BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5050_g1_i1 len=480 path=[41:0-98 40:99-479]

Length=480
                                                                      Score     E

ref|XP_008230957.1|  PREDICTED: metalloendoproteinase 1-like            157   9e-44   
ref|XP_008352994.1|  PREDICTED: metalloendoproteinase 1-like            157   2e-43   
ref|XP_002517411.1|  Metalloendoproteinase 1 precursor, putative        154   2e-42   Ricinus communis
gb|EYU34696.1|  hypothetical protein MIMGU_mgv11b016964mg               154   2e-42   
ref|XP_008230676.1|  PREDICTED: metalloendoproteinase 1-like            154   2e-42   
ref|XP_007216949.1|  hypothetical protein PRUPE_ppa016355mg             151   7e-42   
ref|XP_002275556.1|  PREDICTED: metalloendoproteinase 1-like            152   1e-41   Vitis vinifera
ref|XP_008343421.1|  PREDICTED: metalloendoproteinase 1-like            151   2e-41   
ref|XP_008361888.1|  PREDICTED: metalloendoproteinase 1-like            150   4e-41   
ref|XP_008230961.1|  PREDICTED: metalloendoproteinase 1-like            150   5e-41   
gb|EYU34695.1|  hypothetical protein MIMGU_mgv1a024051mg                147   7e-41   
gb|KDP45419.1|  hypothetical protein JCGZ_09668                         149   8e-41   
ref|XP_002280833.1|  PREDICTED: metalloendoproteinase 1                 148   4e-40   Vitis vinifera
ref|XP_008458713.1|  PREDICTED: metalloendoproteinase 1-like            147   7e-40   
ref|XP_006431003.1|  hypothetical protein CICLE_v10012543mg             146   8e-40   
ref|XP_004296560.1|  PREDICTED: metalloendoproteinase 1-like            147   1e-39   
gb|KDP45996.1|  hypothetical protein JCGZ_11899                         147   1e-39   
ref|XP_004296559.1|  PREDICTED: metalloendoproteinase 1-like            146   2e-39   
ref|XP_004288499.1|  PREDICTED: metalloendoproteinase 1-like            146   2e-39   
gb|KDO37621.1|  hypothetical protein CISIN_1g035681mg                   146   2e-39   
ref|XP_006495379.1|  PREDICTED: metalloendoproteinase 1-like            144   3e-39   
ref|XP_007215990.1|  hypothetical protein PRUPE_ppa011783mg             142   4e-39   
ref|XP_006482471.1|  PREDICTED: metalloendoproteinase 1-like            144   4e-39   
emb|CBI34985.3|  unnamed protein product                                144   6e-39   
emb|CAN59960.1|  hypothetical protein VITISV_011608                     145   9e-39   Vitis vinifera
ref|XP_006482472.1|  PREDICTED: metalloendoproteinase 1-like            145   1e-38   
ref|XP_008230962.1|  PREDICTED: metalloendoproteinase 1-like            144   1e-38   
ref|XP_008365496.1|  PREDICTED: metalloendoproteinase 1-like            144   1e-38   
ref|XP_008368314.1|  PREDICTED: LOW QUALITY PROTEIN: metalloendop...    144   1e-38   
ref|XP_010255256.1|  PREDICTED: metalloendoproteinase 1-like            144   2e-38   
gb|KDO37628.1|  hypothetical protein CISIN_1g039411mg                   141   2e-38   
ref|XP_009341183.1|  PREDICTED: metalloendoproteinase 1-like            144   2e-38   
ref|XP_003633209.1|  PREDICTED: metalloendoproteinase 1-like            143   4e-38   
ref|XP_008458907.1|  PREDICTED: metalloendoproteinase 1-like            143   4e-38   
ref|XP_008230959.1|  PREDICTED: metalloendoproteinase 1-like            142   5e-38   
ref|XP_004142457.1|  PREDICTED: metalloendoproteinase 1-like            142   6e-38   
ref|XP_004142462.1|  PREDICTED: metalloendoproteinase 1-like            142   1e-37   
ref|XP_007014936.1|  Matrixin family protein, putative                  141   2e-37   
gb|EYU34694.1|  hypothetical protein MIMGU_mgv1a023515mg                140   2e-37   
ref|XP_004297959.1|  PREDICTED: metalloendoproteinase 1-like            140   3e-37   
ref|XP_011085796.1|  PREDICTED: metalloendoproteinase 1-like            140   3e-37   
ref|XP_010037507.1|  PREDICTED: metalloendoproteinase 1-like            140   4e-37   
ref|XP_008355534.1|  PREDICTED: metalloendoproteinase 1-like            140   4e-37   
gb|EYU38312.1|  hypothetical protein MIMGU_mgv11b017434mg               139   4e-37   
ref|XP_007010415.1|  Matrixin family protein                            140   5e-37   
ref|XP_007010413.1|  Matrixin family protein                            140   5e-37   
ref|XP_010037506.1|  PREDICTED: metalloendoproteinase 1-like            139   8e-37   
emb|CAN73128.1|  hypothetical protein VITISV_030256                     139   1e-36   Vitis vinifera
ref|XP_008458714.1|  PREDICTED: metalloendoproteinase 1-like            139   1e-36   
ref|XP_008230960.1|  PREDICTED: metalloendoproteinase 1-like            138   2e-36   
ref|XP_010278837.1|  PREDICTED: metalloendoproteinase 1-like            138   2e-36   
ref|XP_002280805.2|  PREDICTED: metalloendoproteinase 1-like            139   2e-36   Vitis vinifera
ref|XP_008230675.1|  PREDICTED: metalloendoproteinase 1-like            137   4e-36   
ref|XP_010273763.1|  PREDICTED: metalloendoproteinase 1-like            138   5e-36   
gb|EPS59674.1|  hypothetical protein M569_15132                         135   7e-36   
ref|XP_004509890.1|  PREDICTED: metalloendoproteinase 1-like            138   7e-36   
ref|XP_008443669.1|  PREDICTED: metalloendoproteinase 1-like            137   8e-36   
ref|XP_008222422.1|  PREDICTED: metalloendoproteinase 1-like            137   1e-35   
ref|XP_002517412.1|  Matrix metalloproteinase, putative                 136   1e-35   Ricinus communis
ref|XP_008230963.1|  PREDICTED: metalloendoproteinase 1-like            136   2e-35   
ref|XP_006448955.1|  hypothetical protein CICLE_v10017519mg             134   3e-35   
ref|XP_010091950.1|  Metalloendoproteinase 1                            136   3e-35   
ref|XP_004139164.1|  PREDICTED: metalloendoproteinase 1-like            135   3e-35   
emb|CAN73130.1|  hypothetical protein VITISV_030258                     137   4e-35   Vitis vinifera
ref|XP_004139163.1|  PREDICTED: metalloendoproteinase 1-like            135   4e-35   
ref|XP_004142461.1|  PREDICTED: metalloendoproteinase 1-like            134   1e-34   
ref|XP_003628627.1|  Matrix metalloproteinase-9                         135   1e-34   
ref|XP_007226174.1|  hypothetical protein PRUPE_ppa015434mg             133   2e-34   
ref|XP_011073059.1|  PREDICTED: metalloendoproteinase 1-like            133   3e-34   
ref|XP_011072962.1|  PREDICTED: metalloendoproteinase 1-like            132   3e-34   
ref|XP_007216923.1|  hypothetical protein PRUPE_ppa018181mg             131   3e-34   
ref|XP_008798076.1|  PREDICTED: metalloendoproteinase 1-like            134   4e-34   
gb|EYU29748.1|  hypothetical protein MIMGU_mgv1a025409mg                131   4e-34   
ref|XP_007216839.1|  hypothetical protein PRUPE_ppa022514mg             132   5e-34   
ref|XP_011085865.1|  PREDICTED: metalloendoproteinase 1-like            131   6e-34   
ref|XP_004159087.1|  PREDICTED: metalloendoproteinase 1-like            134   8e-34   
ref|XP_010913461.1|  PREDICTED: metalloendoproteinase 1-like            132   9e-34   
ref|XP_011071055.1|  PREDICTED: metalloendoproteinase 1-like            132   2e-33   
ref|XP_002533939.1|  Metalloendoproteinase 1 precursor, putative        128   3e-33   Ricinus communis
ref|XP_003530663.1|  PREDICTED: metalloendoproteinase 1-like            131   3e-33   
ref|XP_010255269.1|  PREDICTED: metalloendoproteinase 1-like            130   3e-33   
gb|ACJ24812.1|  matrix metalloproteinase                                130   6e-33   Pinus taeda
gb|EYU18042.1|  hypothetical protein MIMGU_mgv1a018853mg                129   7e-33   
ref|XP_002275671.1|  PREDICTED: metalloendoproteinase 1-like            129   8e-33   Vitis vinifera
emb|CBI34987.3|  unnamed protein product                                128   8e-33   
ref|XP_010272073.1|  PREDICTED: metalloendoproteinase 1                 129   1e-32   
ref|XP_006300509.1|  hypothetical protein CARUB_v10020468mg             129   1e-32   
ref|XP_002887284.1|  hypothetical protein ARALYDRAFT_476141             129   2e-32   
ref|XP_010512095.1|  PREDICTED: metalloendoproteinase 1                 129   3e-32   
ref|XP_006602365.1|  PREDICTED: metalloendoproteinase 1-like            128   3e-32   
ref|XP_009410261.1|  PREDICTED: metalloendoproteinase 1                 128   3e-32   
ref|XP_007153680.1|  hypothetical protein PHAVU_003G055800g             128   4e-32   
ref|XP_006856883.1|  hypothetical protein AMTR_s00055p00201730          128   4e-32   
ref|XP_010415694.1|  PREDICTED: metalloendoproteinase 1-like            128   4e-32   
dbj|BAE98757.1|  predicted GPI-anchored protein                         127   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177174.1|  matrix metalloproteinase                              127   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517862.1|  PREDICTED: metalloendoproteinase 1-like            127   6e-32   
ref|XP_010264870.1|  PREDICTED: metalloendoproteinase 1-like            127   6e-32   
ref|XP_006390919.1|  hypothetical protein EUTSA_v10018701mg             127   8e-32   
ref|XP_003519796.1|  PREDICTED: metalloendoproteinase 1-like            127   8e-32   
gb|KDO82628.1|  hypothetical protein CISIN_1g021444mg                   126   8e-32   
ref|XP_010039144.1|  PREDICTED: metalloendoproteinase 1-like            125   1e-31   
ref|XP_004965108.1|  PREDICTED: metalloendoproteinase 1-like            126   1e-31   
emb|CDY11609.1|  BnaC06g31300D                                          126   1e-31   
ref|XP_006438497.1|  hypothetical protein CICLE_v10031870mg             126   2e-31   
gb|EYU31381.1|  hypothetical protein MIMGU_mgv1a023026mg                124   2e-31   
emb|CDY38799.1|  BnaA07g28710D                                          126   2e-31   
ref|XP_007216922.1|  hypothetical protein PRUPE_ppa018385mg             125   2e-31   
ref|XP_006448956.1|  hypothetical protein CICLE_v10017926mg             125   2e-31   
ref|XP_004965107.1|  PREDICTED: metalloendoproteinase 1-like            125   2e-31   
gb|KDO37620.1|  hypothetical protein CISIN_1g039712mg                   122   2e-31   
emb|CCH68443.1|  matrix metalloproteinase precursor                     125   3e-31   
gb|EYU35921.1|  hypothetical protein MIMGU_mgv1a019701mg                124   3e-31   
ref|NP_001266203.1|  matrix metalloproteinase precursor                 125   3e-31   
ref|XP_010255281.1|  PREDICTED: metalloendoproteinase 1-like            125   4e-31   
ref|XP_010471013.1|  PREDICTED: metalloendoproteinase 1-like            125   4e-31   
ref|XP_006363533.1|  PREDICTED: metalloendoproteinase 1-like            125   4e-31   
ref|XP_004237082.2|  PREDICTED: metalloendoproteinase 1                 125   4e-31   
ref|XP_006416025.1|  hypothetical protein EUTSA_v10007920mg             125   5e-31   
gb|KDO75344.1|  hypothetical protein CISIN_1g037265mg                   124   5e-31   
ref|XP_006387200.1|  hypothetical protein POPTR_1544s00200g             124   5e-31   
gb|KDP21290.1|  hypothetical protein JCGZ_21761                         125   5e-31   
ref|XP_002325947.1|  hypothetical protein POPTR_0019s10230g             124   5e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010030761.1|  PREDICTED: metalloendoproteinase 1-like            124   5e-31   
