|AAF14232.1|AF109195_1  lipid transfer protein                      95.1    6e-21   Hordeum vulgare [barley]
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              94.7    6e-21   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    6e-21   
emb|CDP14198.1|  unnamed protein product                              94.7    7e-21   
emb|CBW38497.1|  lipid transfer protein                               94.4    7e-21   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  94.7    7e-21   Solanum chilense
gb|AEN70933.1|  lipid transfer protein                                94.7    7e-21   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    8e-21   
ref|XP_010464489.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    8e-21   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   94.7    9e-21   
ref|NP_001275802.1|  lipid-transfer protein precursor                 94.4    9e-21   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    94.7    9e-21   Nicotiana tabacum [American tobacco]
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  94.4    9e-21   Lens culinaris
emb|CBW38499.1|  lipid transfer protein                               94.0    9e-21   
emb|CCK33472.1|  lipid transfer protein precursor                     93.6    9e-21   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    9e-21   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    1e-20   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  94.7    1e-20   
gb|AEI70829.1|  non-specific lipid-transfer protein                   94.0    1e-20   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  94.0    1e-20   Tamarix hispida
gb|AEN70915.1|  lipid transfer protein                                94.0    1e-20   
ref|XP_002532868.1|  Nonspecific lipid-transfer protein precursor...  94.0    1e-20   Ricinus communis
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        93.6    2e-20   Capsicum annuum
ref|XP_008463259.1|  PREDICTED: non-specific lipid-transfer prote...  94.0    2e-20   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   94.0    2e-20   
ref|XP_010922734.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    2e-20   
gb|AEN70918.1|  lipid transfer protein                                93.6    2e-20   
ref|XP_009372010.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    2e-20   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    2e-20   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  93.6    2e-20   Cicer arietinum [garbanzo]
gb|ABA29446.1|  non-specific lipid transfer protein                   93.6    2e-20   Vitis vinifera
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    2e-20   
emb|CBW38504.1|  lipid transfer protein                               92.8    2e-20   
emb|CBW38503.1|  lipid transfer protein                               92.8    2e-20   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           93.2    2e-20   
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  93.2    2e-20   
ref|NP_001044654.1|  Os01g0822900                                     93.2    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003605293.1|  Non-specific lipid-transfer protein              93.2    3e-20   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            93.2    3e-20   Gossypium hirsutum [American cotton]
ref|XP_002323072.2|  hypothetical protein POPTR_0016s14290g           94.0    3e-20   Populus trichocarpa [western balsam poplar]
gb|AFK37572.1|  unknown                                               93.2    3e-20   
gb|AGC08426.1|  lipid transfer protein                                93.2    3e-20   
gb|AAY43800.1|  FSLTP2                                                93.2    3e-20   Gossypium hirsutum [American cotton]
ref|NP_001268120.1|  lipid transfer protein precursor                 93.2    3e-20   
dbj|BAP11219.1|  hypothetical protein                                 92.8    3e-20   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  93.2    3e-20   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  92.8    4e-20   Prunus avium [gean]
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    4e-20   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           93.2    4e-20   
gb|AEN70917.1|  lipid transfer protein                                92.8    4e-20   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              98.6    4e-20   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  92.8    4e-20   Triticum aestivum [Canadian hard winter wheat]
gb|ACN11576.1|  lipid transfer protein 3 precursor                    92.8    4e-20   Prunus dulcis [sweet almond]
gb|ADR66942.1|  non-specific lipid transfer protein                   92.8    4e-20   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    4e-20   
dbj|BAP11221.1|  hypothetical protein                                 92.4    4e-20   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  92.4    4e-20   Ricinus communis
emb|CAH69198.1|  type 1 non specific lipid transfer protein precu...  92.8    4e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           92.4    4e-20   
ref|XP_011002608.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    4e-20   
ref|XP_002884695.1|  hypothetical protein ARALYDRAFT_478179           92.4    5e-20   
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  92.8    5e-20   Triticum aestivum [Canadian hard winter wheat]
gb|AFK46170.1|  unknown                                               92.4    5e-20   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    92.8    5e-20   Prunus persica
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    5e-20   
ref|XP_010253093.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    5e-20   
gb|AFI61838.1|  harmalin                                              92.4    5e-20   
gb|AEI70826.1|  non-specific lipid-transfer protein                   92.4    5e-20   
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       92.4    5e-20   
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    5e-20   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    92.4    5e-20   
gb|AAT80649.1|  lipid transfer protein precursor                      92.4    5e-20   Malus domestica [apple tree]
gb|AGW21333.1|  lipid transfer protein                                92.4    6e-20   
gb|AGH27864.1|  lipid transfer protein precursor                      92.4    6e-20   
gb|ADR66943.1|  non-specific lipid transfer protein                   92.4    6e-20   
dbj|BAP11220.1|  hypothetical protein                                 92.0    6e-20   
gb|KHG21711.1|  Non-specific lipid-transfer                           92.4    6e-20   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    6e-20   
dbj|BAP11226.1|  hypothetical protein                                 92.0    6e-20   
gb|AFR43276.1|  lipid transfer protein precursor                      92.4    6e-20   
gb|AEN70916.1|  lipid transfer protein                                92.4    6e-20   
dbj|BAP11218.1|  hypothetical protein                                 92.0    7e-20   
gb|ABQ53932.1|  lipid transfer protein                                92.0    7e-20   Sesamum indicum [beniseed]
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              92.0    7e-20   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  92.0    7e-20   
ref|XP_011091598.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    7e-20   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    7e-20   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            92.0    8e-20   Gossypium hirsutum [American cotton]
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    8e-20   
emb|CDO96795.1|  unnamed protein product                              92.0    8e-20   
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    8e-20   
ref|XP_010464583.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    9e-20   
ref|NP_001176316.1|  Os11g0115466                                     91.7    9e-20   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    9e-20   
ref|NP_001065986.1|  Os12g0115000                                     91.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  91.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 91.7    1e-19   
ref|XP_007017080.1|  Bifunctional inhibitor/lipid-transfer protei...  92.8    1e-19   
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  91.7    1e-19   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 91.7    1e-19   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 95.9    1e-19   
gb|AAA74624.1|  lipid transfer protein precursor                      91.3    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    91.3    1e-19   
gb|KHG30577.1|  Non-specific lipid-transfer                           91.3    1e-19   
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  91.3    1e-19   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    91.3    1e-19   Gossypium hirsutum [American cotton]
gb|AAK28533.1|AF329829_1  lipid transfer protein precursor            91.3    1e-19   Corylus avellana [European hazelnut]
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  91.3    1e-19   
ref|XP_010253092.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       90.9    2e-19   
emb|CDP14199.1|  unnamed protein product                              90.9    2e-19   
gb|AAB70539.1|  lipid transfer protein LPT II                         90.9    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|WP_039311159.1|  hypothetical protein                             90.5    2e-19   
gb|ADK60918.1|  lipid transfer protein                                90.9    2e-19   
gb|AAQ74627.1|  lipid transfer protein I                              90.9    2e-19   Vigna radiata [mung bean]
gb|ABB96481.1|  non-specific lipid transfer protein precursor         90.5    2e-19   Malus domestica [apple tree]
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
gb|ADY68820.1|  lipid transfer protein 3                              90.9    2e-19   
gb|ABK94706.1|  unknown                                               90.5    2e-19   Populus trichocarpa [western balsam poplar]
gb|ADR66950.1|  non-specific lipid transfer protein                   90.5    2e-19   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    90.5    2e-19   
gb|AAY43801.1|  FSLTP3                                                90.5    2e-19   Gossypium hirsutum [American cotton]
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
gb|AET05731.1|  lipid transfer protein isoform b                      89.7    2e-19   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  90.5    3e-19   
gb|ABE11609.1|  lipid-transfer protein precursor                      90.5    3e-19   Solanum chacoense
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  90.5    3e-19   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            90.5    3e-19   Gossypium hirsutum [American cotton]
ref|XP_011091592.1|  PREDICTED: non-specific lipid-transfer prote...  90.5    3e-19   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  90.1    3e-19   Capsicum annuum
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  90.5    3e-19   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    3e-19   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  90.1    3e-19   Gerbera hybrid cultivar
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  90.1    3e-19   Prunus dulcis [sweet almond]
gb|AET05730.1|  lipid transfer protein isoform a                      89.4    3e-19   
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    3e-19   
gb|AGC08428.1|  lipid transfer protein                                90.5    3e-19   
gb|AAR22488.1|  allergen Mal d 3                                      90.1    3e-19   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  90.1    3e-19   
gb|ABK96515.1|  unknown                                               90.1    3e-19   
gb|KHL91133.1|  hypothetical protein QW71_36410                       90.1    3e-19   
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           90.1    4e-19   
gb|AER92599.1|  putative lipid transfer protein                       90.1    4e-19   
gb|AES87466.2|  Lipid transfer protein                                90.9    4e-19   
gb|AGH13362.1|  lipid transfer protein                                89.7    4e-19   
emb|CAH69210.1|  type 1 non specific lipid transfer protein precu...  90.1    4e-19   
gb|ADR66953.1|  non-specific lipid transfer protein                   90.1    4e-19   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    4e-19   
gb|AEC04836.1|  lipid transfer protein                                89.7    4e-19   
ref|XP_002305878.2|  lipid transfer family protein                    90.1    4e-19   
dbj|BAI94496.1|  lipid transfer protein                               90.1    4e-19   
gb|AEN70935.1|  lipid transfer protein                                90.1    4e-19   
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    4e-19   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    4e-19   
gb|ACM78614.1|  lipid transfer protein 2                              89.7    4e-19   
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  89.7    4e-19   
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    5e-19   
gb|ADR66949.1|  non-specific lipid transfer protein                   89.7    5e-19   
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    5e-19   
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    5e-19   
gb|KEH29225.1|  Lipid transfer protein                                89.7    5e-19   
pdb|1BE2|A  Chain A, Lipid Transfer Protein Complexed With Palmit...  89.0    5e-19   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           89.7    5e-19   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    5e-19   
pdb|1MID|A  Chain A, Non-Specific Lipid Transfer Protein 1 From B...  89.0    6e-19   
emb|CAH04985.1|  type 1 non-specific lipid transfer protein precu...  89.7    6e-19   
ref|XP_008798559.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    6e-19   
dbj|BAI94497.1|  lipid transfer protein                               89.7    6e-19   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   89.4    6e-19   
gb|ACB05670.1|  putative non-specific lipid transfer protein          89.4    6e-19   
gb|AEG79730.1|  lipid transfer protein precursor                      89.7    6e-19   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    89.0    6e-19   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   89.4    6e-19   
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    6e-19   
emb|CAB96874.1|  mal d 3                                              88.6    7e-19   
gb|AFK38461.1|  unknown                                               89.4    7e-19   
ref|NP_001065988.1|  Os12g0115300                                     89.4    7e-19   
ref|NP_001065585.1|  Os11g0116000                                     89.4    7e-19   
gb|EAY79716.1|  hypothetical protein OsI_34868                        89.4    7e-19   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  89.4    7e-19   
gb|ACL01093.1|  lipid transfer protein                                89.4    7e-19   
emb|CCD33109.1|  lipid transfer protein                               89.4    7e-19   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 90.1    7e-19   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    7e-19   
gb|ACU24604.1|  unknown                                               89.7    7e-19   
gb|AAX08122.1|  lipid transfer protein III                            89.4    8e-19   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    8e-19   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    8e-19   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           89.7    8e-19   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              89.4    8e-19   
gb|AFK44274.1|  unknown                                               89.0    8e-19   
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    89.0    8e-19   
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       89.0    8e-19   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    9e-19   
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   89.0    9e-19   
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  89.0    9e-19   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    1e-18   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    89.0    1e-18   
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    1e-18   
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    1e-18   
ref|NP_001147136.1|  LOC100280743 precursor                           89.0    1e-18   
ref|XP_010043259.1|  PREDICTED: non-specific lipid-transfer prote...  89.0    1e-18   
gb|EPS73761.1|  non-specific lipid-transfer protein                   89.0    1e-18   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        89.0    1e-18   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    1e-18   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  89.0    1e-18   
gb|AFK36168.1|  unknown                                               88.6    1e-18   
gb|KDP20367.1|  hypothetical protein JCGZ_05250                       88.6    1e-18   
sp|O24037.1|NLTP1_SOLPN  RecName: Full=Non-specific lipid-transfe...  88.6    1e-18   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       88.2    2e-18   
ref|XP_006369492.1|  hypothetical protein POPTR_0001s23940g           88.6    2e-18   
dbj|BAB09777.1|  lipid transfer protein-like                          88.2    2e-18   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   88.2    2e-18   
emb|CAA80809.1|  lipid transfer protein                               88.2    2e-18   
gb|ACM78613.1|  lipid transfer protein 1                              88.2    2e-18   
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    2e-18   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    88.2    2e-18   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    2e-18   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    2e-18   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  87.8    2e-18   
ref|XP_003605269.1|  Non-specific lipid-transfer protein              89.0    3e-18   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               87.8    3e-18   
gb|AAQ74628.1|  lipid tranfer protein II                              87.8    3e-18   
ref|XP_008778766.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    3e-18   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           87.4    3e-18   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 87.8    3e-18   
ref|XP_008779709.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    3e-18   
emb|CAC86258.1|  lipid transfer protein                               87.8    3e-18   
emb|CAY54132.1|  lipid transfer protein precursor                     87.0    3e-18   
gb|ADD13588.1|  non-specific lipid transfer protein 1                 87.4    3e-18   
ref|XP_007140089.1|  hypothetical protein PHAVU_008G083400g           87.8    3e-18   
gb|AHB19226.1|  non specific lipid transfer protein 1B                87.4    3e-18   
gb|AAT80650.1|  lipid transfer protein precursor                      87.4    3e-18   
gb|AAT80652.1|  lipid transfer protein precursor                      87.4    3e-18   
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  87.4    3e-18   
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    3e-18   
gb|ABY54820.1|  lipid transfer protein                                87.4    4e-18   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         87.4    4e-18   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           87.4    4e-18   
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  87.4    4e-18   
gb|ABG54494.1|  putative allergen Rub i 3                             87.4    4e-18   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    4e-18   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    4e-18   
dbj|BAI94498.1|  lipid transfer protein                               87.4    4e-18   
gb|ABF06565.1|  non-specific lipid transfer-like protein              87.4    4e-18   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    87.0    4e-18   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         87.0    4e-18   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   
ref|XP_009398877.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    4e-18   
gb|ACE07187.1|  Art v 3 allergen precursor                            87.0    4e-18   
gb|AAM22768.1|  lipid transfer protein                                86.3    5e-18   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         87.0    5e-18   
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   87.0    5e-18   
gb|KCW88359.1|  hypothetical protein EUGRSUZ_A00745                   88.2    5e-18   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    5e-18   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    6e-18   
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    6e-18   
gb|ABU49731.1|  putative non-specific lipid transfer protein a1       86.7    6e-18   
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  86.7    6e-18   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           86.7    6e-18   
gb|AAP92127.1|  lipid transfer protein LPT1                           86.7    6e-18   
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 87.0    7e-18   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           86.7    7e-18   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    7e-18   
gb|ADR66946.1|  non-specific lipid transfer protein                   86.7    7e-18   
gb|ACN31691.1|  unknown                                               89.0    7e-18   
gb|AAX20049.1|  putative non-specific lipid transfer protein          86.3    7e-18   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    8e-18   
gb|AAB70538.1|  lipid transfer protein                                86.3    8e-18   
gb|AGH27863.1|  lipid transfer protein precursor                      86.7    8e-18   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               86.3    8e-18   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 86.3    9e-18   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    9e-18   
gb|EYU42011.1|  hypothetical protein MIMGU_mgv1a016819mg              85.9    9e-18   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       86.3    9e-18   
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           86.3    9e-18   
gb|AAT80665.1|  lipid transfer protein precursor                      85.9    1e-17   
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    1e-17   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               86.3    1e-17   
gb|AHB19227.1|  non specific lipid transfer protein 1A                85.9    1e-17   
gb|AGH27866.1|  lipid transfer protein precursor                      85.9    1e-17   
emb|CDM80963.1|  unnamed protein product                              85.9    1e-17   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       85.9    1e-17   
gb|ACM78619.1|  non-specific lipid-transfer protein type 1            85.9    1e-17   
gb|AET05733.1|  lipid transfer protein isoform d                      85.1    1e-17   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  85.9    1e-17   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 85.9    1e-17   
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  88.6    1e-17   
gb|ABX75045.1|  LTP isoallergen 2                                     85.1    2e-17   
gb|ADK36632.1|  lipid transfer-like protein                           85.1    2e-17   
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        85.9    2e-17   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  85.9    2e-17   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  84.7    2e-17   
ref|XP_006346674.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           85.5    2e-17   
gb|AAL25839.1|  lipid transfer precursor protein                      85.5    2e-17   
dbj|BAK04894.1|  predicted protein                                    85.5    2e-17   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           85.5    2e-17   
ref|NP_001274465.1|  non-specific lipid-transfer protein 3-like p...  85.5    2e-17   
gb|ACE80968.1|  putative allergen Pru du 3.03                         85.5    2e-17   
gb|AET05732.1|  lipid transfer protein isoform c                      84.7    2e-17   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              85.1    2e-17   
gb|ABO28527.1|  lipid transfer protein                                85.1    2e-17   
ref|XP_008244949.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
ref|XP_003579022.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   85.1    3e-17   
ref|XP_006438990.1|  hypothetical protein CICLE_v10033098mg           85.1    3e-17   
gb|ADR66945.1|  non-specific lipid transfer protein                   85.1    3e-17   
gb|AAF23459.1|AF208833_1  non-specific lipid transfer protein pre...  85.1    3e-17   
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    84.7    3e-17   
ref|XP_003605349.1|  Non-specific lipid-transfer protein              85.1    3e-17   
gb|AGW21344.1|  lipid transfer protein                                85.1    3e-17   
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  84.7    3e-17   
gb|ACP30545.1|  lipid transfer protein precursor                      84.7    3e-17   
emb|CAH03799.1|  lipid transfer protein                               84.3    3e-17   
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    84.7    3e-17   
gb|ABP01768.1|  lipid transfer protein 1                              84.7    3e-17   
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           84.7    3e-17   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    3e-17   
gb|AAT80663.1|  lipid transfer protein precursor                      84.7    3e-17   
gb|ACE80969.1|  putative allergen Pru p 3.03                          84.7    3e-17   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  84.0    3e-17   
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  84.7    3e-17   
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    4e-17   
gb|AFK48111.1|  unknown                                               84.7    4e-17   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    4e-17   
ref|XP_003522128.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    4e-17   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         84.7    4e-17   
emb|CAB96876.2|  pru p 1                                              84.0    4e-17   
ref|XP_010091032.1|  Non-specific lipid-transfer protein              85.9    4e-17   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           84.3    4e-17   
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  84.7    4e-17   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    4e-17   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    4e-17   
gb|ABA33862.1|  phospholipid transfer protein 1                       84.3    4e-17   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   84.3    4e-17   
pir||EPRZ  phospholipid transfer protein homolog - rice               84.0    4e-17
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              84.3    4e-17   
sp|P27631.1|NLTP_DAUCA  RecName: Full=Non-specific lipid-transfer...  84.3    4e-17   
emb|CAA69949.1|  lipid transfer protein                               84.3    4e-17   
ref|XP_007206596.1|  hypothetical protein PRUPE_ppa020486mg           84.3    4e-17   
ref|XP_006295252.1|  hypothetical protein CARUB_v10024340mg           84.3    4e-17   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 84.3    4e-17   
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
emb|CAY54133.1|  lipid transfer protein precursor                     83.6    5e-17   
emb|CAG28937.1|  lipid transfer protein                               84.3    5e-17   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        84.3    5e-17   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  83.6    5e-17   
gb|AAZ32875.1|  lipid transfer protein precursor                      83.2    5e-17   
ref|XP_010043282.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    5e-17   
gb|KHN33231.1|  Non-specific lipid-transfer protein 1                 84.7    5e-17   
gb|ACE07189.1|  Art v 3 allergen precursor                            84.3    5e-17   
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    84.0    5e-17   
emb|CDX71121.1|  BnaC03g12050D                                        84.3    5e-17   
sp|Q42762.1|NLTP1_GOSHI  RecName: Full=Non-specific lipid-transfe...  84.3    5e-17   