gb|KFK44477.1|  hypothetical protein AALP_AA1G261400                    125   6e-31   
ref|XP_011080437.1|  PREDICTED: metalloendoproteinase 1-like            124   6e-31   
gb|KCW56124.1|  hypothetical protein EUGRSUZ_I01878                     124   6e-31   
ref|XP_007216495.1|  hypothetical protein PRUPE_ppa023859mg             120   6e-31   
ref|XP_004297896.1|  PREDICTED: metalloendoproteinase 1-like            124   7e-31   
gb|KFK41437.1|  hypothetical protein AALP_AA2G130300                    125   7e-31   
emb|CDY16241.1|  BnaA09g29750D                                          125   7e-31   
gb|KCW49215.1|  hypothetical protein EUGRSUZ_K02795                     124   1e-30   
ref|NP_001267680.1|  metalloendoproteinase 1-like precursor             123   1e-30   
ref|XP_006363534.1|  PREDICTED: metalloendoproteinase 1-like            124   1e-30   
ref|NP_173824.2|  putative metalloproteinase                            124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217804.1|  hypothetical protein PRUPE_ppa024325mg             124   1e-30   
gb|AAC00572.1|  similar to zinc metalloproteinases                      124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460187.1|  PREDICTED: metalloendoproteinase 1-like            124   1e-30   
ref|XP_007010134.1|  Matrixin family protein, putative                  122   2e-30   
gb|EAZ24565.1|  hypothetical protein OsJ_08327                          124   2e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ98922.1|  predicted protein                                      123   2e-30   
dbj|BAJ93963.1|  predicted protein                                      123   2e-30   
ref|XP_002893327.1|  hypothetical protein ARALYDRAFT_889959             124   2e-30   
gb|KCW85819.1|  hypothetical protein EUGRSUZ_B02562                     123   2e-30   
gb|EYU46220.1|  hypothetical protein MIMGU_mgv1a010241mg                122   3e-30   
ref|NP_001048075.1|  Os02g0740700                                       123   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057259.1|  Os06g0239100                                       123   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87473.1|  hypothetical protein OsI_08881                          123   3e-30   Oryza sativa Indica Group [Indian rice]
gb|EAZ00310.1|  hypothetical protein OsI_22327                          123   3e-30   Oryza sativa Indica Group [Indian rice]
gb|KGN51345.1|  hypothetical protein Csa_5G522910                       122   3e-30   
ref|XP_004159085.1|  PREDICTED: metalloendoproteinase 1-like            122   3e-30   
ref|XP_009105693.1|  PREDICTED: metalloendoproteinase 1-like            123   3e-30   
ref|XP_007044491.1|  Matrixin family protein, putative                  123   3e-30   
ref|XP_009104967.1|  PREDICTED: metalloendoproteinase 1-like            123   3e-30   
gb|ACB59207.1|  matrixin family protein                                 123   4e-30   Brassica oleracea
ref|XP_009115471.1|  PREDICTED: metalloendoproteinase 1                 123   4e-30   
ref|XP_011010763.1|  PREDICTED: metalloendoproteinase 1-like            121   5e-30   
ref|XP_002520211.1|  Metalloendoproteinase 1 precursor, putative        122   5e-30   Ricinus communis
ref|XP_006304956.1|  hypothetical protein CARUB_v10011449mg             122   5e-30   
ref|XP_010552627.1|  PREDICTED: metalloendoproteinase 1                 122   5e-30   
ref|XP_009624303.1|  PREDICTED: metalloendoproteinase 1-like            122   6e-30   
gb|ABF58910.1|  matrix metalloprotease 1                                122   6e-30   Nicotiana tabacum [American tobacco]
ref|NP_001235535.1|  metalloendoproteinase 1 precursor                  121   6e-30   
ref|XP_010498935.1|  PREDICTED: metalloendoproteinase 1-like            122   6e-30   
ref|XP_009758591.1|  PREDICTED: metalloendoproteinase 1-like            122   6e-30   
gb|ACU20327.1|  unknown                                                 121   7e-30   Glycine max [soybeans]
ref|NP_001142095.1|  hypothetical protein precursor                     122   7e-30   Zea mays [maize]
ref|XP_010524412.1|  PREDICTED: metalloendoproteinase 1                 121   8e-30   
ref|XP_002311051.2|  hypothetical protein POPTR_0008s02790g             120   9e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002511639.1|  Metalloendoproteinase 1 precursor, putative        121   1e-29   Ricinus communis
emb|CDX68356.1|  BnaA07g23960D                                          121   1e-29   
gb|AES96374.2|  matrix metalloproteinase                                121   1e-29   
ref|XP_002267298.2|  PREDICTED: metalloendoproteinase 1                 121   1e-29   Vitis vinifera
emb|CAN76268.1|  hypothetical protein VITISV_004096                     121   1e-29   Vitis vinifera
emb|CDY23516.1|  BnaC06g24850D                                          121   2e-29   
ref|XP_004159086.1|  PREDICTED: matrix metalloproteinase-9-like         120   2e-29   
ref|XP_004142459.1|  PREDICTED: matrix metalloproteinase-9-like         120   2e-29   
ref|XP_003613416.1|  Matrix metalloproteinase-9                         121   2e-29   
ref|XP_008458917.1|  PREDICTED: metalloendoproteinase 1-like            119   2e-29   
emb|CBI34986.3|  unnamed protein product                                120   2e-29   
gb|KCW49214.1|  hypothetical protein EUGRSUZ_K02794                     118   2e-29   
ref|XP_004142465.1|  PREDICTED: metalloendoproteinase 1-like            119   2e-29   
gb|EYU46222.1|  hypothetical protein MIMGU_mgv1a027058mg                119   2e-29   
ref|XP_004142468.1|  PREDICTED: metalloendoproteinase 1-like            119   2e-29   
ref|XP_004167464.1|  PREDICTED: metalloendoproteinase 1-like            119   2e-29   
ref|XP_004142466.1|  PREDICTED: metalloendoproteinase 1-like            119   2e-29   
ref|XP_010477738.1|  PREDICTED: metalloendoproteinase 1                 120   2e-29   
gb|EYU46221.1|  hypothetical protein MIMGU_mgv1a010535mg                119   3e-29   
ref|XP_008458910.1|  PREDICTED: metalloendoproteinase 1-like            119   3e-29   
ref|XP_011003818.1|  PREDICTED: metalloendoproteinase 1-like            119   3e-29   
ref|XP_003560867.1|  PREDICTED: metalloendoproteinase 1-like            120   3e-29   
ref|XP_010434790.1|  PREDICTED: metalloendoproteinase 1-like            120   4e-29   
ref|XP_010414620.1|  PREDICTED: metalloendoproteinase 1-like            120   4e-29   
ref|XP_010043822.1|  PREDICTED: metalloendoproteinase 1-like            120   4e-29   
ref|XP_010053954.1|  PREDICTED: metalloendoproteinase 1                 120   4e-29   
gb|KDO75343.1|  hypothetical protein CISIN_1g043086mg                   118   4e-29   
ref|XP_006647869.1|  PREDICTED: metalloendoproteinase 1-like            120   5e-29   
ref|XP_002319607.2|  hypothetical protein POPTR_0013s03350g             119   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011003815.1|  PREDICTED: metalloendoproteinase 1-like            119   6e-29   
ref|XP_008458715.1|  PREDICTED: metalloendoproteinase 1-like            119   6e-29   
emb|CDP00221.1|  unnamed protein product                                119   6e-29   
ref|XP_010264331.1|  PREDICTED: metalloendoproteinase 1-like            119   7e-29   
emb|CDY30915.1|  BnaC09g14910D                                          119   8e-29   
gb|AET01165.2|  matrix metalloproteinase                                119   1e-28   
ref|XP_011086481.1|  PREDICTED: metalloendoproteinase 1-like            119   1e-28   
ref|XP_007157519.1|  hypothetical protein PHAVU_002G076600g             119   1e-28   
gb|ADD21635.1|  matrix metalloprotease 1                                118   1e-28   Nicotiana benthamiana
gb|KDP28814.1|  hypothetical protein JCGZ_14585                         118   1e-28   
ref|XP_006371427.1|  hypothetical protein POPTR_0019s10270g             117   1e-28   
ref|XP_010440122.1|  PREDICTED: metalloendoproteinase 1-like            118   1e-28   
dbj|BAJ94792.1|  predicted protein                                      118   1e-28   
ref|XP_006838196.1|  hypothetical protein AMTR_s00106p00141160          118   1e-28   
ref|XP_011042944.1|  PREDICTED: metalloendoproteinase 1-like            118   2e-28   
ref|XP_008389591.1|  PREDICTED: metalloendoproteinase 1-like            118   2e-28   
ref|XP_010449738.1|  PREDICTED: metalloendoproteinase 1-like            118   2e-28   
ref|XP_003626689.1|  Matrix metalloproteinase-27                        118   2e-28   
ref|XP_007052204.1|  Matrixin family protein                            117   2e-28   
ref|XP_008465718.1|  PREDICTED: metalloendoproteinase 1                 117   3e-28   
gb|ABK95950.1|  unknown                                                 117   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006376166.1|  hypothetical protein POPTR_0013s10410g             117   3e-28   
gb|KFK40830.1|  hypothetical protein AALP_AA2G047000                    117   3e-28   
ref|XP_009136800.1|  PREDICTED: metalloendoproteinase 1-like            117   3e-28   
ref|XP_004297678.1|  PREDICTED: metalloendoproteinase 1-like            117   3e-28   
ref|NP_001151749.1|  metalloendoproteinase 1 precursor                  117   3e-28   Zea mays [maize]
ref|XP_010910625.1|  PREDICTED: metalloendoproteinase 1-like            117   3e-28   
ref|XP_007216020.1|  hypothetical protein PRUPE_ppa014830mg             116   4e-28   
ref|XP_010510985.1|  PREDICTED: metalloendoproteinase 1-like            117   4e-28   
ref|XP_002870142.1|  hypothetical protein ARALYDRAFT_493212             117   4e-28   
ref|XP_008244963.1|  PREDICTED: metalloendoproteinase 1                 117   4e-28   
gb|KHN28682.1|  Metalloendoproteinase 1                                 117   5e-28   
ref|XP_004504503.1|  PREDICTED: metalloendoproteinase 1-like            117   6e-28   
gb|EYU28648.1|  hypothetical protein MIMGU_mgv1a008442mg                116   6e-28   
ref|XP_008353003.1|  PREDICTED: metalloendoproteinase 1-like            116   7e-28   
emb|CDX90504.1|  BnaA03g42770D                                          116   7e-28   
ref|XP_011020982.1|  PREDICTED: metalloendoproteinase 1-like            114   7e-28   
gb|KFK37298.1|  hypothetical protein AALP_AA4G239100                    116   7e-28   
gb|KDP32993.1|  hypothetical protein JCGZ_13024                         115   8e-28   
ref|XP_006293383.1|  hypothetical protein CARUB_v10023542mg             115   1e-27   
ref|XP_006371425.1|  hypothetical protein POPTR_0019s10250g             112   1e-27   
ref|XP_002318762.2|  MATRIX METALLOproteinASE                           115   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_004142843.1|  PREDICTED: metalloendoproteinase 1-like            114   1e-27   
gb|KGN52417.1|  hypothetical protein Csa_5G633150                       114   2e-27   
ref|XP_011080438.1|  PREDICTED: metalloendoproteinase 1-like            114   2e-27   
ref|XP_006375259.1|  hypothetical protein POPTR_0014s05720g             115   2e-27   
ref|XP_004143787.1|  PREDICTED: metalloendoproteinase 1-like            115   2e-27   
ref|XP_011002109.1|  PREDICTED: metalloendoproteinase 1-like            115   2e-27   
ref|XP_004142460.1|  PREDICTED: metalloendoproteinase 1-like            114   2e-27   
ref|XP_010508218.1|  PREDICTED: metalloendoproteinase 1-like            115   2e-27   
ref|NP_176205.1|  Matrixin family protein                               115   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322292.2|  hypothetical protein POPTR_0015s11510g             115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002436777.1|  hypothetical protein SORBIDRAFT_10g008650          115   2e-27   Sorghum bicolor [broomcorn]
ref|XP_011033214.1|  PREDICTED: metalloendoproteinase 1                 114   3e-27   
emb|CDY66521.1|  BnaCnng51190D                                          114   3e-27   
ref|XP_010518113.1|  PREDICTED: metalloendoproteinase 1-like            114   3e-27   
ref|XP_002888162.1|  predicted protein                                  114   3e-27   
ref|NP_193397.1|  Matrixin family protein                               114   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42162.1|  putative proteinase                                     114   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274477.1|  PREDICTED: metalloendoproteinase 1                 114   5e-27   Vitis vinifera
ref|XP_010100525.1|  Metalloendoproteinase 1                            114   6e-27   
ref|XP_006357274.1|  PREDICTED: metalloendoproteinase 1-like            113   6e-27   
emb|CDY45157.1|  BnaA09g14350D                                          113   7e-27   
ref|XP_009360449.1|  PREDICTED: metalloendoproteinase 1                 114   7e-27   
gb|EYU46223.1|  hypothetical protein MIMGU_mgv1a025538mg                112   8e-27   
gb|AAM62476.1|  proteinase like protein                                 113   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223246.1|  hypothetical protein PRUPE_ppa007227mg             113   9e-27   
ref|XP_006414320.1|  hypothetical protein EUTSA_v10025551mg             113   1e-26   
ref|XP_004511690.1|  PREDICTED: metalloendoproteinase 1-like            113   1e-26   
ref|XP_003611315.1|  Matrix metalloproteinase-28                        112   1e-26   
ref|XP_004953898.1|  PREDICTED: metalloendoproteinase 1-like            113   1e-26   
ref|XP_009113266.1|  PREDICTED: metalloendoproteinase 1                 113   1e-26   
ref|XP_006367952.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
ref|XP_006397684.1|  hypothetical protein EUTSA_v10001525mg             112   2e-26   
ref|XP_009626465.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
ref|XP_008373793.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
ref|XP_009351242.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
gb|EYU34693.1|  hypothetical protein MIMGU_mgv1a025583mg                108   2e-26   
ref|XP_009368959.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
ref|XP_006283956.1|  hypothetical protein CARUB_v10005079mg             112   2e-26   
ref|XP_010444942.1|  PREDICTED: metalloendoproteinase 1-like            112   2e-26   
ref|XP_010325488.1|  PREDICTED: metalloendoproteinase 1                 112   3e-26   
ref|XP_007033356.1|  Matrixin family protein, putative                  112   3e-26   
gb|KHN16358.1|  Metalloendoproteinase 1                                 111   3e-26   
ref|XP_004510108.1|  PREDICTED: metalloendoproteinase 1-like            111   3e-26   
ref|XP_010451026.1|  PREDICTED: metalloendoproteinase 1-like            111   4e-26   
ref|XP_004167465.1|  PREDICTED: metalloendoproteinase 1-like            108   4e-26   
ref|XP_010089255.1|  Metalloendoproteinase 1                            111   4e-26   
ref|XP_006440301.1|  hypothetical protein CICLE_v10024210mg             111   4e-26   
ref|XP_010470167.1|  PREDICTED: metalloendoproteinase 1-like            111   4e-26   
ref|XP_008369492.1|  PREDICTED: metalloendoproteinase 1                 111   4e-26   
gb|EPS61169.1|  matrixin family protein                                 110   4e-26   
ref|XP_006387815.1|  hypothetical protein POPTR_0547s00200g             111   4e-26   
ref|XP_002873690.1|  predicted protein                                  108   5e-26   
ref|XP_006355432.1|  PREDICTED: metalloendoproteinase 1-like            111   6e-26   
ref|XP_006300514.1|  hypothetical protein CARUB_v10020497mg             111   6e-26   
ref|XP_009334548.1|  PREDICTED: metalloendoproteinase 1                 111   6e-26   
gb|EYU22461.1|  hypothetical protein MIMGU_mgv1a008611mg                111   6e-26   
ref|XP_007010972.1|  Matrixin family protein                            110   8e-26   
ref|XP_011001486.1|  PREDICTED: metalloendoproteinase 1-like            110   9e-26   
ref|XP_006369019.1|  senescence-specific family protein                 110   9e-26   
gb|AAC31167.1|  metalloproteinase                                       110   1e-25   
ref|XP_009143096.1|  PREDICTED: metalloendoproteinase 1                 110   1e-25   
ref|XP_006477577.1|  PREDICTED: metalloendoproteinase 1-like            110   1e-25   
ref|XP_001774956.1|  predicted protein                                  109   1e-25   
ref|XP_008802827.1|  PREDICTED: metalloendoproteinase 1-like            110   1e-25   
ref|XP_002534615.1|  Metalloendoproteinase 1 precursor, putative        109   1e-25   
ref|XP_006603838.1|  PREDICTED: metalloendoproteinase 1-like            109   1e-25   
emb|CDX74706.1|  BnaA05g04520D                                          109   1e-25   
ref|XP_008376281.1|  PREDICTED: metalloendoproteinase 1-like            110   1e-25   
gb|KHN01125.1|  Metalloendoproteinase 1                                 108   2e-25   
ref|XP_002880153.1|  matrix metalloproteinase                           109   2e-25   
ref|XP_006431002.1|  hypothetical protein CICLE_v10013597mg             107   2e-25   
ref|NP_182030.1|  matrixin family protein                               109   2e-25   
ref|XP_004301194.1|  PREDICTED: metalloendoproteinase 1-like            109   2e-25   
ref|XP_009418044.1|  PREDICTED: metalloendoproteinase 1-like            109   3e-25   
emb|CAN66084.1|  hypothetical protein VITISV_024635                     109   3e-25   
ref|XP_011094514.1|  PREDICTED: metalloendoproteinase 1                 108   3e-25   
ref|XP_007151139.1|  hypothetical protein PHAVU_004G021000g             108   4e-25   
ref|XP_002304280.1|  hypothetical protein POPTR_0003s07510g             108   4e-25   
emb|CDY18956.1|  BnaC04g03940D                                          108   5e-25   
ref|XP_002452573.1|  hypothetical protein SORBIDRAFT_04g028370          108   5e-25   
emb|CDY40518.1|  BnaC01g19940D                                          108   5e-25   
ref|XP_009145660.1|  PREDICTED: metalloendoproteinase 1-like            108   6e-25   
ref|XP_009610496.1|  PREDICTED: metalloendoproteinase 1-like            108   6e-25   
gb|KHN25070.1|  Metalloendoproteinase 1                                 108   7e-25   
ref|XP_006583548.1|  PREDICTED: metalloendoproteinase 1-like            107   9e-25   
ref|NP_001006278.1|  matrilysin precursor                               106   1e-24   
ref|XP_009397655.1|  PREDICTED: metalloendoproteinase 1-like            107   1e-24   
ref|XP_008458911.1|  PREDICTED: metalloendoproteinase 1-like            107   1e-24   
ref|XP_009398117.1|  PREDICTED: metalloendoproteinase 1                 107   2e-24   
ref|XP_006361512.1|  PREDICTED: metalloendoproteinase 1-like            107   2e-24   
ref|XP_008379873.1|  PREDICTED: metalloendoproteinase 1-like            106   2e-24   
ref|XP_010695886.1|  PREDICTED: metalloendoproteinase 1-like            106   2e-24   
emb|CBI34984.3|  unnamed protein product                                109   2e-24   
ref|XP_003573113.1|  PREDICTED: metalloendoproteinase 1-like            106   2e-24   
ref|XP_011010768.1|  PREDICTED: metalloendoproteinase 1-like            103   3e-24   
ref|XP_007157294.1|  hypothetical protein PHAVU_002G058000g             105   3e-24   
ref|XP_004169198.1|  PREDICTED: metalloendoproteinase 1-like            105   3e-24   
ref|XP_011032037.1|  PREDICTED: metalloendoproteinase 1                 106   4e-24   
ref|XP_008238512.1|  PREDICTED: metalloendoproteinase 1                 106   4e-24   
ref|XP_006577655.1|  PREDICTED: metalloendoproteinase 1-like            105   4e-24   
ref|XP_004152428.1|  PREDICTED: metalloendoproteinase 1-like            105   4e-24   
ref|XP_009685061.1|  PREDICTED: matrilysin                              104   5e-24   
ref|XP_007219827.1|  hypothetical protein PRUPE_ppa026649mg             105   5e-24   
gb|KFV87419.1|  Matrilysin                                              104   5e-24   
ref|XP_005010554.1|  PREDICTED: matrilysin isoform X2                   104   6e-24   
gb|EOB07965.1|  Matrilysin                                              104   6e-24   
ref|XP_007134548.1|  hypothetical protein PHAVU_010G056300g             105   7e-24   
ref|XP_007157295.1|  hypothetical protein PHAVU_002G058000g             105   7e-24   
gb|KHN16355.1|  Metalloendoproteinase 1                                 104   8e-24   
ref|XP_005010553.1|  PREDICTED: matrilysin isoform X1                   104   8e-24   
ref|XP_003554856.1|  PREDICTED: metalloendoproteinase 1-like            104   8e-24   
ref|XP_007041108.1|  Matrix metalloproteinase, putative                 103   9e-24   
ref|XP_008458913.1|  PREDICTED: metalloendoproteinase 1-like            104   9e-24   
ref|XP_010538414.1|  PREDICTED: metalloendoproteinase 1                 104   1e-23   
ref|XP_010055492.1|  PREDICTED: metalloendoproteinase 1                 104   1e-23   
gb|KFV43873.1|  Stromelysin-2                                           103   1e-23   
ref|XP_009973912.1|  PREDICTED: matrilysin                              103   1e-23   
ref|XP_010110202.1|  Metalloendoproteinase 1                            104   1e-23   
ref|XP_003538740.1|  PREDICTED: metalloendoproteinase 1-like            104   1e-23   
ref|XP_007210794.1|  hypothetical protein PRUPE_ppa018176mg             104   1e-23   
ref|XP_010553642.1|  PREDICTED: metalloendoproteinase 1                 104   2e-23   
ref|XP_008233236.1|  PREDICTED: metalloendoproteinase 1-like            104   2e-23   
gb|EYU29749.1|  hypothetical protein MIMGU_mgv1a023711mg                103   2e-23   
gb|KGL80216.1|  Matrilysin                                              102   2e-23   
gb|KGN50256.1|  hypothetical protein Csa_5G162050                       103   2e-23   
ref|XP_002892736.1|  predicted protein                                  101   2e-23   
ref|XP_010171235.1|  PREDICTED: matrilysin                              102   2e-23   
gb|KFZ48066.1|  Stromelysin-1                                           102   3e-23   
ref|XP_009780227.1|  PREDICTED: metalloendoproteinase 1-like            103   3e-23   
ref|XP_009958192.1|  PREDICTED: matrilysin                              102   3e-23   
gb|EYU31934.1|  hypothetical protein MIMGU_mgv1a021000mg                103   3e-23   
ref|XP_009554452.1|  PREDICTED: matrilysin                              102   3e-23   