>ref|XP_009778825.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=115

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ++ +TCDTVY +L+PCL+Y+LFG ++ S+CC GVK+L+S A TTADRQSACSC+KS
Sbjct  18   APPAKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLISTATTTADRQSACSCVKS  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +ASRA   +LSRAA IPGKCG + P+ + PNVDCSKV
Sbjct  78   LASRATGDELSRAAGIPGKCGANVPFDISPNVDCSKV  114



>ref|XP_009594799.1| PREDICTED: non-specific lipid-transfer protein 4-like [Nicotiana 
tomentosiformis]
Length=123

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P   +AITCDTVY DL+PCLSY+L GG+VS+ECC G+K+L++ A TT D QSACSC+K++
Sbjct  27   PPAMAAITCDTVYNDLQPCLSYVLIGGSVSTECCSGLKSLLASATTTPDHQSACSCVKNL  86

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            AS A   ++SRAA IPG+CG + P+K+ P+VDCSKV
Sbjct  87   ASAATGEEVSRAARIPGQCGANVPFKISPDVDCSKV  122



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  + ITCDTV+ DLKPCL+Y+L GGNV +ECC G+K+L+  A TTADRQS CSCLKS+
Sbjct  62   PQARAVITCDTVFNDLKPCLNYVLVGGNVPAECCNGLKSLIVKAITTADRQSICSCLKSL  121

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+ A   Q+ RAA +PGKCGV  P+K+  +VDC+KV
Sbjct  122  ATTATDEQVDRAASLPGKCGVKVPFKISRDVDCTKV  157



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  + ITCDTV+ DLKPCLSY+L GGNV +ECC G+K+L++ A TT DRQ ACSC+K++
Sbjct  23   PQTRAVITCDTVFSDLKPCLSYVLVGGNVPTECCNGLKSLITNATTTEDRQMACSCVKNL  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+ A   Q+ RAA +PGKCGV+ P+K+  +VDC+KV
Sbjct  83   ATAATDEQVDRAASLPGKCGVNVPFKISRDVDCTKV  118



>ref|XP_009631015.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=102

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ++ +TCDTVY +L+PCL+Y+LFG ++ S+CC GVK+L++ A TTADRQ ACSC+KS
Sbjct  5    APPVKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIASATTTADRQIACSCVKS  64

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            +ASRA   +LSRAA IPGKCG + P+ + P+VDCSKV 
Sbjct  65   LASRATGDELSRAAGIPGKCGANVPFDISPDVDCSKVN  102



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++ ITCDTVY  +KPCL+Y+LFGG+V  +CC G+++L++ A TTADRQSACSC+KS+
Sbjct  23   PPAKAVITCDTVYDGVKPCLNYVLFGGSVPIDCCNGLESLIASATTTADRQSACSCVKSL  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
            AS A   +LSRAA IPG+CG   P+++ PNVDCSK +F
Sbjct  83   ASHATDEELSRAASIPGQCGASVPFEISPNVDCSKGSF  120



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P   + ITCDTVY DL+PCLSY+L GG+V  ECC G+K+L++ A TT DRQSACSC+K++
Sbjct  27   PPAMAGITCDTVYNDLQPCLSYVLVGGSVPEECCSGLKSLLANATTTPDRQSACSCVKNL  86

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            AS A   ++SRAA I G+CG + P+K+ P+VDCSKV
Sbjct  87   ASAATGEEVSRAASITGQCGANVPFKISPDVDCSKV  122



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++ ITCDTVY  +KPCL+Y+LFGG VS++CC G++++++ A T AD QS CSC+KS+
Sbjct  23   PPAKAVITCDTVYDGVKPCLNYVLFGGIVSTDCCNGLESVIASATTIADHQSTCSCIKSL  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            AS+A   +LSRAA IPG+CG   P+++ PNVDCSKV
Sbjct  83   ASQATDDELSRAASIPGQCGATIPFEISPNVDCSKV  118



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            G++ I+CDTV  DL PCLS++L GG V+  CC G+KTL+S A+T  DRQS CSCLKSVA 
Sbjct  28   GQAQISCDTVDNDLLPCLSFVLNGGKVAPACCSGIKTLLSLAKTQTDRQSVCSCLKSVAQ  87

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A   QL  AA+IP  CGV+ P+++  N+DCSKV
Sbjct  88   SATNGQLKNAAQIPHLCGVNVPFQISRNIDCSKV  121



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            +PRG  AITC  VYGDL PC+ Y+  GG V+ +CC GV++L++ A+T  DR++AC C+K+
Sbjct  21   SPRGTKAITCPQVYGDLTPCIQYLRSGGAVAPQCCSGVRSLLAAARTVTDRRTACRCIKT  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+      + RA+ +PGKCGV  PYK+ P+ DCSK+
Sbjct  81   AAAGLSGLDIGRASALPGKCGVSIPYKISPSTDCSKI  117



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            ++ +TC+TV+  L+PCLSY+L GG +V SECC G+K++++GA T ADRQSAC C+KSV S
Sbjct  34   DATLTCNTVFTTLEPCLSYVLGGGLSVPSECCNGIKSMLNGAYTIADRQSACKCIKSVVS  93

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
             A    +SRAA++PG C  + P+K+ P+VDCSK
Sbjct  94   SAAPGPVSRAAKVPGICKANVPFKISPHVDCSK  126



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC TV   L PCL+Y+  GG V   CC G+K+L + A+TTADRQ+AC+CLK+
Sbjct  23   APHAEAAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAAAKTTADRQAACNCLKT  82

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             ++      LS A+ +PGKCGV+ PYK+ P+ DCSKV
Sbjct  83   ASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            ++C+TVY +L+PCL ++L GG  V S CC G+K+L+  A TTADRQSAC C+KS+AS A 
Sbjct  25   VSCNTVYSNLEPCLGFVLNGGPTVPSACCSGLKSLLVAAGTTADRQSACKCIKSLASSAN  84

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
              Q+ RA+++PG C    PY++ PNVDCSK+T
Sbjct  85   GVQIGRASQLPGICNAHIPYQISPNVDCSKIT  116



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  528  CDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGAA  352
            C+TVY DL+PCL ++L GG  V S CCGG+K+L+  A TTADRQSAC C+KS+AS A   
Sbjct  28   CNTVYTDLEPCLGFVLNGGLTVPSACCGGLKSLLVAAGTTADRQSACKCIKSLASSANGV  87

Query  351  QLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            Q+ RA ++P  C V+ PY++ PNVDCSK+T
Sbjct  88   QIGRATQLPRICKVNVPYQISPNVDCSKIT  117



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            G++ I+CDTV  DL PC+ +I+ GG V   CC G+ TL+S A+T  DRQSACSCLKSVA 
Sbjct  32   GQAQISCDTVKNDLSPCIGFIMNGGKVPPACCSGLNTLLSLAKTRTDRQSACSCLKSVAE  91

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
             A   QL  AA+IP  CGV+ P+K+  +VDCSK
Sbjct  92   SATDDQLKNAAQIPHSCGVNLPFKISRDVDCSK  124



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVS-SECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P+ E+AI+C TV   L PC++++L+GG    + CC G+KTL + A  TADRQ+ CSCLKS
Sbjct  17   PQAEAAISCGTVASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            VAS A  A +S AA +PGKCGV  PYK+ P+ DCS V
Sbjct  77   VASSATPAIISNAAALPGKCGVSIPYKISPSTDCSSV  113



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC TV   L PCL+Y+  GG V+  CC GVK L + A+TT DRQ+AC CLK+
Sbjct  21   APHAEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKT  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             ++     QL  AA + GKCGV+ PYK+ P +DCSKV
Sbjct  81   ASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV  117



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            +  +TC+TVY  L+PCL Y+L G +V  ECC G+K+L+  A+T  DRQSAC C+KSVAS 
Sbjct  28   DETVTCNTVYDSLEPCLGYVLGGASVPPECCSGLKSLLGAARTRTDRQSACQCVKSVASS  87

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A   Q+SRAA IPG C    P+K+  NVDCSK+
Sbjct  88   ATGDQISRAASIPGICKAKLPFKISANVDCSKI  120



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PR E+AITC TV   L PCLSY++ GG V   CC G+K+L   A+T ADR+S CSCLK+ 
Sbjct  26   PRAEAAITCSTVVNSLIPCLSYVMNGGKVPPTCCQGIKSLYGAAKTAADRRSVCSCLKTA  85

Query  372  ASRAGAAQLSRAAEIPGKCGV-DFPYKVDPNVDCSKV  265
            AS         AA +PGKCGV + P+K+ P  DCSKV
Sbjct  86   ASSVSGINFKNAAALPGKCGVKNIPFKISPKADCSKV  122



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC TV   L PCL+++  GG V+  CC GVK L + A+TT DRQ+AC CLK+
Sbjct  21   APHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKT  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             ++     QL  AA + GKCGV+ PYK+ P +DCSKV
Sbjct  81   ASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKV  117



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            +PRG  AITC  VYGDL PC+ Y+  GG V+ +CC GV++L++ A+T  DR++AC C+K+
Sbjct  23   SPRGTKAITCPQVYGDLNPCIQYLRSGGAVAPQCCSGVRSLLAAARTVTDRRTACRCIKT  82

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
             A+      + RA  +PGKCGV  PYK+  + DCSK+ 
Sbjct  83   AAAGLSGLDIGRARALPGKCGVSIPYKISASTDCSKIN  120



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGG--NVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            P+ E+AI+C TV  DL PC++Y+++GG       CC G+KTL + A +TADRQ+ C CLK
Sbjct  21   PQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIKTLYNQASSTADRQAVCGCLK  80

Query  378  SVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            SVA +A  A +  AA +PGKCGV  PY++ P+ DCSKV
Sbjct  81   SVAGQASPAIIGTAAALPGKCGVSIPYEISPSTDCSKV  118



>ref|NP_001055844.2| Os05g0477900 [Oryza sativa Japonica Group]
 dbj|BAF17758.2| Os05g0477900 [Oryza sativa Japonica Group]
Length=129

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS-  367
             +A++C TVY  L PCL Y+  GG V + CCGG++++V+ A+TTADR++AC+CLK+VA+ 
Sbjct  35   RAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAAG  94

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AG   +SRAA +PG+CGV  P+K+ PNV+C+ V
Sbjct  95   AAGGPYISRAAGLPGRCGVSVPFKISPNVNCNAV  128



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC  V   + PC++Y+  GG V + CC GVKTL   A+TT DRQ+ CSC+KS
Sbjct  23   APNAEAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAKTTPDRQTTCSCMKS  82

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A++    ++  AA +PGKCG+  PYK+ P  DCSKV
Sbjct  83   AATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKV  119



>ref|XP_011091596.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PRGE+AI C TV   L PCL Y+   G + S CCGGVK L   AQTT DRQS CSCLKS+
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTNKGPLGS-CCGGVKGLYGAAQTTQDRQSVCSCLKSL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            AS      L++AA +PG+CGV+ PYK+ P+ DCSKV 
Sbjct  82   ASSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ++AITC  V GD+ PC SY+  GG  S  CC GVK+L S A+TTADRQ ACSCLK+
Sbjct  23   APMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKN  82

Query  375  VASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
            +A+  G +     AA +PGKCGV+ PYK+  + +C+ + F
Sbjct  83   LANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIKF  122



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  E+A+TC TV   L PC++Y+  GG+V + CC GV  L S A+TTADRQ+ACSCLKS 
Sbjct  23   PYVEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVAALNSAAKTTADRQAACSCLKSA  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             S     Q S A+ +PGKCGV  PY++ P+ DCSKV
Sbjct  83   LSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKV  118



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            A   E+ +TC TV  DL PCL Y+  GG + + CC G+++L S A TT DRQ+ C+C+KS
Sbjct  21   ASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGIRSLFSAASTTQDRQTVCNCMKS  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A       L+ AA +P KCGV+ PYK+ P++DC+KV
Sbjct  81   AAGAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKV  117



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ++AITC  V GD+ PC SY+  GG  S  CC GVK+L S A+TTADRQ ACSCLK+
Sbjct  23   APMAQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKN  82

Query  375  VASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
            +A+  G +     AA +PGKCGV  PYK+  + +C+ + F
Sbjct  83   LANNMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATIKF  122



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  528  CDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGAAQ  349
            C+TVY  L+PCL Y+L G +V  ECC G+K+L+S A+T  DRQSAC C+K+VAS A   Q
Sbjct  40   CNTVYDSLEPCLGYVLGGASVPPECCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQ  99

Query  348  LSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +SRAA IPG C    P+K+  NVDCSK+
Sbjct  100  ISRAASIPGICKAKVPFKISANVDCSKI  127



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V  +L PC++Y+  GG V  +CC GVKTLVS AQTTAD+Q+AC+CLKS A+   
Sbjct  25   AITCGQVVSNLTPCITYLQRGGAVPGQCCNGVKTLVSSAQTTADKQTACNCLKSTAATIP  84