gb|KFQ16528.1|  Stromelysin-1                                           102   3e-23   
ref|XP_010217214.1|  PREDICTED: matrilysin                              103   3e-23   
gb|KFO69571.1|  Stromelysin-1                                           102   3e-23   
gb|KHN34932.1|  Metalloendoproteinase 1                                 103   3e-23   
ref|XP_004248606.1|  PREDICTED: metalloendoproteinase 1-like            103   4e-23   
ref|XP_002464938.1|  hypothetical protein SORBIDRAFT_01g029150          102   6e-23   
gb|KHN16360.1|  Metalloendoproteinase 1                                 102   6e-23   
gb|EAY79487.1|  hypothetical protein OsI_34615                          102   7e-23   
ref|XP_003203531.1|  PREDICTED: matrilysin                              101   7e-23   
ref|XP_005230633.1|  PREDICTED: stromelysin-2                           102   7e-23   
ref|XP_003635123.1|  PREDICTED: metalloendoproteinase 1                 102   7e-23   
ref|XP_008437072.1|  PREDICTED: metalloendoproteinase 1                 102   8e-23   
ref|XP_009936824.1|  PREDICTED: matrilysin                              101   8e-23   
gb|KGN52411.1|  hypothetical protein Csa_5G632100                       102   8e-23   
gb|KFR13852.1|  Matrilysin                                              101   8e-23   
ref|NP_001065361.2|  Os10g0557900                                       102   1e-22   
ref|XP_008658321.1|  PREDICTED: metalloendoproteinase 1-like            102   1e-22   
ref|XP_008921032.1|  PREDICTED: matrilysin                              101   1e-22   
ref|XP_010692448.1|  PREDICTED: metalloendoproteinase 1                 102   1e-22   
ref|XP_007220919.1|  hypothetical protein PRUPE_ppb025548mg             101   1e-22   
ref|XP_010320628.1|  PREDICTED: metalloendoproteinase 1                 102   1e-22   
emb|CDP09976.1|  unnamed protein product                                101   1e-22   
gb|KCW77797.1|  hypothetical protein EUGRSUZ_D02088                     101   1e-22   
ref|XP_009708511.1|  PREDICTED: matrilysin                              100   1e-22   
gb|KFW80035.1|  Matrilysin                                              100   2e-22   
ref|XP_009640064.1|  PREDICTED: matrilysin                              100   2e-22   
gb|KFP62029.1|  Stromelysin-1                                           100   2e-22   
emb|CDP09487.1|  unnamed protein product                                101   2e-22   
ref|XP_005432126.1|  PREDICTED: 72 kDa type IV collagenase-like         100   2e-22   
ref|XP_008458908.1|  PREDICTED: metalloendoproteinase 1-like            101   2e-22   
gb|EYU34692.1|  hypothetical protein MIMGU_mgv1a022100mg              98.2    2e-22   
ref|XP_010053486.1|  PREDICTED: metalloendoproteinase 1-like            101   2e-22   
ref|XP_009629020.1|  PREDICTED: metalloendoproteinase 1-like            101   2e-22   
gb|KFP18449.1|  Stromelysin-1                                           100   2e-22   
gb|EMC80518.1|  Matrilysin                                              100   2e-22   
ref|XP_004452921.1|  PREDICTED: matrix metalloproteinase-20             102   2e-22   
gb|EYU29746.1|  hypothetical protein MIMGU_mgv1a022148mg              98.6    2e-22   
dbj|BAJ94176.1|  predicted protein                                      100   3e-22   
emb|CAN66781.1|  hypothetical protein VITISV_013507                     100   3e-22   
gb|KFP78211.1|  Matrilysin                                            99.8    3e-22   
gb|EPS70970.1|  hypothetical protein M569_03790                         100   3e-22   
ref|XP_007039816.1|  Matrixin family protein                            100   3e-22   
ref|XP_009070762.1|  PREDICTED: matrilysin                            99.8    3e-22   
gb|KFQ57727.1|  Stromelysin-1                                         99.8    3e-22   
gb|KFV67702.1|  Matrilysin                                            99.8    4e-22   
ref|XP_009899238.1|  PREDICTED: matrilysin                            99.8    4e-22   
ref|XP_007217818.1|  hypothetical protein PRUPE_ppb019632mg           99.4    4e-22   
ref|XP_009490287.1|  PREDICTED: matrilysin                            99.4    4e-22   
ref|XP_010009153.1|  PREDICTED: matrilysin                            99.4    4e-22   
ref|XP_002708614.1|  PREDICTED: matrix metalloproteinase-20             101   4e-22   
gb|KFQ46681.1|  Matrilysin                                            99.4    4e-22   
ref|XP_005501584.1|  PREDICTED: matrilysin                            99.8    4e-22   
ref|XP_003618349.1|  Interstitial collagenase                           100   5e-22   
ref|XP_009911932.1|  PREDICTED: matrilysin                            99.0    5e-22   
gb|KFV41114.1|  Stromelysin-1                                         99.0    5e-22   
ref|XP_004142458.1|  PREDICTED: metalloendoproteinase 1-like          97.1    5e-22   
gb|KFP99937.1|  Matrilysin                                            99.0    5e-22   
gb|EYU42526.1|  hypothetical protein MIMGU_mgv1a011887mg              99.0    6e-22   
ref|XP_009805940.1|  PREDICTED: matrilysin                            99.0    6e-22   
ref|XP_003516663.2|  PREDICTED: metalloendoproteinase 1-like          99.8    6e-22   
ref|XP_002969781.1|  hypothetical protein SELMODRAFT_13930            99.4    6e-22   
gb|EYU20655.1|  hypothetical protein MIMGU_mgv1a025968mg              97.1    6e-22   
gb|KFM04411.1|  Stromelysin-1                                         99.0    6e-22   
gb|KFZ69215.1|  Stromelysin-1                                         99.0    6e-22   
gb|KDP39879.1|  hypothetical protein JCGZ_03410                       99.8    7e-22   
ref|XP_009509073.1|  PREDICTED: matrilysin                            98.6    7e-22   
gb|KFW11249.1|  Matrilysin                                            98.6    7e-22   
gb|KFW77959.1|  Stromelysin-1                                         98.6    8e-22   
ref|XP_009272909.1|  PREDICTED: matrilysin                            99.0    8e-22   
ref|XP_010156415.1|  PREDICTED: matrilysin                            98.6    8e-22   
ref|XP_009320559.1|  PREDICTED: matrilysin                            98.6    8e-22   
gb|KFW65911.1|  Stromelysin-1                                         98.6    8e-22   
ref|XP_011081262.1|  PREDICTED: metalloendoproteinase 1-like          99.4    8e-22   
gb|EYU29747.1|  hypothetical protein MIMGU_mgv1a025729mg              96.7    9e-22   
ref|XP_006013646.1|  PREDICTED: matrix metalloproteinase-25-like      99.4    9e-22   
gb|KFQ86525.1|  Matrilysin                                            98.2    1e-21   
ref|NP_001079874.1|  uncharacterized protein LOC379564 precursor      98.2    1e-21   
ref|XP_008520981.1|  PREDICTED: matrix metalloproteinase-20 isofo...  99.4    1e-21   
ref|XP_001500102.1|  PREDICTED: matrix metalloproteinase-20             100   1e-21   
ref|XP_001153208.1|  PREDICTED: matrix metalloproteinase-20             100   1e-21   
ref|XP_003828430.1|  PREDICTED: matrix metalloproteinase-20           99.8    2e-21   
ref|XP_009873395.1|  PREDICTED: matrilysin                            97.4    2e-21   
gb|KFP91609.1|  Matrilysin                                            97.4    2e-21   
ref|XP_006983832.1|  PREDICTED: matrix metalloproteinase-20           99.4    2e-21   
ref|XP_005077401.1|  PREDICTED: matrix metalloproteinase-20           98.6    2e-21   
ref|XP_008458914.1|  PREDICTED: metalloendoproteinase 1-like          97.8    2e-21   
ref|XP_002198049.2|  PREDICTED: 72 kDa type IV collagenase-like       97.4    3e-21   
ref|XP_008458912.1|  PREDICTED: metalloendoproteinase 1-like          97.8    3e-21   
gb|KFP32186.1|  Stromelysin-2                                         97.1    3e-21   
ref|XP_004661963.1|  PREDICTED: matrix metalloproteinase-20           99.4    3e-21   
ref|XP_009887715.1|  PREDICTED: matrilysin                            97.1    3e-21   
ref|XP_005149869.1|  PREDICTED: matrilysin                            97.1    3e-21   
ref|XP_002754395.1|  PREDICTED: matrix metalloproteinase-20           99.4    3e-21   
ref|XP_003780845.1|  PREDICTED: matrix metalloproteinase-20           99.0    3e-21   
ref|XP_010201314.1|  PREDICTED: matrilysin                            97.4    3e-21   
ref|XP_004585257.1|  PREDICTED: matrix metalloproteinase-20           99.4    3e-21   
ref|XP_003923822.1|  PREDICTED: matrix metalloproteinase-20           99.0    3e-21   
gb|KGL96791.1|  Stromelysin-1                                         97.1    3e-21   
ref|XP_002822444.1|  PREDICTED: matrix metalloproteinase-20           99.0    3e-21   
ref|XP_004052079.1|  PREDICTED: matrix metalloproteinase-20           99.0    4e-21   
ref|XP_004626205.1|  PREDICTED: neutrophil collagenase                98.6    4e-21   
gb|AAT70722.1|  matrix metalloproteinase 20 (enamelysin)              99.0    4e-21   
ref|XP_004983677.1|  PREDICTED: metalloendoproteinase 1-like          97.4    4e-21   
ref|XP_009475180.1|  PREDICTED: matrilysin                            96.7    4e-21   
gb|KFQ92902.1|  Matrix metalloproteinase-18                           96.7    4e-21   
ref|NP_004762.2|  matrix metalloproteinase-20 preproprotein           98.6    4e-21   
ref|XP_003496183.1|  PREDICTED: matrix metalloproteinase-20           98.6    4e-21   
ref|XP_007637744.1|  PREDICTED: matrix metalloproteinase-20           98.6    4e-21   
gb|EYU19330.1|  hypothetical protein MIMGU_mgv1a010192mg              97.1    5e-21   
ref|NP_038931.1|  matrix metalloproteinase-20 precursor               98.6    5e-21   
ref|XP_002988587.1|  hypothetical protein SELMODRAFT_128150           97.1    5e-21   
gb|KFV96739.1|  Stromelysin-1                                         96.3    6e-21   
ref|XP_009571839.1|  PREDICTED: matrilysin                            96.3    6e-21   
emb|CAA73317.1|  enamelysin                                           98.2    6e-21   
ref|XP_003574325.2|  PREDICTED: metalloendoproteinase 1-like          97.8    6e-21   
gb|KFP52111.1|  Matrilysin                                            95.9    7e-21   
ref|XP_002979138.1|  hypothetical protein SELMODRAFT_110370           97.1    7e-21   
ref|XP_004604868.1|  PREDICTED: matrix metalloproteinase-20           98.2    7e-21   
ref|XP_006627924.1|  PREDICTED: matrix metalloproteinase-20-like      96.7    7e-21   
gb|KFO07157.1|  Matrilysin                                            95.9    7e-21   
gb|ERE75957.1|  matrix metalloproteinase-20                           99.0    7e-21   
ref|XP_010302293.1|  PREDICTED: matrilysin                            95.9    8e-21   
ref|XP_008577848.1|  PREDICTED: matrix metalloproteinase-20           97.8    8e-21   
ref|XP_006206761.1|  PREDICTED: matrix metalloproteinase-20           97.8    8e-21   
ref|XP_006186259.1|  PREDICTED: matrix metalloproteinase-20           97.8    9e-21   
gb|ABK51704.1|  matrix metalloproteinase 20                           97.1    9e-21   
ref|NP_001027506.1|  matrix metallopeptidase 13 (collagenase 3) p...  95.5    1e-20   
ref|XP_005378038.1|  PREDICTED: matrix metalloproteinase-20 isofo...  97.1    1e-20   



>ref|XP_008230957.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=310

 Score =   157 bits (398),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 97/169 (57%), Gaps = 10/169 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  T+S+MMMPRCGVPDIINGT  MR  ++             YA F G PKWP N
Sbjct  103  TGTLDTKTISKMMMPRCGVPDIINGTTAMRSGKKRHPHHHGGHTVAHYAFFQGSPKWPAN  162

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGDGYP  148
            K  LTYGF   TP      V  AF  W     F F R     SADLK    + +HGDG P
Sbjct  163  KYHLTYGFARGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGRP  222

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDG GG  AH++ P  G  H+D++E W   G  P G+D+++VALHEIGH
Sbjct  223  FDGPGGVLAHAYAPTNGRFHYDADETWV-VGAVPGGMDLETVALHEIGH  270



>ref|XP_008352994.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 99/173 (57%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA TVS+MMMPRCGVPDIINGT  MR  ++                 Y+ FPG PK
Sbjct  98   TGTLDAKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            WP +K  LTY F   TP +    V  AF  W     F F ++  Y +ADL     + DHG
Sbjct  158  WPSSKYHLTYAFDQTTPTEARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PFDGRGG  AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  218  DGNPFDGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGH  269



>ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=311

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 101/171 (59%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LD++TV++MMMPRCGV DIINGT  M+   +               Y  FPG P+WP
Sbjct  102  TGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNPRWP  161

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             +K  LTYGF   TP +   PV  AF  W     F+F R  DY +AD+    +  DHGDG
Sbjct  162  ASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQDYRAADITIGFHRGDHGDG  221

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDGRGG  AH+F P+ G  H+D +E+WA  G      D+++VALHEIGH
Sbjct  222  SPFDGRGGTLAHAFAPQDGRFHYDGDEHWA-VGATQGAFDVETVALHEIGH  271



>gb|EYU34696.1| hypothetical protein MIMGU_mgv11b016964mg [Erythranthe guttata]
Length=312

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 99/172 (58%), Gaps = 14/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA TVS+M  PRCGVPDIING N M++H  +                Y+  PG P+
Sbjct  103  TGTLDATTVSKMTTPRCGVPDIINGKNTMQKHGTKEHESNSSSKHIHTVSHYSFLPGNPR  162

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGD  157
            WP +K  LTY F   TP     PV  AF  W  +  F F     +SADL    ++ DHGD
Sbjct  163  WPRSKTHLTYMFSANTPAAAVGPVSRAFQKWASSTHFTFSLAQ-SSADLVIGFHSGDHGD  221

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G PFDGRGG  AH+F P  G  H+D++E W+  GP  D  D+++VALHEIGH
Sbjct  222  GNPFDGRGGTLAHAFAPTNGRFHYDADELWS-VGPVQDAFDLETVALHEIGH  272



>ref|XP_008230676.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=299

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 97/166 (58%), Gaps = 7/166 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-----RRHRREVAPQYAHFPGKPKWPDNKQV  316
            TG LD  TVS MM+PRCGVPDIINGT  M     + H      +Y+ F G PKWP  K  
Sbjct  93   TGRLDVKTVSNMMIPRCGVPDIINGTTSMISRKIQHHEGLTVSKYSFFSGNPKWPSAKYR  152

Query  315  LTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDG  139
            LTY F   TP +   PV  AF  W    +F F + + Y + DL       DHGDGYPFDG
Sbjct  153  LTYAFLQGTPNQAKDPVKRAFQSWANNTQFTFSQVEAYETPDLTISFQRLDHGDGYPFDG  212

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            RGG  AH+F P  G  H+D++E W   G    G+D+QS+A+HEIGH
Sbjct  213  RGGVTAHAFSPTDGRFHYDADEMWV-VGSVNGGMDLQSIAVHEIGH  257



>ref|XP_007216949.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
 gb|EMJ18148.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
Length=252

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+LDA TVS MMMPRCGVPDIINGT+ MR  ++     Y  FPGKPKWP +K  LTY F
Sbjct  55   TGILDAQTVSNMMMPRCGVPDIINGTSSMRSGKQ--IAHYTFFPGKPKWPASKYHLTYAF  112

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASA-DLKFHLYARDHGDGYPFDGRGGEY  124
               TP     PV  AF  W    +FKF +       DL    + R HGDG+PFDG GG  
Sbjct  113  LRGTPTAAKGPVARAFNTWAAHTQFKFSQARRNQKPDLTVSFHRRSHGDGHPFDGPGGIL  172

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AHSF PK G  H+D++E W+  G       +++VALHEIGH
Sbjct  173  AHSFAPKDGRFHYDADEKWS-VGVVRGAFHLETVALHEIGH  212



>ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=315

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 101/171 (59%), Gaps = 13/171 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR----------REVAPQYAHFPGKPKWP  331
            TG LD++TVSQM+ PRCG  DIINGTN MR  +          R VA  Y+ F G P+WP
Sbjct  107  TGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRTVA-HYSFFSGSPRWP  165

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             +K  LTY F   TP     PV  AF  W  A  F F    D+ SAD+    +  DHGDG
Sbjct  166  PSKTYLTYAFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDG  225

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            YPFDG GG  AH+F P  G  H+D +E W+  G  P+ +D+++VALHEIGH
Sbjct  226  YPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGH  275



>ref|XP_008343421.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 96/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LD  TVS+MMMPRCGVPDIINGT  MR  ++                 Y+ FPG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            WP +K  LTY F   TP      V  AF  W     F F ++  Y +ADL     + DHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PF GRGG  AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGH  269



>ref|XP_008361888.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 96/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LD  TVS+MMMPRCGVPDIINGT  MR  ++                 Y+ FPG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            WP +K  LTY F   TP      V  AF  W     F F ++  Y +ADL     + DHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PF GRGG  AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGXYDLETVALHEIGH  269



>ref|XP_008230961.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=311

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 98/172 (57%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR-----------HRREVAPQYAHFPGKPKW  334
            TG+LD  TVS MMMPRCGVPDIINGT+ MR            H+      YA FPGKPKW
Sbjct  101  TGILDTQTVSNMMMPRCGVPDIINGTSSMRSGKQSHPPPNHHHKGHTVAHYAFFPGKPKW  160

Query  333  PDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGD  157
            P +K  LTY F   TP     PV  AF  W    +FKF +       DL    + R HGD
Sbjct  161  PASKYHLTYAFLRGTPTAAKGPVARAFNTWAAHTQFKFSQAPRNQKPDLTVSFHRRSHGD  220

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G+PFDG GG  AHSF PK G  H+D++E W+  G       +++VALHEIGH
Sbjct  221  GHPFDGPGGILAHSFAPKDGRFHYDADEKWS-VGVVRGAFHLETVALHEIGH  271



>gb|EYU34695.1| hypothetical protein MIMGU_mgv1a024051mg, partial [Erythranthe 
guttata]
Length=224