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
                  A  +PGKCGV+ PYK+ P+ +C+ + F
Sbjct  85   NINFGNAGSLPGKCGVNLPYKISPSTNCASIKF  117



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APRGE+AI C TV   L PCL Y+   G + S CCGGVK L   AQT  DRQS CSCLKS
Sbjct  22   APRGEAAIGCGTVVSYLNPCLPYVTNKGPLGS-CCGGVKGLYGAAQTAQDRQSVCSCLKS  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            +A       L++AA +PG+CGV+ PYK+ P+ DCSKV 
Sbjct  81   LAGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>gb|AAT01364.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY98428.1| hypothetical protein OsI_20343 [Oryza sativa Indica Group]
 gb|EEE64096.1| hypothetical protein OsJ_18927 [Oryza sativa Japonica Group]
Length=138

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS-  367
             +A++C TVY  L PCL Y+  GG V + CCGG++++V+ A+TTADR++AC+CLK+VA+ 
Sbjct  35   RAALSCSTVYNTLLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAAG  94

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCS  271
             AG   +SRAA +PG+CGV  P+K+ PNV+C+
Sbjct  95   AAGGPYISRAAGLPGRCGVSVPFKISPNVNCN  126



>ref|XP_004245220.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            +PR ++AITC +V+  L PCLSY++ GG V   CC G+K+L S A+TTAD Q  CSCLK 
Sbjct  24   SPRVDAAITCSSVFNGLIPCLSYVVKGGKVPPTCCRGIKSLYSIAKTTADHQGVCSCLKM  83

Query  375  VASRAGAAQLSRAAEIPGKCGV-DFPYKVDPNVDCSKV  265
             AS         AA +PGKCGV + P+K+ P VDCSKV
Sbjct  84   AASSVSGIDFKNAAALPGKCGVKNIPFKISPKVDCSKV  121



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            A   E+ +TC TV  DL PCL Y+  GG + + CC G++ L S A TT DRQ+ C+C+KS
Sbjct  21   ASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGIRNLFSAASTTQDRQTVCNCMKS  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A       L+ AA +P KCGV  PYK+ P++DC+KV
Sbjct  81   AARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKV  117



>ref|XP_010922738.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=117

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AITC  VYGDL PC+ YI  GG V+ +CC G++TLV+ A+T  DR++AC+CLK+ A+ +
Sbjct  26   TAITCSDVYGDLLPCVQYIQSGGAVAPQCCSGLRTLVAAARTGDDRRTACTCLKTAAA-S  84

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +  +SRA+++PGKCGV  PYK+ P+ DCSK+
Sbjct  85   FSGDVSRASKLPGKCGVSIPYKLSPSTDCSKI  116



>gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Erythranthe guttata]
Length=117

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PRGE+AI C TV   +KPCL Y+   G +   CCGG+K L S A+TT DRQS C+CLKS+
Sbjct  25   PRGEAAIGCGTVVSYMKPCLPYVTGSGPLGG-CCGGIKGLNSAAKTTPDRQSVCACLKSL  83

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A   G   L +AA +PG+CGV+ PYK+ P+ DCSKV
Sbjct  84   A---GGVNLGKAAALPGQCGVNIPYKISPSTDCSKV  116



>ref|XP_008778991.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=117

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AITC  VYGDL PC+ YI  GG V+S+CC G+++LV+ A+T  DR++AC+CLKS A+ +
Sbjct  26   AAITCSDVYGDLLPCVQYIQSGGAVASQCCSGLQSLVAAARTADDRRAACTCLKSAAA-S  84

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                + RA+ +PGKCGV  PYK+ P+ DC+K+T
Sbjct  85   FKGNVKRASSLPGKCGVSVPYKLSPSTDCNKIT  117



>sp|A0AT32.1|NLTP6_LENCU RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP6; 
Flags: Precursor [Lens culinaris]
 gb|AAX35810.1| lipid transfer protein 6 precursor [Lens culinaris subsp. culinaris]
Length=118

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AI+C  V  DL PCL+Y+  G   S +CCGGVK L++ A TT DRQ+AC+CLKS
Sbjct  20   APMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKS  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A        + AA +PGKCGVD PYK+  + +C+ V F
Sbjct  80   AAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVKF  118



>ref|XP_011091597.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PRGE+AI C TV   L PCL Y+   G + S CCGGVK L   AQT  DRQS CSCLKS+
Sbjct  23   PRGEAAIGCGTVVSYLNPCLPYVTNKGPLGS-CCGGVKGLYGAAQTAQDRQSVCSCLKSL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A       L++AA +PG+CGV+ PYK+ P+ DCSKV 
Sbjct  82   AGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AITC  V GD+ PCLSY+  GG  S  CC GVK+L   A+TTADRQ+AC+CLK++
Sbjct  24   PMAQAAITCGQVAGDVSPCLSYLRSGGKPSDACCNGVKSLSGAAKTTADRQAACNCLKNL  83

Query  372  ASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
            A+  G +     AA +PGKCGV+ PYK+  + +C+ + F
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIKF  122



>ref|XP_010931360.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X2 [Elaeis guineensis]
Length=117

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  VYGDL PC++Y+  GG+V+ +CC G+++L++ A+T  DR++AC CLK++
Sbjct  22   PGRADAITCSDVYGDLLPCVAYVQAGGSVAPQCCSGLRSLLAAARTADDRRTACRCLKTI  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            ++R     +SRA  IPGKCGV  PYK  P++DCSK+ 
Sbjct  82   SARF-PGYVSRANTIPGKCGVSIPYKFSPSIDCSKIN  117



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            +TC+ VY  L+PCL Y+L GG +V SECCGG K+L+S   T  DRQSAC C+KS  S A 
Sbjct  29   VTCNMVYSSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNAN  88

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
             AQLSRAA +P  C  + P+K+ P+VDCSKV 
Sbjct  89   EAQLSRAATLPRICKTNVPFKISPHVDCSKVN  120



>sp|A0AT31.1|NLTP5_LENCU RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP5; 
Flags: Precursor [Lens culinaris]
 gb|AAX35809.1| lipid transfer protein 5 precursor [Lens culinaris subsp. culinaris]
Length=116

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AI+C  V GDL PCL+Y+  G   S +CCGGVK L++ A TT DRQ+AC+C+KS
Sbjct  19   APMAEGAISCGAVTGDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCMKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS       + AA +PGKCGV+ PYK+  + +C+ V
Sbjct  79   AASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTV  115



>gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Erythranthe guttata]
Length=117

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 4/96 (4%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI C TV   +KPCL Y+   G +   CCGG+K L S A+TT DRQSACSCLKS+
Sbjct  25   PLGEAAIGCGTVVSYIKPCLPYVTGSGPLGG-CCGGIKGLNSAAKTTPDRQSACSCLKSL  83

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A   G   L +AA +PG+CGV+ PYK+ P+ DCSKV
Sbjct  84   A---GGVNLGKAAALPGQCGVNIPYKISPSTDCSKV  116



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APR E+AITC TV  DL  CLSY+   G + S CC GVK L   A+TT DRQS C+CLKS
Sbjct  22   APRSEAAITCGTVVSDLDSCLSYLTNKGPLGS-CCSGVKGLYGAAKTTQDRQSVCNCLKS  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +A       LS+AA +PG+CGV+ PYK+ P+ DCS V
Sbjct  81   LADSYTDVDLSKAAGLPGQCGVNIPYKISPSTDCSTV  117



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            +P+ ++ +TC  V  +L PC+SY+++GG NV ++CC G+K L   AQT  DRQ+ CSC+K
Sbjct  23   SPKAQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCNGIKNLYGQAQTKTDRQAICSCIK  82

Query  378  SVASRAG----AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +  S +G     + L+ AA +P KCGV+ PY++ PN DC+ V
Sbjct  83   NAVSNSGFNYSRSNLNNAANLPKKCGVNIPYQISPNTDCNSV  124



>ref|XP_004963700.1| PREDICTED: non-specific lipid-transfer protein 2A-like, partial 
[Setaria italica]
Length=127

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS-R  364
            +A++C TVY  L PCL Y+  GG V   CC G++ LVSGA+TT DR++ C+CLK+VA+  
Sbjct  25   AALSCSTVYNTLMPCLGYVQSGGTVPRACCSGIQRLVSGARTTPDRRAICTCLKNVAAGA  84

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCS  271
            AG   +SRAA +PG+CGV  PYK+ PN++C+
Sbjct  85   AGGPYISRAAGLPGRCGVPLPYKLSPNMNCN  115



>emb|CDY00655.1| BnaC03g36390D [Brassica napus]
Length=113

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNV-SSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
             GE+A+TC+ V GDL PCLSY++ GGN  S+ CC GV+TL S AQTTADRQS C C+K+ 
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNAPSTNCCNGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
               A   ++ L+ A  +P KCGV+ P+ + P+ +C++
Sbjct  77   IGGASYSSSNLNNALSLPAKCGVNLPFSISPSTNCNR  113



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AI+C  V  DL PCL+Y+  G   S +CCGGVK L++ A TT DRQ+AC+CLKS
Sbjct  12   APMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKS  71

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A        + AA +PGKCGV+ PYK+  + +C+ V F
Sbjct  72   AAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVKF  110



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E+AITC  V   L PCL+Y+  GG V   CC G+K L S AQTTADRQ+AC CLKS++  
Sbjct  26   EAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNSAAQTTADRQTACKCLKSLSGS  85

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                    A+ +PGKCGV  PYK+ P+ DCSKVT
Sbjct  86   IPGINYGLASGLPGKCGVSVPYKISPSTDCSKVT  119



>ref|XP_009396870.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=119

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PRG  AITC  VYGDL  C+ Y L GG +  +CC G+K+L++ A+TT DR++AC C+K+ 
Sbjct  24   PRGGEAITCSQVYGDLISCVGY-LQGGPIKQQCCSGIKSLIAAARTTQDRRTACGCIKTA  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A+        R +++PG+CG+   YK+ PNVDCSK+ 
Sbjct  83   AAGLSGIDYGRVSQLPGQCGISVSYKISPNVDCSKIN  119



>ref|XP_009396875.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=119

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PRG  AITC  VYGDL  C+ Y L GG +  +CC G+K+L++ A+TT DR++AC C+K+ 
Sbjct  24   PRGGEAITCSQVYGDLISCVGY-LQGGPIKQQCCSGIKSLIAAARTTKDRRTACGCIKTA  82

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A+        R +++PG+CG+   YK+ PNVDCSK+ 
Sbjct  83   AAGLSGIDYGRVSQLPGQCGISVSYKISPNVDCSKIN  119



>sp|A0AT29.1|NLTP2_LENCU RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
7; Short=LTP7; Flags: Precursor [Lens culinaris]
 gb|AAX35807.1| lipid transfer protein 2 precursor [Lens culinaris]
Length=118

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 63/99 (64%), Gaps = 0/99 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AI+C  V  DL PCL+Y+  G   S +CCGGVK L++ A TT DRQ+AC+CLKS
Sbjct  20   APMAEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKS  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A        + AA +PGKCGV+ PYK+    +C+ V F
Sbjct  80   AAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF  118



>ref|XP_006367725.1| PREDICTED: non-specific lipid-transfer protein 4-like [Solanum 
tuberosum]
Length=123

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSE---CCGGVKTLVSGAQTTADRQSACSC  385
            +P+ E+AI+C+TVY  L PCLSY++ G N S+    CC G+++L + A TT DRQ  CSC
Sbjct  22   SPQAEAAISCNTVYSKLMPCLSYLMGGSNKSAAPAGCCSGIQSLYTAASTTTDRQGVCSC  81

Query  384  LKS-VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            LKS  AS   +   S+AA +  KCGV  PYK+ P++DCSKV
Sbjct  82   LKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPDIDCSKV  122



>ref|XP_008792224.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            +TC  VYGDL PC+ Y+  GG V+ ECC GV++L++ A+T  DR++AC CLK+VA++  +
Sbjct  29   MTCSDVYGDLLPCVEYVQAGGAVAPECCSGVRSLLAAARTADDRRTACRCLKTVAAKF-S  87

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +SRA  IPGKCGV  P+K+ P++DCSK+
Sbjct  88   GYVSRANSIPGKCGVSIPFKLSPSMDCSKI  117



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++ +TC TV  DL PC+SY+ +GG V++ CC GV+TL + A++TADRQ+ C+CLK   S 
Sbjct  30   KAQVTCRTVVNDLSPCISYVSYGGAVTTNCCNGVRTLYNAARSTADRQTVCTCLKQAVSG  89

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  QL  AA +PGKCG++ PY++ P+ DCS+V
Sbjct  90   ISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRV  124



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGN--VSSECCGGVKTLVSGAQTTADRQSACSCL  382
            +P  E+AI+C TVY +L PCLSY++ G    V + CC G+++L + A TT DRQS CSCL
Sbjct  25   SPHAEAAISCSTVYSNLAPCLSYLIGGSKQAVPAGCCSGIQSLYTAASTTVDRQSVCSCL  84

Query  381  KSVASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            K+ A+  G++   ++AA +  KCGV  PYK+ PN+DCSKV
Sbjct  85   KAGAASLGSSIDANKAATLLNKCGVTVPYKISPNIDCSKV  124



>ref|XP_009135090.1| PREDICTED: non-specific lipid-transfer protein 6-like [Brassica 
rapa]
Length=115

 Score =   102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNV-SSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
             GE+A+TC+ V GDL PCLSY++ GGN  S+ CC GV+TL S AQTTADRQS C C+K+ 
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               A   ++ L  A  +P KCGV+ P+ + P+ +C+ +
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCNSI  114



>emb|CDX73941.1| BnaA03g31060D [Brassica napus]
 emb|CDX73942.1| BnaA03g31050D [Brassica napus]
Length=113

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNV-SSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
             GE+A+TC+ V GDL PCLSY++ GGN  S+ CC GV+TL S AQTTADRQS C C+K+ 
Sbjct  17   HGEAAVTCNNVVGDLYPCLSYVMQGGNSPSTNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
               A   ++ L  A  +P KCGV+ P+ + P+ +C++
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCNR  113



>ref|XP_004245221.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=123

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSE---CCGGVKTLVSGAQTTADRQSACSC  385
            +P+ E+AI+C+TVY  L PCLSY++ G N ++    CC G+++L + A TT DRQ  CSC
Sbjct  22   SPQTEAAISCNTVYSKLMPCLSYLMGGSNRAAAPAGCCSGIQSLYTAASTTTDRQGVCSC  81

Query  384  LKS-VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            LKS  AS   +   S+AA +  KCGV  PYK+ PN+DCS+V
Sbjct  82   LKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPNIDCSQV  122



>ref|XP_010931359.1| PREDICTED: non-specific lipid-transfer protein 1-like isoform 
X1 [Elaeis guineensis]
Length=118

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  VYGDL PC++Y+  GG+V+ +CC G+++L++ A+T  DR++AC CLK++
Sbjct  22   PGRADAITCSDVYGDLLPCVAYVQAGGSVAPQCCSGLRSLLAAARTADDRRTACRCLKTI  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            ++R     +SRA  IPGKCGV  PYK  P++DCS 
Sbjct  82   SARF-PGYVSRANTIPGKCGVSIPYKFSPSIDCSN  115



>ref|XP_009615065.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=125

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSE--CCGGVKTLVSGAQTTADRQSACSCL  382
            +P  E+AI+C TVY +L PCLSY++     ++   CC G+++L + A TTADRQS CSCL
Sbjct  25   SPHAEAAISCSTVYSNLAPCLSYLMGSSKQAAPAGCCSGIQSLYTAASTTADRQSVCSCL  84

Query  381  KSVASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            K+ A+  G++   ++AA +  KCGV  PYK+ PN+DCSKV
Sbjct  85   KAGAASLGSSIDTNKAATLLSKCGVTVPYKISPNIDCSKV  124



>gb|ACP43542.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            + E+A +C TV   L PCL+Y+  GG+V + CC GVK+L + A+TT DRQ+AC+C+K+ A
Sbjct  24   QAEAAFSCGTVVSSLTPCLTYLKSGGSVPTTCCSGVKSLNAAAKTTPDRQTACNCMKNAA  83

Query  369  SRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +     +L  A  +P KCGV+ PYK+ P+ DCSKV
Sbjct  84   AGITGLKLELAGSLPTKCGVNIPYKISPSTDCSKV  118