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 98/172 (57%), Gaps = 14/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA TVS+M  PRCGVPDII+G N M++H  +                Y+ F G P+
Sbjct  15   TGTLDATTVSKMTTPRCGVPDIIDGKNTMQKHGTKEHESNSSSKHIHTVSHYSFFQGNPR  74

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGD  157
            WP +K  LTY F   TP     PV  AF  W  +  F F     +SADL    +  DHGD
Sbjct  75   WPPSKTHLTYRFLPNTPGAAVGPVSRAFQKWASSTHFTFSLAQ-SSADLVIGFHRGDHGD  133

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G PFDGRGG  AH+F P  G  H+D++E W+  GP  D  D+++VALHEIGH
Sbjct  134  GNPFDGRGGTLAHAFAPTNGRFHYDADEQWS-VGPVQDAFDLETVALHEIGH  184



>gb|KDP45419.1| hypothetical protein JCGZ_09668 [Jatropha curcas]
Length=270

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 98/178 (55%), Gaps = 19/178 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR-----------------HRREVAPQYAHF  352
            TG LD++TV  M+ PRCGVPDIINGTN M+                  +       YA F
Sbjct  54   TGTLDSETVETMIKPRCGVPDIINGTNRMQNGNISPSSSPSPSPSSSPNSFHTVSHYAFF  113

Query  351  PGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLY  175
            PG PKW  +K  LTY FG  TP      +  AF  W     F F+R TD  +AD+K    
Sbjct  114  PGTPKWEASKYHLTYEFGPQTPPIAIEVISQAFQTWANNSHFTFERGTDITTADIKIRFR  173

Query  174  ARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             RDHGDG PFDGRGG  AH++ P+ G  HFD+EENW   G      D+ +VALHEIGH
Sbjct  174  KRDHGDGIPFDGRGGILAHAYSPQDGRFHFDAEENWVT-GAREGAYDLGTVALHEIGH  230



>ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera]
Length=319

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 99/174 (57%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------------VAPQYAHFPGKP  340
            TG LD++TVS+M+ PRCGV DIINGTN M   ++                  Y+ FPG P
Sbjct  107  TGDLDSETVSEMVKPRCGVADIINGTNWMLSGKKRQYHGHGHGHGSLRTVAHYSFFPGSP  166

Query  339  KWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDH  163
            +WP +K  LTY F   TP     PV  A+  W  A  F F    DY SAD+    +  DH
Sbjct  167  RWPPSKTYLTYAFLPGTPNWAMSPVSRAYGRWDSATHFTFGWIQDYTSADMTISFHRLDH  226

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDG PFDG GG  AH+F P  G  H+D +E W+  G  P+ +D+++VALHEIGH
Sbjct  227  GDGSPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGH  279



>ref|XP_008458713.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=282

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 101/173 (58%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTN-------LMRRHRREV-----APQYAHFPGKPK  337
            TG LD  T+SQM  PRCGV DIING         L+ RHR+ +        +A F G  K
Sbjct  70   TGTLDNSTISQMSKPRCGVADIINGRTGMKSGKRLVNRHRKIIGHFHEVSHFAFFEGNLK  129

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHG  160
            WP++K  LTYGF   TP +   PV  AF  W     F F + ++Y +AD+K      DHG
Sbjct  130  WPNSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESNYENADIKVTFERGDHG  189

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG+PFD  GG  AH+F P  G  HFD+ E+WA+ G  P+  D+++VALHEIGH
Sbjct  190  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPNSYDMETVALHEIGH  241



>ref|XP_006431003.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
 gb|ESR44243.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
Length=254

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--------RHRREVAPQYAHFPGKPKWPDN  325
            TGVLDA+TV++M +PRCGV DI+NGT  MR         H       Y+ FP  PKWP +
Sbjct  44   TGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPAS  103

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
            K  LTY F   T      PV  AF  W    +FKF +  D+A+AD+K    + DHGDG P
Sbjct  104  KFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNP  163

Query  147  FDGRGGE---YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDGRGG     AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  164  FDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGH  214



>ref|XP_004296560.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------VAPQYAHFPGKPKWPDNK  322
            TG LD+ TVS+M  PRCGV DIINGT+ MR  ++            Y+ F G PKWP +K
Sbjct  102  TGTLDSKTVSKMTTPRCGVADIINGTSSMRSAKKRHHHGSLHTTAHYSFFQGNPKWPSSK  161

Query  321  QVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
              LTYGF   TP +    V  AF  W+    F F +   Y +ADLK      +HGDG  F
Sbjct  162  YHLTYGFLPNTPSEATGAVARAFATWEGNTHFTFSQAQSYENADLKIGFQRGNHGDGAAF  221

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG  AH+F P  GI H+D++E W+  G  P   D+++VALHEIGH
Sbjct  222  DGPGGTLAHAFSPTHGIFHYDADETWS-VGAVPGATDLETVALHEIGH  268



>gb|KDP45996.1| hypothetical protein JCGZ_11899 [Jatropha curcas]
 gb|KDP45997.1| hypothetical protein JCGZ_11900 [Jatropha curcas]
Length=309

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 100/170 (59%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRRE-----VAPQYAHFPGKPKWPD  328
            TG LD +T+S MMMPRCG+PDIING+  M      HR       +   Y  F GKPKWP 
Sbjct  101  TGFLDYETMSIMMMPRCGIPDIINGSTRMLSGKNNHRHSSSSFHMVSHYTFFRGKPKWPV  160

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  LTYGF   TP +    V  AF  W    +FKF    DY +ADLK   Y  +HGDG 
Sbjct  161  SKYNLTYGFEPSTPTEARGAVANAFETWATVTKFKFTSVQDYKTADLKIGFYRGEHGDGL  220

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P+ G  H+D++E +A  G      D+++VALHEIGH
Sbjct  221  PFDGPGGITAHAFAPQDGRFHYDADEKYA-VGAVQGAFDLKTVALHEIGH  269



>ref|XP_004296559.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 99/168 (59%), Gaps = 9/168 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR----RHRREVAPQYAHFP---GKPKWPDNK  322
            TG LD  TV++MMMPRCG+PDIINGT+ MR    RH        AH+    G PKWP +K
Sbjct  102  TGTLDGKTVAKMMMPRCGLPDIINGTSSMRSAKKRHHHGSIHTTAHYAFPAGNPKWPSSK  161

Query  321  QVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
              LTYGF   TP +    V  AF  W     F F +  +Y +ADLK      DHGDG  F
Sbjct  162  YHLTYGFLPGTPSEATGAVARAFATWAGNTHFTFSQAQNYENADLKIGFEKGDHGDGSAF  221

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG  AH+F P  G  H+D++ENW+  G  P   D++++ALHEIGH
Sbjct  222  DGPGGVLAHAFYPTDGRFHYDADENWS-VGAKPGAFDLETLALHEIGH  268



>ref|XP_004288499.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 98/168 (58%), Gaps = 9/168 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-------EVAPQYAHFPGKPKWPDNK  322
            TG LD  TVS+MMMPRCGVPDIINGT+ MR   +            Y+ FPG PKWP +K
Sbjct  103  TGKLDNKTVSKMMMPRCGVPDIINGTSFMRSANKGHHHGSIHTTALYSFFPGSPKWPSSK  162

Query  321  QVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPF  145
              LTYGF   T  +    V  AF  W K+ RF F     Y +ADLK      DHGDG PF
Sbjct  163  YHLTYGFLPGTRSEATAAVARAFATWAKSSRFTFSPAQSYYNADLKISFQRGDHGDGVPF  222

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG  AHSF P  G  H+D+++ W   G  P   D++SVALHEIGH
Sbjct  223  DGPGGILAHSFCPSDGRFHYDADDTWT-VGAKPGAFDLESVALHEIGH  269



>gb|KDO37621.1| hypothetical protein CISIN_1g035681mg [Citrus sinensis]
Length=320

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--------RHRREVAPQYAHFPGKPKWPDN  325
            TGVLDA+TV++M +PRCGV DI+NGT  MR         H       Y+ FP  PKWP +
Sbjct  110  TGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPAS  169

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
            K  LTY F   T      PV  AF  W    +FKF +  D+A+AD+K    + DHGDG P
Sbjct  170  KFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNP  229

Query  147  FDGRGGE---YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDGRGG     AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  230  FDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGH  280



>ref|XP_006495379.1| PREDICTED: metalloendoproteinase 1-like, partial [Citrus sinensis]
Length=235

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--------RHRREVAPQYAHFPGKPKWPDN  325
            TG+LDA+TV++M +PRCGV DI+NGT  MR         H       Y+ F G P+WP +
Sbjct  25   TGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPAS  84

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
            K  LTY F   T      PV  AF  W    +FKF +  D+A+AD+K    + DHGDG P
Sbjct  85   KFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNP  144

Query  147  FDGRGGE---YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDGRGG     AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  145  FDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGH  195



>ref|XP_007215990.1| hypothetical protein PRUPE_ppa011783mg [Prunus persica]
 gb|EMJ17189.1| hypothetical protein PRUPE_ppa011783mg [Prunus persica]
Length=196

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 90/157 (57%), Gaps = 9/157 (6%)
 Frame = -1

Query  447  MMMPRCGVPDIINGTNLMRRHRRE-------VAPQYAHFPGKPKWPDNKQVLTYGFGNPT  289
            M MPRCGVPDIINGT  MR  ++            YA F G PKWP NK  LTYGF   T
Sbjct  1    MEMPRCGVPDIINGTTSMRSGKKRGGHGSIHTVGHYAFFQGNPKWPANKYHLTYGFLQGT  60

Query  288  PFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGGEYAHSF  112
            P +    V  AF  WQ    F F +     SADLK     RDHGDG+PFDG  G  AH+F
Sbjct  61   PSEAVGAVARAFATWQGNTHFTFSQAQSIESADLKIGFGRRDHGDGHPFDGPYGTAAHAF  120

Query  111  RPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             P  G  H+D++E W   G  P GLD+++VALHEIGH
Sbjct  121  APTDGRFHYDADETWV-VGAVPGGLDLETVALHEIGH  156



>ref|XP_006482471.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=254

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--------RHRREVAPQYAHFPGKPKWPDN  325
            TG+LDA+TV++M +PRCGV DI+NGT  MR         H       Y+ F G P+WP +
Sbjct  44   TGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPAS  103

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
            K  LTY F   T      PV  AF  W    +FKF +  D+A+AD+K    + DHGDG P
Sbjct  104  KFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNP  163

Query  147  FDGRGGE---YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDGRGG     AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  164  FDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGH  214



>emb|CBI34985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 93/161 (58%), Gaps = 17/161 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD++TVSQM+ PRCG  DIINGTN MR                P+WP +K  LTY F
Sbjct  78   TGSLDSETVSQMVKPRCGAADIINGTNWMR---------------SPRWPPSKTYLTYAF  122