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   L PC+SY+  GG V   CC G+K+L S A+TTADRQ+AC CLK+ +S    
Sbjct  29   ITCGQVASALSPCISYLQKGGAVPPACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVSG  88

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
              LS A+ +PGKCGV  PYK+ P+ DC+KVT
Sbjct  89   INLSLASGLPGKCGVSVPYKISPSTDCTKVT  119



>ref|XP_009396871.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP    AITC  V  DL PC+ Y    G+++S CC GVK+L S A+T+ADR++AC+C+KS
Sbjct  19   APHVTQAITCGQVTSDLSPCIPYATGKGSLTSGCCNGVKSLNSAAKTSADRKTACTCIKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            + SR  +A     + IPGKCGV  PY + P+ DCSKV
Sbjct  79   LVSRFSSANTGVVSGIPGKCGVSIPYTISPSTDCSKV  115



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)
 Frame = -2

Query  555  APRGE-SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            AP  E +AITC  V   + PCL+Y+  GG V   CC GVK+L S A+TT DRQ+AC+CLK
Sbjct  21   APHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNSAAKTTPDRQTACNCLK  80

Query  378  SVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            S A    + Q   A+ +P KCGV+ PYK+ P+ DCSKV
Sbjct  81   SAAVSNPSIQAGLASSLPAKCGVNVPYKISPSTDCSKV  118



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PR   A+TCD V  +L  CLSY+  GG V + CC GVK L+S A+T  DRQ+ACSCLKS+
Sbjct  26   PRPSEALTCDDVNNNLISCLSYVAGGGKVPTSCCSGVKNLLSLAKTRNDRQTACSCLKSL  85

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A  A   QL RA  +P  C +  P+ +  +VDCSKV
Sbjct  86   AVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKV  121



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AI C+TV   + PCL Y+   G +   CCGGVK L+  A+TT DRQ+ C+CLK+
Sbjct  19   APLAEAAIGCNTVASKMAPCLPYVTGKGPLGG-CCGGVKGLIDAARTTPDRQAVCNCLKT  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +A       L  AA +PGKCGV  PY++ PN DCSKV
Sbjct  78   LAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKV  114



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI C  V   L PC++Y++ GG + + CC G+K+L + A +T DRQ+AC+C+KS 
Sbjct  21   PHADAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +PGKCGV+ PYK+ P++DCS V
Sbjct  81   AASIKGINFSHAGSLPGKCGVNLPYKISPSIDCSTV  116



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI+C  V   L PC+SY+  GG + + CC G+++L + A +T DRQ+AC+C+KS 
Sbjct  21   PHADAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESLNNQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +PGKCGV+ PYK+ P++DCS V
Sbjct  81   AASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTV  116



>ref|XP_010252072.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++AI+C  +   L PC++Y + GG +   CC GV+TL S A+TTADRQ+ C CLKS A+ 
Sbjct  29   DAAISCGQLASLLSPCVNYFVKGGPLPPACCSGVRTLNSAAKTTADRQATCQCLKSAAAS  88

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 L  A  IPGKCGV+FPYK+ P+ DCS+V
Sbjct  89   IPGLNLGLANSIPGKCGVNFPYKISPSTDCSRV  121



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+A++C TV GDL PC+ Y+  G   +  CC GVK L++ A TTADRQ+AC+CLK+
Sbjct  20   APMAEAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAAAPTTADRQAACNCLKT  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A          AA +PGKC V+ PYK+    +C+ + F
Sbjct  80   AAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIKF  118



>ref|XP_009618455.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
 gb|AHB86570.1| non-specific lipid-transfer protein LTP1.1 [Nicotiana tabacum]
Length=129

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            +  +TCDTV   L+ CL Y++ GG V SECC G+K+L+  A+TTAD QSAC CLKS+ S 
Sbjct  36   DETVTCDTVINSLRSCLGYVIGGGIVPSECCNGLKSLLIVARTTADHQSACKCLKSIDSG  95

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                + SR A IP  C    P+K+ P+VDCSK+
Sbjct  96   VTREEFSRVASIPRICKAKVPFKISPDVDCSKI  128



>gb|AAT68263.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI+C  V   L PC++Y+  GG + + CC G+KTL S A +T DRQ+AC+C+KS 
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGAIPAACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A          A+ +PGKCGV+ PYK+ P++DCS V
Sbjct  81   ARSISGINFGLASSLPGKCGVNLPYKISPSIDCSTV  116



>ref|XP_004245406.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            + +TC TVY  L+PCL Y+L GG +V SECC G+K+L   A+TTADRQ  C CLK+V S 
Sbjct  29   TVVTCSTVYSRLEPCLGYVLGGGLSVPSECCNGIKSLHRAARTTADRQRFCRCLKNVRSN  88

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A   ++SRA+++ G C V+  +K+ P+ DCSKV
Sbjct  89   ATNTRISRASQLTGICKVNALFKIRPDFDCSKV  121



>emb|CDY27974.1| BnaC05g43760D [Brassica napus]
Length=111

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            RGE+A++C+ V GDL PCLSY++ GGNV + CC G++TL S AQT  DRQ  C C+K+  
Sbjct  16   RGEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAI  75

Query  369  SRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
                  +  L+ A  +P KCGV+ PY + P+ +C +
Sbjct  76   GGVSFSSNNLNNAQSLPAKCGVNLPYSISPSTNCDR  111



>ref|XP_004506487.1| PREDICTED: non-specific lipid-transfer protein 3-like [Cicer 
arietinum]
Length=124

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGN-VSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P+ E A+TC  V  +L  C+SYI++GGN V ++CC GV+ L + AQTT DR++ CSC+K+
Sbjct  23   PKAEGAVTCGQVVNNLTSCVSYIMYGGNTVPAQCCNGVRNLNAMAQTTPDRRAVCSCIKN  82

Query  375  VASRAG----AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              S +G       L+ AA +P +CGV+ PY++ PN DC+ V
Sbjct  83   AVSSSGFTYSNTNLNLAASLPRRCGVNIPYQISPNTDCNSV  123



>ref|XP_003566138.1| PREDICTED: non-specific lipid-transfer protein P5-like [Brachypodium 
distachyon]
Length=130

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +A++C TVY  L PCL Y+  GG V   CC G+K LVSGA++T DR++ C CLK+V+S 
Sbjct  36   RAALSCSTVYNTLMPCLGYVQSGGTVPRACCTGIKRLVSGARSTQDRRTVCVCLKNVSSG  95

Query  363  A-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A G   L+RAA +P +CGV  PYK  PN  CS +
Sbjct  96   AKGGPYLTRAAGLPARCGVPLPYKTGPNDSCSSI  129



>ref|XP_009608991.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608992.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=106

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+ ++AI+C  V   L PC+SY+  GG + + CC G+K L S A TT DRQ+AC C+KS 
Sbjct  10   PQADAAISCRQVVTSLSPCISYVRQGGALPAPCCSGIKALNSQATTTPDRQAACICIKSA  69

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +P KCGV+ PYK+ P++DCS V
Sbjct  70   AAGVSGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  105



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC  V   L  C SY+  GG V   CC GVK+L S A+TT DRQ+ C CLK 
Sbjct  20   APYAEAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSLNSAARTTPDRQTVCGCLKR  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +G    S AA +PGKCGV+ PYK+ P+ DCSKV
Sbjct  80   A---SGGVNASNAASLPGKCGVNIPYKISPSTDCSKV  113



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI+C  V   L PC+SY+  GG + + CC G+K+L + A +T DRQ+AC+C+KS 
Sbjct  21   PHADAAISCGQVVASLSPCISYVRQGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +P KCGV+ PYK+ P++DCS V
Sbjct  81   AAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PC+ Y+  GG V   CC GVK+L S A+TT DRQ+AC CLKS
Sbjct  20   APYAE-ALTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKSLNSAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              S         AA +PGKCGV+ PYK+ P  DCSKV
Sbjct  79   AYSSISGINEGNAASLPGKCGVNIPYKISPGTDCSKV  115



>gb|AAK01293.1|AF331710_1 lipid transfer protein [Avicennia marina]
Length=117

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI+C TV   L PC+ Y+   G +   CCGGVK+L   A+TT DRQS C CLKS+
Sbjct  23   PHGEAAISCGTVASKLAPCIPYVTNRGPLGG-CCGGVKSLYGLARTTPDRQSVCGCLKSL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            AS      L +AA +PG+CGV+ PYK+ P+ DCSKV
Sbjct  82   ASSYN-VNLGKAAGLPGQCGVNIPYKISPSTDCSKV  116



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E+A++C+ V  DL PCL+Y++ GGN+   CC G+K L   A++ +DRQ+ C C+KS   R
Sbjct  21   EAAVSCNAVQADLYPCLAYVVQGGNIPQSCCTGIKMLKQQAKSASDRQAVCRCIKSAVGR  80

Query  363  A--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +  L  AA +PGKCGV  PYK+DP+ +C+ +
Sbjct  81   VSYSSTYLKNAATLPGKCGVKLPYKIDPSTNCNSI  115



>ref|XP_009146980.1| PREDICTED: non-specific lipid-transfer protein 6 [Brassica rapa]
Length=113

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            RGE+A++C+ V GDL PCLSY++ GGNV + CC G++TL S AQT  DRQ  C C+K+  
Sbjct  16   RGEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAI  75

Query  369  SRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                  +  ++ A  +P KCGV+ PY + P+ +C  + 
Sbjct  76   GGVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNCDSIN  113



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+ ++AI+C  V   L PC+SY+  GG + + CC G+K+L + A +T DRQ+AC+C+KS 
Sbjct  21   PQADAAISCGQVVSSLTPCISYVTKGGAIPAPCCSGIKSLNNQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                       A+ +PGKCGV+ PYK+ P++DCS V
Sbjct  81   VGSISGINFGLASSLPGKCGVNLPYKISPSIDCSTV  116



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+SY+  GG V   CC GVK+L S A+TT DRQ+AC CLKS
Sbjct  6    APYTE-ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKS  64

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  65   AYNSISGVNAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E AI+C  V   + PCL Y L GG + + CC GVK+L++ AQTT DRQ+ACSCLKS +  
Sbjct  24   EGAISCGMVTSKMAPCLGY-LTGGTLPATCCAGVKSLLASAQTTPDRQAACSCLKSASGG  82

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                    AA +P KCGV+ PYK+ P+ DC+KV
Sbjct  83   IAGLNYGNAASLPSKCGVNIPYKISPSTDCTKV  115



>emb|CDY36007.1| BnaA05g29430D [Brassica napus]
Length=111

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            RGE+A++C+ V GDL PCLSY++ GGNV + CC G++TL S AQT  DRQ  C C+K+  
Sbjct  16   RGEAAVSCNAVVGDLYPCLSYVVQGGNVPANCCNGIRTLNSQAQTPVDRQGVCRCIKNAI  75

Query  369  SRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
                  +  ++ A  +P KCGV+ PY + P+ +C +
Sbjct  76   GGVSFSSNNVNNAQSLPAKCGVNLPYSISPSTNCDR  111



>pdb|2MAL|A Chain A, Solution Structure Of Lipid Transfer Protein From Lentil 
Lens Culinaris
Length=93

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AI+C  V  DL PCL+Y+  G   S +CCGGVK L++ A TT DRQ+AC+CLKS A    
Sbjct  1    AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSIT  60

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
                + AA +PGKCGV+ PYK+    +C+ V F
Sbjct  61   KLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF  93



>emb|CCJ09772.1| putative non-specific lipid transfer protein, partial [Hirudo 
medicinalis]
Length=82

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  507  LKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGAAQLSRAAEI  328
            LKPCL Y+  G  V   CCGG+K+L + A+TTADR+S C CLKS+A        S+AA +
Sbjct  1    LKPCLGYVQGGNVVPPPCCGGIKSLYTSAKTTADRRSICYCLKSLAGSFKGINYSKAAGL  60

Query  327  PGKCGVDFPYKVDPNVDCSKV  265
            PGKCGV+ PYK+DP+ DCSKV
Sbjct  61   PGKCGVNIPYKIDPSTDCSKV  81



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ESAITC  V   L PCL Y+  G   S++CCGGV+ L S A TT DRQ+AC+CLKS
Sbjct  18   APMAESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKS  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A        + AA +PGKCGV+ PYK+  + +C+ +
Sbjct  78   AAGSISRLNANNAAALPGKCGVNIPYKISTSTNCATI  114



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AITC  V   + PC++Y+  GG V + CC GV++L S A+TTADRQ+AC+CLK+
Sbjct  19   APLAE-AITCGQVSSSVAPCINYLKVGGAVPAACCNGVRSLNSAAKTTADRQAACNCLKT  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
             ++      LS AA +PGKCGV  PYK+ P+ +C++
Sbjct  78   ASASIKGINLSLAAGLPGKCGVSVPYKISPSTNCNR  113



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 0/101 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ESAITC  V   L PCL Y+  G   S++CCGGV+ L S A TT DRQ+AC+CLKS
Sbjct  18   APMAESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKS  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTFGI  253
             A        + AA +PGKCGV+ PYK+  + +C+    G+
Sbjct  78   AAGSISRLNANNAAALPGKCGVNIPYKISTSTNCATYHQGL  118



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC TV G L PC+ Y+  G   S+ CCGGVK L S A TT DRQ+AC+CLKS
Sbjct  75   APMAEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKS  134

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A        + AA +PGKCGV+ PYK+  + +C+ +
Sbjct  135  AAGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATI  171



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+SY+  GG V   CC GVK+L S A+TT DRQ+AC CLKS
Sbjct  20   APYTE-ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA  PGKCGV  PYK+ P+ DCSKV
Sbjct  79   AYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKV  115



>ref|XP_007033545.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
 gb|EOY04471.1| Non-specific lipid-transfer protein isoform 1 [Theobroma cacao]
Length=119

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYIL-FGGNVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            AP  + AI+C  V G L PC+SY+   GG V S CC G+K L S AQT+ DR++AC+C+K
Sbjct  21   APLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIK  80

Query  378  SVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            S A        + A+++P KCGV  PY++ PN+DCS V 
Sbjct  81   SAAGSISGINYALASQMPSKCGVSIPYQISPNIDCSSVN  119



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A++C  V   L PC+SY+  GG V   CC GVK+L S A+TT DRQ+AC CLKS  +   
Sbjct  11   ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSIS  70

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  71   GINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_009596391.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=147

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 1/91 (1%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC TV   L PCLSY++ GG V   CC G+K+L    +TTADR+S CSCLK+  S    
Sbjct  56   ITCSTVVNGLIPCLSYVVNGGKVPPTCCKGIKSLYGAVKTTADRRSVCSCLKTATSSVSG  115

Query  354  AQLSRAAEIPGKCGV-DFPYKVDPNVDCSKV  265
                 AA +PGKCGV + P+K+ P  DCSKV
Sbjct  116  INFKNAAALPGKCGVKNIPFKISPKADCSKV  146



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A++C  V   L PC+SY+  GG V   CC GVK+L S A+TT DRQ+AC CLKS  +   
Sbjct  11   ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSIS  70

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  71   GINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_006367906.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            + +TC TVY  L+PCL Y+L GG +V SECC G+K+L   A+TTADRQ  C CLK+V S 
Sbjct  28   TVVTCSTVYSSLEPCLGYVLGGGLSVPSECCSGIKSLHRAARTTADRQRFCRCLKNVRSN  87

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A   +++RA+++ G C V+  +K+ P+ DCSKV
Sbjct  88   ATDTRINRASKLTGICKVNAFFKIRPDFDCSKV  120



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI C TV   L PCL Y+   G +   CC G+  L + AQTTADRQS C CLK +
Sbjct  23   PEGEAAIGCGTVVSYLNPCLPYVTGTGALGG-CCKGINDLYAAAQTTADRQSVCGCLKDL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+      L +AA +P +CG++ PYK+ P+ DCSKV
Sbjct  82   AASTSGVNLGKAAGLPSQCGLNIPYKISPSTDCSKV  117



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 57/90 (63%), Gaps = 0/90 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            I+C  V   L PC  Y+L GG V + CC GVK+L   A TTADR+  C CLKSV S A  
Sbjct  33   ISCGKVTSTLAPCFEYVLNGGKVPNSCCDGVKSLYKEASTTADRREVCVCLKSVTSSASP  92

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              ++ A  +PGKCGV  PY++ P +DC+KV
Sbjct  93   GVINNAKSLPGKCGVSIPYEITPAIDCNKV  122