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGGEY  124
               TP     PV  AF  W  A  F F    D+ SAD+    +  DHGDGYPFDG GG  
Sbjct  123  LPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDGYPFDGPGGTI  182

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D +E W+  G  P+ +D+++VALHEIGH
Sbjct  183  AHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGH  222



>emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera]
Length=319

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 95/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            +G LD++TVS M+ PRCGV DIINGT+ MR   R              Y+   G P+WP 
Sbjct  99   SGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSFHTVAHYSFLAGSPRWPP  158

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  LTY F + TP      V  AF  W  A  F F  T DY +AD+K      DHGDG+
Sbjct  159  SKTHLTYAFLSGTPSTTMSAVTRAFGQWASATNFSFAETQDYTNADMKIGFQRGDHGDGH  218

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AHSF P  G  HFD +E+W   G      D+++VALHEIGH
Sbjct  219  PFDGPGGTIAHSFPPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGH  267



>ref|XP_006482472.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=320

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--------RHRREVAPQYAHFPGKPKWPDN  325
            TG+LDA+TV++M +PRCGV DI+NGT  MR         H       Y+ F G P+WP +
Sbjct  110  TGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPAS  169

Query  324  KQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
            K  LTY F   T      PV  AF  W    +FKF +  D+A+AD+K    + DHGDG P
Sbjct  170  KFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNP  229

Query  147  FDGRG---GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDGRG   G  AH+F P  G  H+D++E WA  G      D+++VALHEIGH
Sbjct  230  FDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGH  280



>ref|XP_008230962.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=314

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 92/170 (54%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            TG LDA TVS MMMPRCGV DIINGT+ MR  ++              Y+ F G PKWP 
Sbjct  105  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGKKRHPHHHHGGHTVAHYSFFQGNPKWPA  164

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDY-ASADLKFHLYARDHGDGY  151
            +K  LTY F   TP +   PV  AF  W     F F       + DL    +  +HGDG 
Sbjct  165  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEVQSNQNPDLTVSFHRGNHGDGA  224

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P  G  H+D+ E WA  G      D+QSVALHEIGH
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDAAEAWA-VGAVSGAFDLQSVALHEIGH  273



>ref|XP_008365496.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=319

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 95/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA TV +M+MPRCGV DIINGT  MR  ++                 Y+ F G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFFTGNPK  157

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            WP +K  LTY F   TP +    V  AF  W     F F ++ +Y +ADL       DHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEAXDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PFDGRGG  AH+F P     H+D++E WA  G   D  D+++VALHEI H
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEAWA-VGAVADAYDLETVALHEIXH  269



>ref|XP_008368314.1| PREDICTED: LOW QUALITY PROTEIN: metalloendoproteinase 1-like 
[Malus domestica]
Length=309

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 95/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA TV +M+MPRCGV DIINGT  MR  ++                 Y+   G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFXTGNPK  157

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            WP +K  LTY F   TP +    V  AF  W     F F ++ +Y +ADL       DHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEARDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PFDGRGG  AH+F P     H+D++E WA  G   D  D+++VALHEIGH
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEXWA-VGAVADAYDLETVALHEIGH  269



>ref|XP_010255256.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=309

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 99/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAP----------QYAHFPGKPKWP  331
            TG LD +T+ QM +PRCG PDI NGT  MR  + +  P          +Y+ F G P+WP
Sbjct  99   TGSLDPETLKQMSLPRCGAPDITNGTTSMRSGKEKKHPHERKTLHTVSRYSFFSGIPRWP  158

Query  330  DNKQVLTYGFGNPTPFKFFIPV-GLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGD  157
             +K +LTY F   TP     PV   AF  W    RF+F  T DY +AD+K      DHGD
Sbjct  159  PSKTLLTYAFLPGTPVSSMRPVCDRAFQRWAAVSRFRFQETQDYLTADIKISFERGDHGD  218

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             YPFDG GG  AH++ P  G  H+D++E W   G   DG D++SVA+HEIGH
Sbjct  219  KYPFDGPGGVLAHAYAPTDGRFHYDADEKWY-IGASLDGYDVESVAMHEIGH  269



>gb|KDO37628.1| hypothetical protein CISIN_1g039411mg [Citrus sinensis]
Length=222

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 96/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            TGVLD +TV+ M  PRCGV DI+NGT  MR   +              Y  FPG+P+WP 
Sbjct  13   TGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSHYEFFPGRPRWPP  72

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +   LTY F   TP +    VG AF  W     FKF +T DY +A+LK       HGD  
Sbjct  73   SNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLKISFQRGWHGDSS  132

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDGRGG  AH+  P+ GI  +D++E WA  G  P   D+++VALHEIGH
Sbjct  133  PFDGRGGTIAHAAPPRGGIFDYDADEQWA-VGARPGAFDLETVALHEIGH  181



>ref|XP_009341183.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=340

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 102/179 (57%), Gaps = 20/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------------VAPQYAH  355
            TG LD +TVS+MMMPRCGV D+INGT+ MR  +++                      Y+ 
Sbjct  122  TGTLDGETVSKMMMPRCGVADVINGTSSMRSGKKKHHQHDPDHDHHNHGSSVHAVSHYSF  181

Query  354  FPGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHL  178
            F G+ +WP +K  LTYGF   TP +   PV  AF  W     F+F R+ +Y  AD+K   
Sbjct  182  FKGRLRWPTSKHHLTYGFLPSTPTEAMGPVSHAFRTWASNTHFRFSRSRNYKRADIKISF  241

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
               DHGDG PFDG+GG  AH++ P  G  H+D++E W+  G      D+++VALHEIGH
Sbjct  242  EYSDHGDGSPFDGKGGVLAHAYAPTNGRFHYDADEPWS-VGALEGYYDLETVALHEIGH  299



>ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=319

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 94/170 (55%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            +G LD++TVS M+ PRCGV DIINGT+ MR   R              Y+ F G P+WP 
Sbjct  99   SGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSPRWPP  158

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +   LTY F + T       V  AF  W  A  F F  T DY +AD+K      DHGDG+
Sbjct  159  SNTHLTYAFLSGTSSTTMSAVTRAFGQWASATDFTFAETQDYTNADMKIGFQRGDHGDGF  218

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AHSF P  G  HFD +E+W   G      D+++VALHEIGH
Sbjct  219  PFDGPGGTIAHSFSPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGH  267



>ref|XP_008458907.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=316

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 96/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-------RHRR-----EVAPQYAHFPGKPK  337
            TG LDA T+  M  PRCGV DII+G   M+       +HR+          YA F G PK
Sbjct  104  TGTLDAKTLDLMSKPRCGVADIIDGKTRMKSGKKMVNQHRKINGHFHTVSHYAFFDGNPK  163

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHG  160
            WP +K  LTYGF   TP K   PVG AF  W     F F R + Y  AD+K    + DHG
Sbjct  164  WPASKFHLTYGFLPGTPSKAVAPVGRAFKTWGAHTHFNFSRASKYKKADIKISFRSGDHG  223

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG+ FDG GG  AH F P  G  HFD+ E+WA  G   D  D+++VALHEIGH
Sbjct  224  DGHSFDGVGGVIAHGFAPTDGRLHFDAIESWA-VGAVADSFDLETVALHEIGH  275



>ref|XP_008230959.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 94/170 (55%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------VAPQYAHFPGKPKWPDNK  322
            TG LDA TV +M +PRCGVPDIINGT  MR   +            YA F G PKWP NK
Sbjct  105  TGTLDAKTVKKMEIPRCGVPDIINGTTSMRSGNKRGGHGSTHTVGHYAFFQGNPKWPANK  164

Query  321  QVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY--  151
              LTYGF   TP +    V  AF  WQ    F F +   + SADLK      DHGDG   
Sbjct  165  YHLTYGFLQGTPSEAVGAVARAFATWQGNTHFTFSQAQSFESADLKIGFGRGDHGDGANN  224

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             FDG G   AH+F P  G  H+D++E W   G  P G D+++VALHEIGH
Sbjct  225  AFDGPGKTIAHAFPPSDGRFHYDADETWV-VGAVPGGFDLETVALHEIGH  273



>ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52418.1| hypothetical protein Csa_5G633160 [Cucumis sativus]
Length=313

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 96/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LD  T+ QM  PRCGV DIING   M+  +R V               +A F G  +
Sbjct  101  TGTLDNSTLMQMSKPRCGVADIINGKTSMKSGKRFVNQHRKISGHFHEVSHFAFFEGNLR  160

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHG  160
            WPD+K  LTYGF   TP +   PV  AF  W     F F + + Y +AD+K      DHG
Sbjct  161  WPDSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESKYENADIKISFEKGDHG  220

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG+PFD  GG  AH+F P  G  HFD+ E+WA+ G  P   D+++VALHEIGH
Sbjct  221  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPKSYDMETVALHEIGH  272



>ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52413.1| hypothetical protein Csa_5G632120 [Cucumis sativus]
Length=319

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 94/173 (54%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------------VAPQYAHFPGKPK  337
            TG LDA T++QM  PRCGV DII+G   MR  ++                 +A F G PK
Sbjct  106  TGTLDAMTIAQMSKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHSVSHFAFFDGNPK  165

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            WP  K  LTYGF   TP +   PV  AF  W     F F +  D  ++D+       DHG
Sbjct  166  WPATKSHLTYGFLPGTPSETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFETGDHG  225

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DGYPFDG GG  AH+F P  G  H D++E+WA  G   D  D+++VALHEIGH
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSDSFDLETVALHEIGH  277



>ref|XP_007014936.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY32555.1| Matrixin family protein, putative [Theobroma cacao]
Length=310

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 93/171 (54%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAP----------QYAHFPGKPKWP  331
            TG LD+ TVS+MM  RC V DI NGT  MR  ++   P           YA FPG PKWP
Sbjct  101  TGTLDSKTVSKMMTSRCAVADITNGTTGMRSGKKRQHPAGSKSFHTVAHYAFFPGNPKWP  160

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
            D+K  LTY F   T      PV  AF  W     F F RT DY +AD+     +RDH DG
Sbjct  161  DSKSHLTYAFLPGTRADAINPVVRAFQTWAANTHFSFSRTQDYTNADITISFESRDHADG  220

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H+D++E W+     P    ++++ALHEIGH
Sbjct  221  NPFDGPDGTLAHAFAPTNGRFHYDADEQWS-VSVTPGAYHLETIALHEIGH  270



>gb|EYU34694.1| hypothetical protein MIMGU_mgv1a023515mg, partial [Erythranthe 
guttata]
Length=261

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA TVS+M  PRCGVPDII+               Y+ F G P+WP +K  LTY F
Sbjct  76   TGTLDATTVSKMTTPRCGVPDIID------------VSHYSFFQGNPRWPPSKTHLTYRF  123

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGYPFDGRGGEYA  121
               TP     PV  AF  W  +  F F R    SADL    +  DHGDG+PFDGRGG  A
Sbjct  124  LPNTPAPAVGPVSRAFQKWASSTHFTFSRAQ-NSADLVIGFHRGDHGDGFPFDGRGGTLA  182