>ref|XP_009608993.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI+C  V   L PC++Y+  GG + + CC G+K L + A TT DRQ+AC+C+KS 
Sbjct  22   PHADAAISCGQVVTRLSPCINYVRQGGALPAPCCSGIKALNNQATTTPDRQAACNCIKSA  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       + A  +P KCGV+ PYK+ P++DCS V
Sbjct  82   AASISGINFNLAGSLPSKCGVNLPYKISPSIDCSTV  117



>gb|ACQ42222.1| lipid transfer protein 1 [Chimonanthus praecox]
Length=116

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V   L PC++Y+  GG + S CC GV++L + A++T DRQ+AC CLKS AS   
Sbjct  25   AITCGQVASALSPCITYLRSGGALQSNCCAGVRSLNNAAKSTTDRQTACGCLKSAASSIS  84

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              Q   A  +P KCGV  PYK  P+ DCSKV
Sbjct  85   GIQYGLAGSLPSKCGVSIPYKTSPSTDCSKV  115



>emb|CAA42832.1| LTP 1 [Hordeum vulgare]
Length=134

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APR   A+ C  V   +KPCL+Y+  G   S ECC GV+ L + AQ++ DRQ+ C+CLK 
Sbjct  20   APRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKG  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            +A       L+ AA IP KC V+ PY + P++DCS+ T
Sbjct  80   IARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRFT  117



>gb|AAT68265.1| lipid transfer protein precursor [Nicotiana glauca]
Length=112

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++AI+C  V   L PC++Y+  GG++ + CC G+KTL S A +T DRQ+AC+C+KS 
Sbjct  21   PHADAAISCGQVVTSLTPCINYVRQGGDIPTACCSGIKTLNSQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVD  277
            A          A+ +PGKCGV+ PYK+ P++D
Sbjct  81   AGSISGINFGLASSLPGKCGVNLPYKISPSID  112



>emb|CBW38502.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A++C  V   L PC+SY+  GG V   CC GVK+L S A+TT DRQ+AC CLKS  +   
Sbjct  11   ALSCGQVSFSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSIS  70

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  71   GINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+SY+  GG V   CC GVK+L   A+TT DRQ+AC CLKS
Sbjct  20   APYAE-ALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNCAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  79   AYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  115



>ref|XP_010043171.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88335.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
 gb|KCW88336.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ESA+TC  V   + PCL Y+  GG + S CC G+++L S A+TT DRQ+AC CL+S A  
Sbjct  23   ESAVTCGQVASCVAPCLGYLRAGGTLPSACCSGIRSLNSAARTTPDRQTACRCLQSAAGN  82

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 L   + +PGKCGV  PYK+ P+ DCS+V
Sbjct  83   IRGLNLGLVSALPGKCGVSVPYKISPSTDCSRV  115



>sp|P07597.1|NLTP1_HORVU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Probable amylase/protease inhibitor; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA41946.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA28805.1| unnamed protein product [Hordeum vulgare]
 gb|AAA32970.1| amylase/protease inhibitor [Hordeum vulgare]
 emb|CAP16136.1| non-specific lipid transport protein 1 precursor [Hordeum vulgare]
Length=117

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APR   A+ C  V   +KPCL+Y+  G   S ECC GV+ L + AQ++ DRQ+ C+CLK 
Sbjct  20   APRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKG  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +A       L+ AA IP KC V+ PY + P++DCS++
Sbjct  80   IARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>dbj|BAK05317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APR   A+ C  V   +KPCL+Y+  G   S ECC GV+ L + AQ++ DRQ+ C+CLK 
Sbjct  20   APRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKG  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +A       L+ AA IP KC V+ PY + P++DCS++
Sbjct  80   IARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>gb|ABH03042.1| non-specific lipid transfer protein [Solanum sogarandinum]
Length=114

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PC  Y++  G +   CCGGVK+L+  AQTTADRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSSLAPCFPYLMNRGPLGG-CCGGVKSLLGQAQTTADRQTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS      L +AA +P  C V+ PYK+ P+ DCSKV
Sbjct  77   AASSFTGLDLGKAAGLPSACSVNIPYKISPSTDCSKV  113



>ref|XP_004151695.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 ref|XP_004167529.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 gb|KGN54448.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=125

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS-  367
            E+ ++C+ V  +L+PC+SY+  GG  SS CC GVK L + A+TT DRQ+ C CLKS+ + 
Sbjct  29   EAVVSCNQVITNLRPCVSYVTGGGYPSSNCCSGVKQLSTAARTTPDRQAVCRCLKSLVNG  88

Query  366  -RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             +     ++ AA +P KCGV  PY ++PNVDC+ +  
Sbjct  89   VKYNGQNVANAAALPTKCGVTLPYSINPNVDCNTIKM  125



>ref|XP_010931358.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=118

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P   +AITC  V   +  C+SY+  GG++ + CC GV++L   A+TTADR++ C+CLKS 
Sbjct  22   PHAANAITCGQVASSVSGCISYVRSGGSIPASCCSGVRSLAGSAKTTADRRTVCNCLKST  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A+R    + + AA +P KCGV  P+ + P+ DCSKVT
Sbjct  82   AARISGIKPALAAGLPSKCGVRIPFTISPSTDCSKVT  118



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   L PC++Y+  GG V + CC GV++L + A+TTADRQ+AC+CLKS  +    
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG  60

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              L+ AA +PGKCGV  PYK+ P+ DC  V
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSV  90



>gb|AEN70919.1| lipid transfer protein [Gossypium mustelinum]
 gb|AEN70920.1| lipid transfer protein [Gossypium mustelinum]
Length=120

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G V S CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCIAYLTGNGAGGVPSSCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>gb|ABP01769.1| lipid transfer protein 2 [Salvia miltiorrhiza]
Length=114

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  E+AI C  V   L PCL Y+   G +   CCGG+K L   A+TT DRQS C+CLK++
Sbjct  19   PPSEAAIGCGAVVSYLNPCLPYVTNKGPLGG-CCGGIKGLYGAAKTTPDRQSVCNCLKTL  77

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            AS      L +AA +PG+CGV  PYK+ P+ DCSKV
Sbjct  78   ASSYKGVNLGKAAGLPGQCGVSIPYKISPSTDCSKV  113



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            +++C TV  DL PCL Y+  GG V  +CC G+++L + A TTADRQ+ C+C+K+ AS   
Sbjct  2    SMSCSTVVTDLYPCLDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVT  61

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               L  AA +P KCGV  PY++ P+VDC+ V
Sbjct  62   GLNLDLAAGLPQKCGVSIPYQISPSVDCATV  92



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   + PC+SY+  GG+ +  CCGGVK+L S A T ADR++AC CLKS
Sbjct  21   APHAE-ALTCGQVTSSMTPCMSYLTGGGSPTPACCGGVKSLNSMASTPADRKAACGCLKS  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A       +  AA +PGKCG+  PY +  + DCSKV
Sbjct  80   AAGAMTNLNMGNAASLPGKCGISLPYPISTSTDCSKV  116



>sp|O24038.1|NLTP2_SOLPN RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; AltName: Full=LpLTP2; Flags: Precursor [Solanum pennellii]
 gb|AAB07487.1| lipid transfer protein 2 [Solanum pennellii]
Length=114

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PCL Y++  G +   CCGGVK L+  AQTT DRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSTLAPCLPYLMNRGPLGG-CCGGVKGLLGQAQTTVDRQTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS      L +AA +P  C V+ PYK+ P+ DCSKV
Sbjct  77   AASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKV  113



>ref|NP_001268074.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33394.1|AF467946_1 lipid transfer protein isoform 4 [Vitis vinifera]
Length=119

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = -2

Query  531  TCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGAA  352
            TC  V   L PC+SY+  GG V + CC G+K+L S A+TT DRQ+AC CLK+ +S     
Sbjct  30   TCGQVASALSPCISYLQKGGAVPAGCCSGIKSLNSAAKTTGDRQAACKCLKTFSSSVSGI  89

Query  351  QLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                A+ +PGKCGV  PYK+ P+ DCSKVT
Sbjct  90   NYGLASGLPGKCGVSVPYKISPSTDCSKVT  119



>ref|XP_002323667.1| putative lipid transfer family protein [Populus trichocarpa]
 gb|ABK95728.1| unknown [Populus trichocarpa]
 gb|EEF05428.1| putative lipid transfer family protein [Populus trichocarpa]
Length=120

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++AI+C+ V   L PC+SY++  G ++  CC G++ L S A+TT DRQS C+CLK+ AS+
Sbjct  25   KAAISCNQVINTLTPCISYVVGNGALTDNCCNGIRGLNSAARTTPDRQSVCTCLKNTASQ  84

Query  363  --AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +  ++ AA +PGKCGV  PYK+DP+ DC  V
Sbjct  85   FSYNSRNVALAAGLPGKCGVKLPYKIDPSTDCKSV  119



>pdb|1T12|A Chain A, Solution Structure Of A New Ltp1
Length=91

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 60/91 (66%), Gaps = 1/91 (1%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V  +L PCL+Y+   G +   CCGGVK LV+ A+TT DRQ AC+CLKS A    
Sbjct  1    AITCGQVTSNLAPCLAYLRNTGPLG-RCCGGVKALVNSARTTEDRQIACTCLKSAAGAIS  59

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               L +AA +P  CGV+ PYK+ P+ DCSKV
Sbjct  60   GINLGKAAGLPSTCGVNIPYKISPSTDCSKV  90



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS
Sbjct  20   APYAE-ALTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P  DCSKV
Sbjct  79   AYNSISGVNAGNAASLPGKCGVSIPYKISPGTDCSKV  115



>gb|AGH32496.1| non-specific lipid transfer protein [Papaver somniferum]
Length=117

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
             E AI+C TV   L PC+ Y+   G++ + CC GVK+L   AQTT+DRQ+ C CLK+ A 
Sbjct  23   AEGAISCGTVVSKLSPCVGYLTGLGSLPANCCTGVKSLYQAAQTTSDRQTVCGCLKNAAK  82

Query  366  RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 ++S AA +PGKCGV  PY    ++DCSKV
Sbjct  83   SMTNIKMSNAASLPGKCGVSIPYTFSTSIDCSKV  116



>ref|XP_006407743.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49196.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=113

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C++V  +L PC+SY++ GGNV + CC G++TL   AQT ADRQS C C+K+   
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 +  L+ A  +P KCGV+ PY++ P+ +C  + 
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDSIN  113



>gb|AAO33357.1|AF465408_1 nonspecific lipid transfer protein 1 [Vitis cinerea var. helleri 
x Vitis vinifera]
Length=119

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   L  CL Y+  GG V   CC G+K L S AQTTADRQ+AC CLK+ ++    
Sbjct  29   ITCGQVSSALSSCLGYLKNGGAVPPGCCSGIKNLNSAAQTTADRQAACKCLKTFSNSIPG  88

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
              L  A+ +PGKCGV  PYK+ P+ DCSKVT
Sbjct  89   INLGLASGLPGKCGVSVPYKISPSTDCSKVT  119



>ref|XP_009778826.1| PREDICTED: uncharacterized protein LOC104228120 [Nicotiana sylvestris]
Length=226

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            R E+ ++ DTVY  L+PC+ Y+L GG +  ECC G+K+L+S A+T  DRQS CSC K  A
Sbjct  48   RTEALLSSDTVYSSLQPCIGYVLGGGTLPPECCSGLKSLISIAKTRPDRQSFCSCAKGAA  107

Query  369  SRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            S     +L+RA  + G+C    P+K+ P++DCSK
Sbjct  108  SSTTPEELARANGLAGRCHARVPFKISPDMDCSK  141



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  V G L PC+ ++  GG +   CC GV++L + A+TT DRQ+AC+CLK  
Sbjct  19   PLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQA  78

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A    +  L+ AA +PG CGV  PYK+  + DCSKV
Sbjct  79   ARSIPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>ref|NP_187489.1| lipid-transfer protein 6 [Arabidopsis thaliana]
 sp|Q9LDB4.1|NLTP6_ARATH RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP 
6; AltName: Full=Xylogen-like protein 15; Short=AtXYP15; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51363.1|AC012562_24 putative nonspecific lipid-transfer protein; 75707-75272 [Arabidopsis 
thaliana]
 gb|AAF76932.1| lipid transfer protein 6 [Arabidopsis thaliana]
 gb|AAL24433.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM10179.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 gb|AAM63704.1| putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
 dbj|BAE73271.1| xylogen like protein 15 [Arabidopsis thaliana]
 gb|AEE74676.1| lipid-transfer protein 6 [Arabidopsis thaliana]
Length=113

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C+TV  DL PCLSY+  GG V + CC G+ TL S AQT+ DRQ  C C+KS   
Sbjct  17   GEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIG  76

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                    +  A E+P KCGVD PYK  P+ DC  +
Sbjct  77   GLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSI  112



>ref|XP_006407744.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
 gb|ESQ49197.1| hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
Length=129

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C++V  +L PC+SY++ GGNV + CC G++TL   AQT ADRQS C C+K+   
Sbjct  17   GEAAVSCNSVVSELYPCISYVVQGGNVPASCCNGIRTLNGQAQTPADRQSVCRCIKNAIG  76

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
                 +  L+ A  +P KCGV+ PY++ P+ +C +
Sbjct  77   GVSYSSNNLNNALSLPAKCGVNLPYRISPSTNCDR  111



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E AITC  V  +L PCL+Y+   G +   CCGGVK LV+ A+TT DRQ AC+CLKS
Sbjct  19   APCAE-AITCGQVTSNLAPCLAYLRNTGPLG-RCCGGVKALVNSARTTEDRQIACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A       L +AA +P  CGV+ PYK+ P+ DCSKV
Sbjct  77   AAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKV  113



>ref|XP_010683517.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFG--GNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP+ ++ +TC TV   L PCL+Y+  G  G V   CC G+KTL   AQ+T DRQ  C CL
Sbjct  24   APQAKATVTCGTVATSLTPCLNYLQAGASGAVPGGCCTGIKTLNGAAQSTPDRQMVCQCL  83

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A       +  A+ IP KCGV+ PYK+DP+ DCS V
Sbjct  84   KSAAKAMPNVNVGLASSIPPKCGVNIPYKLDPSTDCSSV  122



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+A+TC  V   L PCL Y+  G + S  CCGG+K+L S A T ADR++AC CLKS
Sbjct  19   APHAEAAVTCGQVTSSLLPCLGYLQGGASPSPACCGGIKSLNSMASTPADRKTACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+      +S A+ +PGKC V  PY +  + DCSKV
Sbjct  79   AAASVKGIDMSAASGLPGKCDVSIPYPISTSTDCSKV  115



>gb|AEN70936.1| lipid transfer protein [Gossypium gossypioides]
Length=119

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYIL-FGGNVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            AP  + A+TC  V   L PC++Y+   GG V   CCGG+K+L S AQTT DRQ+AC C+K
Sbjct  21   APLAQGAVTCGQVTTSLAPCITYLRGKGGPVPQGCCGGIKSLNSAAQTTPDRQAACKCIK  80

Query  378  SVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            S A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   SAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  117



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI C TV   L PC+ Y+   G +   CC G+K L   A++T DRQS C+CLK +
Sbjct  23   PEGEAAIGCGTVVSKLSPCIPYVTGKGALGG-CCKGIKGLYDLAKSTGDRQSVCNCLKFL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+      L +AA +PG+CGV  PYK+ P+ DCSKV
Sbjct  82   AASTSGVNLGKAAALPGQCGVSIPYKISPSTDCSKV  117



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  E+AITC  V   L PC+ Y+  GG  ++ CCGGVK+L S A T ADR++AC CLKS 
Sbjct  22   PFAEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGVKSLNSMASTPADRKAACGCLKSA  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       + A+ +P KCGV  PY +  +VDC+KV
Sbjct  82   AASISGMNTAAASSLPSKCGVSIPYPISTSVDCAKV  117



>ref|NP_001189842.1| lipid-transfer protein 6 [Arabidopsis thaliana]
 gb|AEE74677.1| lipid-transfer protein 6 [Arabidopsis thaliana]
Length=117

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C+TV  DL PCLSY+  GG V + CC G+ TL S AQT+ DRQ  C C+KS   
Sbjct  17   GEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIG  76

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                    +  A E+P KCGVD PYK  P+ DC   T
Sbjct  77   GLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSET  113



>ref|XP_010277659.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=122

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
              ++A+TC  V   L PC++Y + GG +   CCG V+ L++ ++TTADRQ+ CSC KS A
Sbjct  27   HADAAMTCGQVASLLTPCINYFVKGGALPPACCGAVRGLITASKTTADRQAVCSCFKSAA  86

Query  369  SRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +      L  A  IPG+CGV F YK+ P+ DCS++
Sbjct  87   ASIPGVNLGLANSIPGRCGVQFTYKISPSTDCSRI  121



>gb|AAF14232.1|AF109195_1 lipid transfer protein [Hordeum vulgare]
 dbj|BAJ87805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +AI+C  VY  L PCL Y+  GG  +  CC G++ L++ A  + DR++ C CLK+VA+ 
Sbjct  27   RAAISCSAVYSTLMPCLQYVQQGGTPARGCCAGIQNLLAEANNSPDRRTICGCLKNVANA  86

Query  363  A-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A G ++++RAA +P KC V+ PYK+ P+VDC+ +
Sbjct  87   APGGSEITRAAALPSKCNVNLPYKISPSVDCNSI  120



>gb|EYU41036.1| hypothetical protein MIMGU_mgv1a016508mg [Erythranthe guttata]
Length=118

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI C  V   ++PCL Y+  G +    CCGG+K+L + A+TT DRQS C+CLKS+
Sbjct  25   PPGEAAIGCGAVVSYMQPCLPYVT-GNSPLGGCCGGIKSLNNAAKTTPDRQSVCACLKSL  83

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            AS        +AA +P  CG++ PYK+ P+ DCSK
Sbjct  84   ASSFSGVNFGKAAGLPATCGINIPYKISPSTDCSK  118



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ESAITC  V   + PCL Y+  GG + S CC G+++L + A+TT DR++ C C++S 
Sbjct  20   PLTESAITCGQVRSWVAPCLGYLRAGGKIPSACCSGIRSLNNAARTTHDRRTTCRCVQSA  79

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A       L   + +PGKCGV  PYK+ P+ DCS+V
Sbjct  80   AGNIQGLNLGLVSALPGKCGVRIPYKISPSTDCSRV  115



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  E AITC  V G + PC++Y+  GG V   CCGG++ LV  A+TTADR++AC+CLKS 
Sbjct  23   PHAE-AITCGQVSGAVAPCINYVRSGGVVPPSCCGGIRGLVGAAKTTADRRTACNCLKSA  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A R    +   AA +PGKCGV  P+ +  +V+C+ VT
Sbjct  82   AGRIPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTVT  118



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS
Sbjct  6    APYAE-ALSCGQVSNSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKS  64

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  65   AYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>sp|Q3YMR2.1|NLTP2_SOLCI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Solanum chilense]
 gb|AAZ22829.1| lipid transfer protein [Solanum chilense]
Length=114

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PCL Y++  G +   CCGGVK L+  AQTT DRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSTLAPCLPYLMNRGPLGG-CCGGVKGLLGQAQTTVDRQAACACLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS      L +AA +P  C V+ PYK+ P+ DCSKV
Sbjct  77   AASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKV  113



>gb|AEN70933.1| lipid transfer protein [Gossypium davidsonii]
 gb|AEN70934.1| lipid transfer protein [Gossypium klotzschianum]
Length=120

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGN--VSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+   G   V   CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCIAYLTGNGAGVVPPRCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAASMSGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>ref|XP_009800887.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
 dbj|BAK19152.1| lipid transfer protein [Nicotiana tabacum]
Length=117

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++ I+C  V   L PC+SY+  GG + + CC G+ +L + A +T DRQ+AC+C+KS 
Sbjct  21   PHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +P KCGV+ PYK+ P++DCS V
Sbjct  81   AAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>ref|XP_010464489.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C T   +L PC+SYI+ GGNV   CC G+K L S AQT ADRQS C C+KS   
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGNVPESCCNGIKALNSQAQTAADRQSVCRCIKSAIG  76

Query  366  RAG--AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 +  L+ A  +P KCG++ PYK  P+ +C  + 
Sbjct  77   GVSYTSNNLNNALSLPSKCGLNLPYKFSPSTNCDSIN  113



>ref|NP_001235162.1| uncharacterized protein LOC100499726 precursor [Glycine max]
 gb|ACU13384.1| unknown [Glycine max]
Length=122

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 64/101 (63%), Gaps = 5/101 (5%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P  +  +TC  V  +L PC+SY+++GG NV  +CC G++ L   AQT  DRQ+ C+C+K+
Sbjct  21   PMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGIRNLYGMAQTKPDRQAVCNCIKN  80

Query  375  VASRAGAA----QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +G       L+ AA +P KCGV+ PY++ PN DC++V
Sbjct  81   GVRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDCTRV  121



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 59/96 (61%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  V G L PC+ ++  GG +   CC GV++L + A+TT DRQ+AC+CLK  
Sbjct  19   PLSAQAITCGQVSGSLAPCIGFLRSGGPIPMPCCNGVRSLNAAARTTPDRQTACNCLKQA  78

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A       L+ AA +PG CGV  PYK+  + DCSKV
Sbjct  79   AGSIPNLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|AAT45202.1| lipid transfer protein 1 precursor [Nicotiana tabacum]
Length=124

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  ++ I+C  V   L PC+SY+  GG + + CC G+ +L + A +T DRQ+AC+C+KS 
Sbjct  28   PHADADISCGQVVASLSPCISYVRQGGAIPAPCCSGINSLNNQATSTPDRQTACNCIKSA  87

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+       S A  +P KCGV+ PYK+ P++DCS V
Sbjct  88   AAGISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  123



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 0/99 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AI+C TV G L PCL+Y+  G   S +CCGGVK L   A+TT DR++AC+CLKS
Sbjct  20   APMAEAAISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTTIDRRAACNCLKS  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A      +    A +PGKCGV  PY +  + +C+ + F
Sbjct  80   SAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIRF  118



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS
Sbjct  6    APYAE-ALSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKS  64

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  65   AYNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 93.6 bits (231),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   L PCLSY+  GG V   CC  +K+L   A+T ADRQ+AC CLKS AS    
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG  60

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               + A+ +PGKCGV  PYK+ P+ DCS V
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSV  90



>ref|XP_008370253.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
 ref|XP_008363932.1| PREDICTED: non-specific lipid-transfer protein 3-like [Malus 
domestica]
Length=123

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP+ E+A+TC  V   L PCLSY+  GG ++  CC GVKTL + AQTT DRQ+ C+CLK 
Sbjct  24   APKAEAAVTCGQVVNSLVPCLSYVTNGGALNPACCNGVKTLYNLAQTTPDRQNVCNCLKQ  83

Query  375  VASRAGAAQLS--RAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +       +   AA +P +CGV+ PYK+ P+ DC  V
Sbjct  84   AINGIPYTNTNAGLAAGLPARCGVNIPYKISPSTDCKSV  122



>ref|XP_006644921.1| PREDICTED: non-specific lipid-transfer protein 6-like [Oryza 
brachyantha]
Length=120

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +AI+C  VY  L PCL Y+  GG V   CCGG+++L++ A  T DR++ C CLKSVA+ 
Sbjct  26   RAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKSVANG  85

Query  363  A-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A G   ++RAA +P KC V  PYK+  +V+C+ + 
Sbjct  86   ASGGPYITRAAALPSKCNVSLPYKISTSVNCNAIN  120



>ref|XP_007033546.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04472.1| Non-specific lipid-transfer protein 6, putative isoform 2 [Theobroma 
cacao]
Length=137

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYIL-FGGNVSSECCGGVKTLVSGAQTTADRQSACSCLK  379
            AP  + AI+C  V G L PC+SY+   GG V S CC G+K L S AQT+ DR++AC+C+K
Sbjct  21   APLAQGAISCGQVTGYLTPCISYLRGSGGAVPSSCCSGIKGLNSAAQTSQDRKAACACIK  80

Query  378  SVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCS  271
            S A        + A+++P KCGV  PY++ PN+DC+
Sbjct  81   SAAGSISGINYALASQMPSKCGVSIPYQISPNIDCT  116



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 58/97 (60%), Gaps = 1/97 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS
Sbjct  20   APYAE-ALSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +         AA +PGKCGV  PYK+ P  DCSKV
Sbjct  79   AYNSISGINAGNAASLPGKCGVSIPYKISPGTDCSKV  115



>gb|ACM78617.1| non-specific lipid-transfer protein type 1 subfamily protein 
[Tamarix hispida]
Length=118

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            +TC T+   L PCL Y+  GG+ ++ CCGGVKTL S A +TADRQ+AC CLKS A+    
Sbjct  28   LTCGTITQKLAPCLPYLKSGGSPAAGCCGGVKTLHSMATSTADRQAACGCLKSSATSIPG  87

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             ++  AA +PGKCGV+  + V   VDCSKV
Sbjct  88   VKMGNAAALPGKCGVNIGFPVSTKVDCSKV  117



>gb|AEN70915.1| lipid transfer protein [Gossypium thurberi]
 gb|AEN70938.1| lipid transfer protein [Gossypium trilobum]
Length=120

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC +Y+     G+V   CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCFAYLTGNGAGSVPPRCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>ref|XP_002532868.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF29522.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=115

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITCD V G L PC+ Y++ GG VS+ CC GV+ L S A+TTADRQ  C C KS+
Sbjct  21   PMTTQAITCDQVVGGLTPCIGYLMSGGEVSAACCNGVRGLNSAAKTTADRQQICQCFKSL  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               AG      A+ +PGKC V+  +K+ P+ DC+ +
Sbjct  81   G--AGGMTNGYASSLPGKCNVNVTFKIGPSTDCNSI  114



>gb|AAR83849.1| nonspecific lipid transfer protein 2 precursor [Capsicum annuum]
Length=114

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V GDL  CL Y+   G + S CCGGV+ L+  A+T ADR++AC+CLKS
Sbjct  19   APHAE-ALTCGQVAGDLAACLPYLQGSGPLGS-CCGGVRALLGAAKTPADRKTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+      LS+AA +P  CGV+ PYK+ P+ DCS V
Sbjct  77   AANAIKGINLSKAAGLPTACGVNIPYKISPSTDCSTV  113



>ref|XP_008463259.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=125

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS-  367
            E+ +TC+ V  +L PC+SY+  GG+ S  CC GV+ L   AQTT DRQ  C CLKS+ + 
Sbjct  29   EATVTCNQVVSNLSPCISYVTGGGSPSFNCCSGVRQLNKAAQTTPDRQDVCRCLKSLING  88

Query  366  -RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
                   ++ AA +P KCGV+ PY ++PN DCS +  
Sbjct  89   VTYNGQNVANAAALPTKCGVNLPYTINPNADCSTIKM  125



>ref|NP_001238176.1| uncharacterized protein LOC100305883 precursor [Glycine max]
 gb|ACU13784.1| unknown [Glycine max]
Length=125

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (67%), Gaps = 3/99 (3%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P+ ++A+TC+ V  +L PC+SY+L GG  V   CC G+KTL + A +T DRQ+ C C+K+
Sbjct  26   PKAQAAVTCNQVVSNLTPCISYVLNGGKTVPGPCCNGIKTLFNLAHSTPDRQTVCKCIKN  85

Query  375  VAS--RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              S    G + + RAA +P +CGV+ P ++ P+ DC++V
Sbjct  86   AVSAFHYGKSNVDRAAALPKQCGVNIPCQISPSTDCTRV  124



>ref|XP_010922734.1| PREDICTED: non-specific lipid-transfer protein 1 [Elaeis guineensis]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  V   L PC+SY   GG V + CC GVK LV+ A+TTADR++AC+CLK+ 
Sbjct  22   PYTAHAITCGQVVSYLTPCISYARSGGQVPAGCCSGVKGLVAAARTTADRRTACTCLKNT  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A+     +    + IPGKCGV  PY + P+ DCS+V+
Sbjct  82   AAGLSGLKPGLISGIPGKCGVRVPYAISPSTDCSRVS  118



>gb|AEN70918.1| lipid transfer protein [Gossypium turneri]
 gb|AEN70931.1| lipid transfer protein [Gossypium armourianum]
 gb|AEN70932.1| lipid transfer protein [Gossypium harknessii]
Length=120

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G V   CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCINYLRGNGAGAVPPGCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAASISGINFGIASGLPGKCGVNIPYKISPSTDCNR  118



>ref|XP_009372010.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+ ++A+TC  V  DL PC+SY+  GG ++  CC GV+TL + AQTT DRQS C+CLK  
Sbjct  25   PKADAAMTCGQVVSDLTPCISYVRAGGALAPACCNGVRTLFTLAQTTPDRQSVCNCLKQA  84

Query  372  ASRAGAAQLS--RAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +       +   AA +P KCGV+ PYK+ P+ DC  V
Sbjct  85   INGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDCKSV  122



>ref|XP_010025406.1| PREDICTED: non-specific lipid-transfer protein 8-like [Eucalyptus 
grandis]
 gb|KCW62060.1| hypothetical protein EUGRSUZ_H04731 [Eucalyptus grandis]
Length=119

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFG-GNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P  ESAI+C  V  DL+PC+SY+  G GN  + CC GV +L + A ++AD+++AC+CLK+
Sbjct  23   PVSESAISCSDVVKDLRPCVSYLKSGSGNPPAACCAGVTSLANAATSSADKKAACACLKN  82

Query  375  VASRAGA-AQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A +    AQL++A  +P KCGV  P  V PNVDCSK+
Sbjct  83   AAQKMNPNAQLAQA--LPSKCGVTLPVAVSPNVDCSKI  118



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ESAITC  V   L PCL Y+  G   S++CCGGV+ L S A TT DRQ+AC+CLKS
Sbjct  18   APMAESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKS  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A        + AA +PGKC V+ PYK+  + +C+ +
Sbjct  78   AAGSISRLNANNAAALPGKCVVNIPYKISTSTNCATI  114



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   L  C++Y+  GG V   CC G+K+L S A+TT DRQ+AC CLK+ +S    
Sbjct  29   ITCGQVASSLSQCINYLQKGGAVPPGCCSGIKSLNSAAKTTGDRQTACKCLKTFSSSISG  88

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 A+ +PGKCGV  PYK+ P+ DCSKVT
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKVT  119



>ref|XP_008798560.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PR   AITC  V   L PC++Y   GG + + CC GVK LV+ A++T DRQ+ACSCLK  
Sbjct  22   PRMADAITCGQVVSFLTPCIAYARNGGPIPAGCCSGVKGLVAAAKSTPDRQTACSCLKRA  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+          A +P KCGV  PY + P+ DCSKV
Sbjct  82   AASISGLNTGLIAGVPAKCGVRIPYSISPSTDCSKV  117



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A++C  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS  +   
Sbjct  11   ALSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSIS  70

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  71   GINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A++C  V   L PC+ Y+  GG V   CC GVK L + A+TT DRQ+AC CLKS  +   
Sbjct  11   ALSCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGLNNAAKTTPDRQAACGCLKSAYNSIS  70

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  AA +PGKCGV  PYK+ P+ DCSKV
Sbjct  71   GINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_006369490.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
 gb|ERP66059.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
Length=108

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFG-GNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P  E+AI+C  V  DL+PC+SY++ G G   + CC G+  + + A TTAD+Q+AC+C+KS
Sbjct  12   PPSEAAISCSDVIKDLRPCVSYLMNGTGKPPAACCSGISAIQASASTTADKQAACNCIKS  71

Query  375  VASRAGAA-QLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
             + +   + QL++A  +P  CG+  P+ V PNVDCSK+T
Sbjct  72   ASKQINPSPQLAQA--LPANCGITLPFTVSPNVDCSKIT  108



>ref|XP_009626829.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana tomentosiformis]
 gb|AAM74206.1|AF519812_1 non-specific lipid transfer protein [Nicotiana tabacum]
 dbj|BAK19150.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PC+ Y+L  G +   CCGGVK L+  A+T ADR++AC+CLKS
Sbjct  19   APHAE-ALTCGQVQSSLAPCVPYLLGRGPLGG-CCGGVKRLLGAARTPADRKTACNCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+      +  AA +PG CGV+ PYK+ P+ DCSKV
Sbjct  77   AANTFKGIDMGNAARLPGTCGVNIPYKISPSTDCSKV  113



>ref|NP_001044654.1| Os01g0822900 [Oryza sativa Japonica Group]
 dbj|BAD73499.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAD87070.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF06568.1| Os01g0822900 [Oryza sativa Japonica Group]
 gb|EAY76313.1| hypothetical protein OsI_04247 [Oryza sativa Indica Group]
 gb|EAZ13979.1| hypothetical protein OsJ_03904 [Oryza sativa Japonica Group]
 dbj|BAG96400.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99603.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99771.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99850.1| unnamed protein product [Oryza sativa Japonica Group]
Length=120

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +AI+C  VY  L PCL Y+  GG V   CCGG+++L++ A  T DR++ C CLK+VA+ 
Sbjct  26   RAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANG  85

Query  363  A-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A G   ++RAA +P KC V  PYK+  +V+C+ +
Sbjct  86   ASGGPYITRAAALPSKCNVSLPYKISTSVNCNAI  119



>ref|XP_003605293.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=121

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = -2

Query  552  PRGESAIT-CDTVYGDLKPCLSYILFGGNV--SSECCGGVKTLVSGAQTTADRQSACSCL  382
            P+ E+A+T C  V   L PC+SYI+ GGN   +++CC G++ L + AQTT DR++ C+C+
Sbjct  18   PKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNLNTMAQTTNDRRAVCTCI  77

Query  381  KSVASRAGAA----QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            K+  S++G +     L+ AA +P KCGV+ PY++ PN DC+ V
Sbjct  78   KNAVSQSGFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  120



>gb|AAF35184.1|AF195863_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26701.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43273.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43274.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43275.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  +  +TC  V G L PC++Y+     G V   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DCS+V
Sbjct  81   KSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDCSRV  119



>ref|XP_002323072.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
 gb|EEF04833.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
Length=150

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++AI+C+ V   L PC+SY++  G ++  CC  ++ L S A+TT DRQS C+CLK+ AS+
Sbjct  55   KAAISCNQVINTLTPCISYVVGNGALTGNCCNAIRGLNSAARTTPDRQSVCTCLKNTASQ  114

Query  363  --AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +  ++ AA +PGKCGV  PYK+DP+ DC  V
Sbjct  115  FSYNSRNVALAAGLPGKCGVKLPYKIDPSTDCKSV  149



>gb|AFK37572.1| unknown [Medicago truncatula]
 gb|AES87490.2| Lipid transfer protein [Medicago truncatula]
Length=126

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = -2

Query  552  PRGESAIT-CDTVYGDLKPCLSYILFGGNV--SSECCGGVKTLVSGAQTTADRQSACSCL  382
            P+ E+A+T C  V   L PC+SYI+ GGN   +++CC G++ L + AQTT DR++ C+C+
Sbjct  23   PKAEAAVTSCGPVVTSLYPCVSYIMNGGNTVPAAQCCNGIRNLNTMAQTTNDRRAVCTCI  82

Query  381  KSVASRAGAA----QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            K+  S++G +     L+ AA +P KCGV+ PY++ PN DC+ V
Sbjct  83   KNAVSQSGFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  125



>gb|AGC08426.1| lipid transfer protein [Gossypium hirsutum]
Length=120

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  +  +TC  V G L PC++Y+     G V   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGTVTCGQVTGSLAPCINYLRGNGAGAVPQGCCSGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DC+KV
Sbjct  81   KSAAAGIPGINYGIASGLPGKCGVNIPYKISPSTDCNKV  119



>gb|AAY43800.1| FSLTP2 [Gossypium hirsutum]
Length=120

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G V   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQTTPDRQAACRCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ PN DC++
Sbjct  81   KSAAAGITGINFGLASGLPGKCGVNIPYKISPNTDCNR  118



>ref|NP_001268120.1| lipid transfer protein precursor [Vitis vinifera]
 gb|AAO33393.1|AF467945_1 lipid transfer protein isoform 1 [Vitis vinifera]
Length=119

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = -2

Query  534  ITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAGA  355
            ITC  V   + PC SY+  GG+V + CC G+K+L S A+TT DRQ+AC CLK+ +     
Sbjct  29   ITCGQVASAVGPCASYLQKGGSVPAGCCSGIKSLNSAAKTTVDRQAACKCLKTFSGSIPG  88

Query  354  AQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 A+ +PGKCGV  PYK+ P+ DCSKVT
Sbjct  89   INFGLASGLPGKCGVSVPYKISPSTDCSKVT  119



>dbj|BAP11219.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11225.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             + +TC  V  DL PC+SY+  GG V   CC GV+TL + AQTTADRQ+ C CLK   + 
Sbjct  13   RAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQNVCKCLKQAVNG  72

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   L  AA +P KCG+  PYK+ P+ DC KV
Sbjct  73   ISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>ref|XP_008244918.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X2 [Prunus 
mume]
Length=123

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  +A++C  V   L PCLSY+   G ++  CC GVK+L S AQTTADRQS C+CLK  
Sbjct  25   PKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQA  84

Query  372  AS--RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +      A    AA +PGKCGV+ PYK+ P+ DC  +
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSI  122



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A+TC  V  +L PC++Y+  GG V   CC G++ + + A+TTADRQ+AC+CLK +++   
Sbjct  26   ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVP  85

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                + AA +PGKCGV+ PYK+ P+ +C+ V
Sbjct  86   GVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E+A+TC  V   L PC SYI  GG  ++ CCGG++ L   AQTT DRQS C+CLK   + 
Sbjct  27   EAALTCGQVVNKLTPCASYIQNGGTPAANCCGGIRALYGMAQTTPDRQSVCNCLKQAIAG  86

Query  363  A--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 A+   AA +PGKCGV+ PYK++P+ DC  +
Sbjct  87   IPYTGAKAGLAAGLPGKCGVNIPYKINPSTDCKSI  121



>ref|XP_007206148.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
 sp|Q43019.1|NLTP3_PRUDU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Prunus dulcis]
 emb|CAA65477.1| lipid transfer protein [Prunus dulcis]
 gb|ACE80966.1| putative allergen Pru du 3.02 [Prunus dulcis x Prunus persica]
 gb|ACE80967.1| putative allergen Pru p 3.02 [Prunus dulcis x Prunus persica]
 gb|EMJ07347.1| hypothetical protein PRUPE_ppa013428mg [Prunus persica]
Length=123

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  +A++C  V  +L PC++Y+  GG ++  CC GV++L S AQTTADRQS C+CLK  
Sbjct  25   PKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQA  84

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +      A    AA +PGKCGV+ PYK+ P+ DC  +
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSI  122



>gb|AEN70917.1| lipid transfer protein [Gossypium schwendimanii]
Length=120

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 61/98 (62%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC+ Y+     G V   CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTTSLAPCIGYLTGNGAGTVPQGCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC TV G L PC+ Y+  G   S+ CCGGVK L S A TT DRQ+AC+CLKS
Sbjct  447  APMAEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKS  506

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A        + AA +PGKCGV+ PYK+  + +C+ +
Sbjct  507  AAGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATI  543


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  ++AI+C TV   L PC+ Y+  G   S  CCGGVK L   A TT DRQ+AC+CLK 
Sbjct  18   APMADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQ  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
             A        + A+ +PGKCGV+ PYK+  + +C +
Sbjct  78   AAGAISGLNTAAASALPGKCGVNIPYKISTSTNCHQ  113



>emb|CAH69197.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|EMT00342.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=121

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +AI+C TVY  L PCL Y+  GG+ +  CC G++ L++ A  + DR++ C CLK+VA+ 
Sbjct  27   HAAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNVANG  86

Query  363  A-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A G   ++RAA +P KC V  PYK+ P+VDC+ +
Sbjct  87   ASGGPYITRAAALPSKCNVALPYKISPSVDCNSI  120



>gb|ACN11576.1| lipid transfer protein 3 precursor [Prunus dulcis]
Length=123

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  +A++C  V  +L PC++Y+  GG ++  CC GV++L S AQTTADRQS C+CLK  
Sbjct  25   PKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQA  84

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +      A    AA +PGKCGV+ PYK+ P+ DC  +
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTI  122



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A+TC  V  +L PC++Y+  GG V   CC G++ + + A+TTADRQ+AC+CLK +++   
Sbjct  26   ALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVP  85

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                + AA +PGKCGV+ PYK+ P+ +C+ V
Sbjct  86   GVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_004302622.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E+A+TC  V   L PC+SY+  GG  ++ CCGG++ L   AQTT DRQS C+CLK   + 
Sbjct  27   EAALTCGQVVNKLMPCVSYVQNGGTPAANCCGGIRALYGMAQTTPDRQSVCNCLKQAIAG  86

Query  363  A--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 A    AA +PGKCGV+ PYK++P+ DC  +
Sbjct  87   IPYTGANAGLAAGLPGKCGVNIPYKINPSTDCKSI  121



>dbj|BAP11221.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11224.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             + +TC  V  DL PC+SY+  GG V   CC GV+TL + AQTTADRQ+ C CLK   + 
Sbjct  13   RAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQNVCKCLKQAVNG  72

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   L  AA +P KCG+  PYK+ P+ DC KV
Sbjct  73   ISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKV  107



>ref|XP_002528683.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF33672.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=114

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 3/96 (3%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AITC  V   L  CLSY+  GG V   CC GV+ L S A+TTADRQ  C CLKS 
Sbjct  21   PMTTEAITCGQVVSGLSSCLSYLRSGGAVPPACCNGVRGLNSAAKTTADRQQVCECLKSA  80

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+      LS A+ +PGKC V+ PYK+ P+ DC  +
Sbjct  81   AA---GINLSNASSLPGKCNVNIPYKISPSTDCKSI  113



>emb|CAH69198.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69211.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|ABE99813.1| lipid transfer protein [Triticum aestivum]
Length=120

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AI+C TVY  L PCL Y+  GG+ +  CC G++ L++ A  + DR++ C CLK+V
Sbjct  23   PATVHAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNV  82

Query  372  ASRA-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+ A G   ++RAA +P KC V  PYK+ P+VDC+ +
Sbjct  83   ANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSI  119



>ref|XP_006296741.1| hypothetical protein CARUB_v10014964mg [Capsella rubella]
 gb|EOA29639.1| hypothetical protein CARUB_v10014964mg [Capsella rubella]
Length=113

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C+T   +L PC+SY+L GGN    CC G++TL S AQT  DRQS C C+KS   
Sbjct  17   GEAAVSCNTAVAELYPCISYVLQGGNPPDSCCSGLRTLSSQAQTPPDRQSVCRCIKSAIG  76

Query  366  RAG--AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                 +  L+ A  +P KCG++ PYK  P+ +C  +
Sbjct  77   GVSYTSNNLNNALALPSKCGINLPYKFSPSTNCDSI  112



>ref|XP_011002608.1| PREDICTED: non-specific lipid-transfer protein 1 [Populus euphratica]
Length=120

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++AI+C+ V   L PC+SY++  G ++  CC  ++ + S A+TT DRQS C+CLK+ AS+
Sbjct  25   KAAISCNQVINTLTPCISYVVGNGALTGNCCNAIRGINSAARTTPDRQSVCTCLKNTASQ  84

Query  363  --AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +  ++ AA +PGKCGV  PYK+DP+ DC  V
Sbjct  85   FSYNSRNVALAAGLPGKCGVKLPYKIDPSTDCKSV  119



>ref|XP_002884695.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60954.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C+TV  DL PCLSY+  GG V S CC G+ TL S AQT+ADRQ  C C+KS   
Sbjct  17   GEAAVSCNTVIADLYPCLSYVTQGGPVPSLCCNGLTTLNSQAQTSADRQGVCRCIKSAIG  76

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                    +  A  +P KCG++ PYK  P+ +C  +
Sbjct  77   GLTLSPGTIDNALSLPSKCGINLPYKFSPSTNCESI  112



>emb|CAH69196.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=120

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P    AI+C TVY  L PCL Y+  GG+ +  CC G++ L++ A  + DR++ C CLK+V
Sbjct  23   PATVHAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNV  82

Query  372  ASRA-GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+ A G   ++RAA +P KC V  PYK+ P+VDC+ +
Sbjct  83   ANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSI  119



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AI+C +V G L PC+ Y+  G   S +CC GVK L + A TT DR++AC CLK+
Sbjct  21   APMAEAAISCGSVIGALTPCMPYLTGGPAPSPQCCAGVKNLNAAASTTPDRKTACGCLKN  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A          AA +PGKCGV+ PYK+  + +C+ +
Sbjct  81   AAGSMPNLNAGNAAALPGKCGVNIPYKISTSTNCNTI  117



>gb|AAM22767.2| lipid transfer protein 2 precursor [Prunus persica]
Length=123

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  +A++C  V  +L PC++Y+  GG ++  CC GV++L S AQTTADRQS C+CLK  
Sbjct  25   PKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQA  84

Query  372  ASRA--GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             +      A    AA +PGKCGV+ PYK+ P+ DC  +
Sbjct  85   VNGIPYPNANAGLAAGLPGKCGVNIPYKISPSTDCKSI  122



>ref|XP_009396874.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP    AITC  V   L  C+SY    G +S+ CC GVK+L S A+TTADR++AC+C+KS
Sbjct  20   APHVTLAITCGQVTSALSSCISYATGKGPLSTACCSGVKSLNSAAKTTADRKTACTCIKS  79

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              SR   AQ    A IPGKCGV   Y +  + DCSKV
Sbjct  80   TVSRLSGAQAGAIAGIPGKCGVSIGYPISASTDCSKV  116



>ref|XP_010253093.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=123

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP   +AI+C  V  +L PC+ Y+  GG +  +CC GV+TL   A+TTADRQ+ C CLKS
Sbjct  26   APNEVAAISCGQVVSNLSPCIVYLRTGGPLPPKCCSGVRTLSRAARTTADRQTTCICLKS  85

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+     + + A+ +  KCGV+ PYK+ P+ DCS+V
Sbjct  86   SAAGVPGIKPALASSLADKCGVNLPYKISPSTDCSRV  122



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AI C TV   L PC+ Y+  GG+    CC GV+ L + A+TT DRQ AC CL++
Sbjct  18   APLTEAAIACGTVVSALSPCIGYLRAGGSPPLACCNGVRALNNAARTTPDRQEACRCLQN  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A   G    + A  +PGKCGV+ PYK+  + +CS V
Sbjct  78   AARSMGGLNEANAGSLPGKCGVNIPYKISTSTNCSTV  114



>gb|AEI70826.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=118

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A++C  V   L PC+ Y+  GG V   CC GVK+L S A+TT DRQ+AC CLKS
Sbjct  20   APYAE-ALSCGQVSSSLAPCIGYLTKGGVVPPACCSGVKSLNSAAKTTPDRQAACGCLKS  78

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDP--NVDCSKV  265
              S         AA +PGKCGV+ PYK+ P    DCSKV
Sbjct  79   AYSSISGINSGNAASLPGKCGVNIPYKISPGTRTDCSKV  117



>gb|KDP21874.1| hypothetical protein JCGZ_00661 [Jatropha curcas]
Length=119

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
              +AITC  V  +L PC+ Y+  GG V   CC G++TL + AQTT DRQ+ C CL+S  S
Sbjct  23   ARAAITCGDVVRELTPCVGYLQSGGQVPGNCCNGIRTLYNAAQTTPDRQAVCQCLESAVS  82

Query  366  --RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
              R  +  L  A  +P KC V+ PYK+DP+ +C  V
Sbjct  83   NFRYSSYNLGLAQSLPAKCNVNIPYKIDPSTNCKNV  118



>ref|XP_006367396.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L  CL Y++  G +   CCGGVK L+  AQ TADRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSSLASCLPYLMNRGPLGG-CCGGVKGLLGQAQNTADRQTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS      L +AA +P  C V+ PYK+ P+ DCSKV
Sbjct  77   AASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKV  113



>ref|NP_001234735.1| non-specific lipid transfer protein precursor [Solanum lycopersicum]
 emb|CAJ19705.1| non-specific lipid transfer protein [Solanum lycopersicum]
Length=114

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PCL Y++  G + + CC GVK L+  A+TT DRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSTLAPCLPYLMNRGPLRN-CCDGVKGLLGQAKTTVDRQAACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             AS      L +AA +P  C V+ PYK+ P+ DCSKV
Sbjct  77   AASSFTGLNLGKAAALPNTCSVNIPYKISPSTDCSKV  113



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V   L PC+ Y+  GG V   CC G++T+ S A+TTADRQ+AC+CLK++A    
Sbjct  24   AITCGQVTSSLAPCIGYVRNGGAVPPACCNGIRTINSLARTTADRQTACNCLKNLAGSIS  83

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                + AA +PGKCGV+ PYK+  + +C+ V
Sbjct  84   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|AGW21333.1| lipid transfer protein [Prunus davidiana]
Length=117

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V   L PC+ Y+  GG V   CC G++ + + A+TT DRQ+AC+CLK +++   
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               L+ AA +PGKCGV+ PY++ P+ +C+ V
Sbjct  86   GVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>gb|AGH27864.1| lipid transfer protein precursor [Prunus davidiana]
 gb|AGH27865.1| lipid transfer protein precursor [Prunus davidiana]
Length=117

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            AITC  V   L PC+ Y+  GG V   CC G++ + + A+TT DRQ+AC+CLK +++   
Sbjct  26   AITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP  85

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
               L+ AA +PGKCGV+ PY++ P+ +C+ V
Sbjct  86   GVNLNNAASLPGKCGVNIPYQISPSTNCANV  116



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -2

Query  537  AITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRAG  358
            A+TC  V  +L PC+ Y+  GG V   CC G++ + + A+TTADRQ+AC+CLK +++   
Sbjct  26   ALTCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVP  85

Query  357  AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                + AA +PGKCGV+ PYK+ P+ +C+ V
Sbjct  86   GVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>dbj|BAP11220.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             + +TC  V  DL PC+SY+  GG V   CC GV+TL + AQTTADRQ+ C CLK   + 
Sbjct  13   RAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQNVCKCLKQAVNG  72

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   L  AA +P KCG+  PYK+ P+ DC KV
Sbjct  73   ISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>gb|KHG21711.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYI--LFGGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC+SY+     G +   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCISYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DC+ V
Sbjct  81   KSAATGIRGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>ref|XP_011005034.1| PREDICTED: non-specific lipid-transfer protein 8-like [Populus 
euphratica]
Length=108

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 65/98 (66%), Gaps = 2/98 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFG-GNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P  ++AI+C  V  DL+PC++Y++ G G   + CC G+ ++ + A TTAD+QSAC+C+KS
Sbjct  12   PPSDAAISCSDVIKDLRPCVNYLMNGTGKPPAACCSGISSIQAAASTTADKQSACNCIKS  71

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
             AS+    +   A  +P  CG+  P+ V PNVDCSK+T
Sbjct  72   -ASKQMNPKPQLAQALPANCGITLPFTVSPNVDCSKIT  108



>dbj|BAP11226.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             + +TC  V  DL PC+SY+  GG V   CC GV+TL + AQTTADRQ+ C CLK   + 
Sbjct  13   RAQVTCSVVVNDLSPCISYVSGGGAVPVNCCNGVRTLNNAAQTTADRQNVCKCLKQAVNG  72

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   L  AA +P KCG+  PYK+ P+ DC KV
Sbjct  73   ISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKV  107



>gb|AFR43276.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43278.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYI--LFGGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G +   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DCS V
Sbjct  81   KSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSV  119



>gb|AEN70916.1| lipid transfer protein [Gossypium laxum]
Length=120

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 2/98 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGN--VSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+   G   V   CCGG+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTTSLAPCITYLRGNGAAAVPPGCCGGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSK  268
            KS A+         A+ +PGKCGV+ PYK+ P+ DC++
Sbjct  81   KSAAAGISGINYGIASGLPGKCGVNIPYKISPSTDCNR  118



>dbj|BAP11218.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11222.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11223.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             + +TC  V  DL PC+SY+  GG V   CC GV+TL + AQTTADRQ+ C CLK   + 
Sbjct  13   RAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQNVCKCLKQAVNG  72

Query  363  AGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   L  AA +P KCG+  PYK+ P+ DC KV
Sbjct  73   ISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKV  107



>gb|ABQ53932.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P GE+AI C TV   L  C  Y+   G +   CC G+K L + AQTTADRQS C CLK +
Sbjct  23   PEGEAAIGCGTVVSYLNSCFPYVTGTGALGG-CCKGIKDLYAAAQTTADRQSVCDCLKDL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A+      L +AA +P +CG++ PYK+ P+ DCSKV
Sbjct  82   AASTTGVDLGKAAGLPSQCGLNIPYKIIPSTDCSKV  117



>gb|EYU42014.1| hypothetical protein MIMGU_mgv1a016509mg [Erythranthe guttata]
Length=118

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            E+AI C TV   L+PCL Y+   G +   CCGGVK L S A+TT DRQS C+CLK++   
Sbjct  26   EAAIGCGTVVSYLQPCLPYVTDKGPLGG-CCGGVKGLYSSAKTTQDRQSVCNCLKTLVGS  84

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 L +AA +P  CGV  PYK+ P+ DCSKVT
Sbjct  85   NIGINLGKAAGLPALCGVSIPYKISPSTDCSKVT  118



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -2

Query  549  RGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVA  370
            +  +A+TC  V   L PC+SY+ +GG +   CC GVKTL   AQT+ADRQ+ C C+KS  
Sbjct  25   QARAAVTCGDVVRTLTPCISYVQYGGPLPDNCCNGVKTLYGEAQTSADRQNVCKCIKSAV  84

Query  369  SRAGAA--QLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +    +   L  AA +PGKCG+  PY + P+ DC+KV
Sbjct  85   NGFSYSNFNLGLAAGLPGKCGLHLPYTISPSTDCNKV  121



>ref|XP_011091598.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=120

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            PR E+AI+C TV   L  CL Y+   G + S CC GVK L   AQTT DRQS C+CL+S+
Sbjct  25   PRTEAAISCSTVVSYLNQCLPYVSNKGPLGS-CCSGVKGLYGAAQTTEDRQSVCNCLESL  83

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
            A       +++ A +PG+C VD PYK+ P+ +C+KV 
Sbjct  84   AGSYTDVDMNKVAGLPGQCDVDIPYKISPSTNCTKVN  120



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E+AITC  V   L  C+ Y+  GG +   CC G+K+L S A+TT DRQ  C+CLKS
Sbjct  21   APLAEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGLKSLNSAAKTTPDRQGVCNCLKS  80

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            +A +        AA +P KCGV  PYK+ P  DC  V
Sbjct  81   LAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTV  117



>gb|AAF35186.1|AF195865_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|ACI26698.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43277.1| lipid transfer protein precursor [Gossypium hirsutum]
Length=120

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYI--LFGGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G +   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTSSLAPCINYLRGTGAGAIPPGCCSGIKSLNSAAQTTPDRQAACKCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DCS V
Sbjct  81   KSAAAGIPGINFGLASGLPGKCGVNIPYKISPSTDCSSV  119



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP    A+TC  V   + PCL Y+  GG++ + CCGGVK L S A+T  DRQ AC CLK 
Sbjct  22   APHAAQALTCGQVLNMVMPCLGYLKNGGSIPATCCGGVKNLASSAKTKPDRQQACKCLKP  81

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVTF  259
             A   G     RA ++P  CGVD+   + P +DCS V +
Sbjct  82   AAKSYG-INYDRANKLPSACGVDYKINISPTIDCSTVKY  119



>emb|CDO96795.1| unnamed protein product [Coffea canephora]
Length=122

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            APR E+ I C  V   L PC  Y+  GG+V   CC GV+ LV+ A+T ADR+SAC+CLK 
Sbjct  25   APRAEAVIACGQVISFLTPCTRYLKNGGSVPGNCCAGVRHLVAAARTPADRKSACTCLKG  84

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                    +L  A  +P KCG +  Y++ P +DCS+VT
Sbjct  85   AYRGYPGIKLPNAQSLPKKCGANVRYRIIPTIDCSRVT  122



>ref|XP_008244911.1| PREDICTED: non-specific lipid-transfer protein 3 isoform X1 [Prunus 
mume]
Length=132

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P+  +A++C  V   L PCLSY+   G ++  CC GVK+L S AQTTADRQS C+CLK  
Sbjct  25   PKAMAAVSCGQVVNSLTPCLSYVSNNGPLNPSCCTGVKSLYSMAQTTADRQSICNCLKQA  84

Query  372  AS--RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDC  274
             +      A    AA +PGKCGV+ PYK+ P+ DC
Sbjct  85   VNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDC  119



>ref|XP_010464583.1| PREDICTED: non-specific lipid-transfer protein 6-like [Camelina 
sativa]
Length=113

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = -2

Query  546  GESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVAS  367
            GE+A++C T   +L PC+SYI+ GG V   CC G+K L S AQT+ADRQS C C+KS   
Sbjct  17   GEAAVSCSTTVAELYPCVSYIVQGGTVPESCCNGIKALNSQAQTSADRQSVCRCIKSAIG  76

Query  366  RAG--AAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                 +  L+ A  +P KCG++ PY+  P+ +C  + 
Sbjct  77   GVSYTSNNLNNALSLPSKCGLNLPYRFSPSTNCDSIN  113



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AI+C  V   + PCLSY   G   S+ CC GV++L S A TTADR++AC+CLK+VA   
Sbjct  26   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
                   AA IP KCGV  PY + P++DCS V 
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V  +L PCL Y+   G +   CC GVK L++ A+TT DRQ+AC+CLKS
Sbjct  19   APHAE-ALTCGQVTSNLAPCLPYLRNKGPLG-RCCSGVKGLLNAARTTQDRQTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A       L +AA +P  CGV+ PY + P+ DCSKV
Sbjct  77   AAGAISGINLRKAAGLPSTCGVNIPYNISPSTDCSKV  113



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AI+C  V   + PCLSY   G   S+ CC GV++L S A TTADR++AC+CLK+VA   
Sbjct  18   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  77

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   AA IP KCGV  PY + P++DCS V
Sbjct  78   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  109



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AI+C  V   + PCLSY   G   S+ CC GV++L S A TTADR++AC+CLK+VA   
Sbjct  25   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  84

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   AA IP KCGV  PY + P++DCS V
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  116



>gb|KHN14506.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (63%), Gaps = 5/99 (5%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGG-NVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P  +  +TC  V  +L PC+SY+++GG NV  +CC G++ L   AQT  DRQ+ C+C+K+
Sbjct  10   PMAQGEMTCGQVVSNLTPCISYVVYGGTNVPEQCCNGIRNLYGMAQTKPDRQAVCNCIKN  69

Query  375  VASRAGAA----QLSRAAEIPGKCGVDFPYKVDPNVDCS  271
                +G       L+ AA +P KCGV+ PY++ PN DC+
Sbjct  70   GVRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDCT  108



>ref|XP_007017080.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY34699.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=161

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
             +AITC+ V   L PC+ Y +FGG V+  CC G+KTL + A+TT DR+  C+C+K  A+R
Sbjct  68   NAAITCEEVTYYLIPCIGYGVFGGTVAPSCCTGIKTLDAAAKTTEDRREKCNCVKEGAAR  127

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                  +R  EIPG  G   PYKV P+VDCSKV
Sbjct  128  IPGLNYTRVNEIPGLRGTTCPYKVTPDVDCSKV  160



>ref|XP_011091603.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSV  373
            P  E+ I C  V   L  CL Y+   G + + CCGGVK+L   A+TT D+QS C CL+S+
Sbjct  23   PGTEATIGCGAVLSTLSSCLPYVTDQGPLGA-CCGGVKSLYVAAKTTTDKQSVCGCLESL  81

Query  372  ASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            A       L++AA +PG+CGV+ PYK+ P+VDCSKV
Sbjct  82   AGSVPNVDLAKAAGLPGQCGVNIPYKISPSVDCSKV  117



>gb|KDO64078.1| hypothetical protein CISIN_1g033544mg [Citrus sinensis]
Length=117

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYIL--FGGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  ++A+TC  V   L+ C+ Y+    GG V   CC G+K+L S A TT DRQS C+CL
Sbjct  18   APIAQAAVTCGQVTSSLQACIPYVTGPRGGAVPPACCSGIKSLNSAATTTPDRQSVCNCL  77

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            K+ A       L+ A+ +P +CGV+ PY++ P+VDCS+V
Sbjct  78   KTAAGSIKNLNLNLASRLPRQCGVNIPYQISPSVDCSRV  116



>gb|KHN40624.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=408

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = -2

Query  552  PRGESAITCDTVYGDLKPCLSYILFGGN-VSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            P+ ++A+TC+ V  +L PC+SY+L GG  V   CC G+KTL + A +T DRQ+ C C+K+
Sbjct  26   PKAQAAVTCNQVVSNLTPCISYVLNGGKAVPGPCCNGIKTLFNLAHSTPDRQTVCKCIKN  85

Query  375  VAS--RAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCS  271
              S    G + + RAA +P +CGV+ PY++ P+ DC+
Sbjct  86   AVSAFHYGKSNVDRAAALPKQCGVNIPYQISPSTDCT  122



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = -2

Query  540  SAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASRA  361
            +AI+C  V   + PCLSY   G   S+ CC GV++L S A TTADR++AC+CLK+VA   
Sbjct  26   AAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  360  GAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                   AA IP KCGV  PY + P++DCS V
Sbjct  86   SGLNAGNAASIPSKCGVTIPYTISPSIDCSSV  117



>ref|XP_007017081.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
 gb|EOY34700.1| Non-specific lipid-transfer protein, putative [Theobroma cacao]
Length=119

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 0/98 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP   + I+C+ V   L PC++Y LFGG V   CC G+KTL + + TT DR++ C+C+K 
Sbjct  22   APYVNATISCEQVTNWLTPCITYGLFGGTVPPGCCEGIKTLNAASNTTEDRRAQCNCVKE  81

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKVT  262
             A++       R  E+PGKCG   PYK+  ++DCSKV 
Sbjct  82   GAAKIPGLNYDRVNELPGKCGTTCPYKLSYDLDCSKVN  119



>gb|KHG30577.1| Non-specific lipid-transfer [Gossypium arboreum]
Length=120

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G V   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPVCCSGIKSLNSAAQTTPDRQAACRCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DC+ V
Sbjct  81   KSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>ref|XP_006367397.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=114

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 63/97 (65%), Gaps = 2/97 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP  E A+TC  V   L PCL Y+   G +   CCGGVK L+  A+TTADR++AC+CLKS
Sbjct  19   APHAE-ALTCGQVTAGLAPCLPYLQGRGPLGG-CCGGVKGLLGSAKTTADRKTACTCLKS  76

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A+      L++AA IP  CGV+ PYK+ P+ DCS V
Sbjct  77   AANAIKGIDLNKAAGIPSVCGVNIPYKISPSTDCSTV  113



>gb|AAG29777.1| lipid transfer protein 3 precursor [Gossypium hirsutum]
 gb|ACI26697.1| lipid transfer protein [Gossypium hirsutum]
 gb|AFR43270.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43271.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43272.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILF--GGNVSSECCGGVKTLVSGAQTTADRQSACSCL  382
            AP  + A+TC  V   L PC++Y+     G V   CC G+K+L S AQTT DRQ+AC C+
Sbjct  21   APLAQGAVTCGQVTNSLAPCINYLRGSGAGAVPPGCCSGIKSLNSAAQTTPDRQAACRCI  80

Query  381  KSVASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
            KS A+         A+ +PGKCGV+ PYK+ P+ DC+ V
Sbjct  81   KSAAAGITGINFGLASGLPGKCGVNIPYKISPSTDCNSV  119



>gb|AAK28533.1|AF329829_1 lipid transfer protein precursor [Corylus avellana]
Length=115

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 0/97 (0%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP   +++TC  + G+L PC+ Y+  GG +   CC GV+ +   ++TT+DRQSAC+CLK 
Sbjct  18   APVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKD  77

Query  375  VASRAGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
             A        + AA +PGKCGV+ PYK+ P+ +C+ V
Sbjct  78   TAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNV  114



>ref|XP_009346911.1| PREDICTED: non-specific lipid-transfer protein 3-like [Pyrus 
x bretschneideri]
Length=123

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 2/99 (2%)
 Frame = -2

Query  555  APRGESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKS  376
            AP+ E+A+TC  V   L PC+SY+  GG +   CC GV+TL + AQTT DRQ+ C+CLK 
Sbjct  24   APKAEAAVTCGQVVNSLVPCISYVGNGGALDPACCNGVRTLYNLAQTTPDRQNVCNCLKQ  83

Query  375  VASRAGAAQLS--RAAEIPGKCGVDFPYKVDPNVDCSKV  265
              +       +   AA +P KCGV+ PYK+ P+ DC  V
Sbjct  84   AINGIPYTNTNAGLAAGLPAKCGVNIPYKISPSTDCKSV  122



>ref|XP_010253092.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=114

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 63/93 (68%), Gaps = 0/93 (0%)
 Frame = -2

Query  543  ESAITCDTVYGDLKPCLSYILFGGNVSSECCGGVKTLVSGAQTTADRQSACSCLKSVASR  364
            ++ I+C  V   L PC++Y++ GG VS  CC GV+ L + A+TT DR++AC C+KS ++ 
Sbjct  21   DAGISCGQVTSQLAPCITYLVRGGAVSPLCCRGVRGLSASARTTRDRRTACGCIKSASAG  80

Query  363  AGAAQLSRAAEIPGKCGVDFPYKVDPNVDCSKV  265
                +L+ AA +PG+C V  PYK+ P+ DCS+V
Sbjct  81   IRGLKLALAASLPGRCRVRIPYKISPSTDCSRV  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1029984871572