Query  120  HSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            H+F P  G  H+D++E W+  GP  D  D+++VALHEIGH
Sbjct  183  HAFAPTNGRFHYDADERWS-VGPVQDAFDLETVALHEIGH  221



>ref|XP_004297959.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR----RHRREVAPQYAHFP---GKPKWPDNK  322
            TG LD  T+S MM P CGVPDIINGT  MR    +H+        H+    G  KWP +K
Sbjct  106  TGTLDEKTISMMMKPHCGVPDIINGTTSMRSAKIKHQHRAIHTTVHYTLPDGDYKWPPSK  165

Query  321  QVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDY-ASADLKFHLYARDHGDGYPF  145
              LT+GF   TP      +  AF  WQK+  FKF +++   +ADLK   + RDHGDG PF
Sbjct  166  YQLTFGFLPGTPSAATGSIVQAFAIWQKSTHFKFSQSNNPQNADLKISFHKRDHGDGDPF  225

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG+ AH+  P  G  H+D+EE W+  G  P  +D  SV LHEIGH
Sbjct  226  DGPGGQLAHAAYPTGGTLHYDAEETWSA-GAKPGAMDYGSVGLHEIGH  272



>ref|XP_011085796.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=314

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 95/173 (55%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LD +T+++++ PRCG PDI+NGTN M    ++                Y+ F G P+
Sbjct  103  TGTLDTETITKLVTPRCGNPDIVNGTNTMLPRSKKTQNSSSSPSSIHTVSHYSFFRGNPR  162

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            WP +K  LTYGF   TP     PV  AF  W  A  F F R  +    DL    + RDHG
Sbjct  163  WPPSKTHLTYGFSANTPTNAIDPVVRAFEKWDSATHFTFSRAQNNQRPDLVIGFHRRDHG  222

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PFDG GG  AH+F P  G  H+DSEE W+   P  +   +++VALHEIGH
Sbjct  223  DGAPFDGPGGTIAHAFAPTDGRFHYDSEETWS-IAPNANAFHLETVALHEIGH  274



>ref|XP_010037507.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49217.1| hypothetical protein EUGRSUZ_K02797 [Eucalyptus grandis]
Length=311

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 98/170 (58%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR---------EVAPQYAHFPGKPKWPD  328
            TG LD+ TV+ M MPRCG  DI+NGT+ MR  +R              +  F G PKWP 
Sbjct  103  TGNLDSQTVAMMTMPRCGAADIVNGTSRMRSGKRGTRHGSSNFHTVGHFTFFDGNPKWPS  162

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  LTY F   T      PV  AF  W  A +F F ++ +Y SAD+K     RDHGDG 
Sbjct  163  SKYHLTYAFYPETRDDVVGPVSRAFNTWASATQFTFSQSQNYESADIKIAFARRDHGDGA  222

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F+P  G+ H+D++E W+  GP     ++++VALHEIGH
Sbjct  223  PFDGPNGVIAHAFQPTVGMFHYDADEPWSA-GPVSGSYNMETVALHEIGH  271



>ref|XP_008355534.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 98/179 (55%), Gaps = 20/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR------------------HRREVAPQYAH  355
            TG LD +TVS+MMMPRCGV DIINGT+ MR                           Y+ 
Sbjct  91   TGTLDGETVSKMMMPRCGVADIINGTSSMRSGKKKHHHHDPDHDHHNHGSSVHAVSHYSF  150

Query  354  FPGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHL  178
            F G+ +WP +K  LTYGF   TP +   PV  AF  W     F+F R+ +Y  AD+K   
Sbjct  151  FKGRLRWPTSKHHLTYGFLPNTPTEAMGPVSYAFRTWASNTHFRFSRSRNYRRADIKISF  210

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
               DHGDG PFDG GG  AH++ P  G  H+D++E W+  G      D+++VALHEIGH
Sbjct  211  EYGDHGDGSPFDGEGGVLAHAYAPTNGRFHYDADEPWS-VGALEGYYDLETVALHEIGH  268



>gb|EYU38312.1| hypothetical protein MIMGU_mgv11b017434mg [Erythranthe guttata]
Length=251

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 97/172 (56%), Gaps = 13/172 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-----------REVAPQYAHFPGKPKW  334
            TG+LDA TVS+M  PRCG  DI+NG N M+ ++             V+      P   +W
Sbjct  37   TGILDATTVSKMTTPRCGYADIVNGINTMQLNKGKKYLNSNNDIHTVSHYRFTVPRNRRW  96

Query  333  PDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGD  157
            P +K  LTY F   TP     PV  AF  W     F F R  D +S DL    + R HGD
Sbjct  97   PRSKANLTYRFLPNTPEIAVGPVSRAFQKWHSISGFSFSRVQDSSSTDLVIGFFKRSHGD  156

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G PFDG GG  AH+FRP  G  H+D++E W++ GP PD +D++S+A+HEIGH
Sbjct  157  GAPFDGPGGVTAHAFRPTDGRLHYDADEKWSD-GPAPDAMDLESIAVHEIGH  207



>ref|XP_007010415.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19225.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 96/171 (56%), Gaps = 13/171 (8%)
 Frame = -1

Query  477  GVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-----------VAPQYAHFPGKPKWP  331
            G LD +TVS+MMMPRCGV DIINGT+ MR  +++               YA FP  P+WP
Sbjct  102  GALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRWP  161

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
             +K  LTY F   T      PV  AF  W     F+F R D Y  AD+      RDHGDG
Sbjct  162  PSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGDG  221

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG GG  AH+F P  G  H+D++E W+     P  + +++VALHEIGH
Sbjct  222  NPFDGPGGTLAHAFAPTIGRFHYDADETWS-VSARPGTMHLETVALHEIGH  271



>ref|XP_007010413.1| Matrixin family protein [Theobroma cacao]
 ref|XP_007099564.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19223.1| Matrixin family protein [Theobroma cacao]
 gb|EOY20464.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   140 bits (352),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 96/171 (56%), Gaps = 13/171 (8%)
 Frame = -1

Query  477  GVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-----------VAPQYAHFPGKPKWP  331
            G LD +TVS+MMMPRCGV DIINGT+ MR  +++               YA FP  P+WP
Sbjct  102  GALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRWP  161

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
             +K  LTY F   T      PV  AF  W     F+F R D Y  AD+      RDHGDG
Sbjct  162  PSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGDG  221

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG GG  AH+F P  G  H+D++E W+     P  + +++VALHEIGH
Sbjct  222  NPFDGPGGTLAHAFAPTLGRFHYDADETWS-VSARPGTMHLETVALHEIGH  271



>ref|XP_010037506.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49212.1| hypothetical protein EUGRSUZ_K02792 [Eucalyptus grandis]
Length=311

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 95/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV---------APQYAHFPGKPKWPD  328
            TG LD+ TV+ M  PRCGV DI+NGT+ MR  +R              +  F G PKWP 
Sbjct  103  TGNLDSQTVAMMTTPRCGVADIVNGTSRMRSGKRTTHHGSNKFHTVGHFTFFDGSPKWPS  162

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  LTY     T      PV  AF  W  A  F F ++ +Y SAD+K     RDHGDG 
Sbjct  163  SKYHLTYALDPGTQDDVLGPVSRAFKTWASATHFTFSQSQNYESADIKIAFARRDHGDGA  222

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F+P  G+ H+D +E W+  GP     D+++VALHEIGH
Sbjct  223  PFDGPSGVIAHAFQPTIGVFHYDGDEPWS-VGPVRGSYDLETVALHEIGH  271



>emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera]
Length=305

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD++TVSQM+ PRCG  DIINGTN MR  ++     +      P+WP +K  LTY F
Sbjct  107  TGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLR-SPRWPPSKTYLTYAF  165

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGGEY  124
               TP     PV  A   W  A  F F    D+ SAD+    +  DHGDG PFDG GG  
Sbjct  166  LPGTPSWAMSPVSRAXXQWDSATHFTFGXIQDHTSADMTISFHRLDHGDGXPFDGPGGTI  225

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D +E W+  G  P+ +D+++VA+HEIGH
Sbjct  226  AHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVAVHEIGH  265



>ref|XP_008458714.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=319

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 98/173 (57%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR--RHRREV----------APQYAHFPGKPK  337
            TG LDA T++QM+ PRCGV DII+G   MR  + R+++             +A F G PK
Sbjct  106  TGTLDAMTIAQMLKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHRVSHFAFFDGNPK  165

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            WP  K  LTYGF   TP +   PV  AF  W     F F +  D  ++D+     + DHG
Sbjct  166  WPATKSHLTYGFLPGTPPETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFESGDHG  225

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DGYPFDG GG  AH+F P  G  H D++E+WA  G      D+++VALHEIGH
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSGSFDLETVALHEIGH  277



>ref|XP_008230960.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 96/170 (56%), Gaps = 12/170 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LDA+TVS MMMPRCGV DIINGT+ MR  ++               Y  F G PKWP
Sbjct  106  TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGY  151
             +K  LTY F   TP +   PV  AF  W     F F +++  + DL    +  +HGDG 
Sbjct  166  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  224

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P  G  H+D++E ++  G      D+++VALHEIGH
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGH  273



>ref|XP_010278837.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=319

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 98/176 (56%), Gaps = 17/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-----------VAPQYAHFPGKPKW  334
            TG LD+ TV QMMMPRCG+PDIINGT  MR  ++                Y  FP  P+W
Sbjct  102  TGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHGPSSLHTVSHYTFFPNNPRW  161

Query  333  PDNKQVLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYAR  169
            P +K  LTY F +        +       AF  WQ+   F F+   + A++D+    +  
Sbjct  162  PPSKTHLTYRFRSSVSVVGLQQLRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFHRG  221

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DHGDGY FDGRGG  AH+F P  G  H+D++E+W+   P P   D++SVA+HEIGH
Sbjct  222  DHGDGYSFDGRGGTLAHAFAPTVGRFHYDADESWST-NPQPGMFDLESVAVHEIGH  276



>ref|XP_002280805.2| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=335

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 100/171 (58%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWP-  331
            TG LD++TVS+MM  RCGV DI+NGT+ M+  ++              Y  FPG P+WP 
Sbjct  126  TGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPGSPRWPT  185

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             N   LTY F   TP +  IPV  AF  W  A  F F +T D+ +A+L    ++  HGD 
Sbjct  186  SNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHSLLHGDW  245

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG GG  AH++ P  G  H+D++E W+  G  P  LD+++VALHEIGH
Sbjct  246  NPFDGPGGTIAHAYAPTDGRFHYDADEEWS-VGAVPGALDVETVALHEIGH  295



>ref|XP_008230675.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=305

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 96/170 (56%), Gaps = 12/170 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LDA+TVS MMMPRCGV DIINGT+ MR  ++               Y  F G PKWP
Sbjct  98   TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  157

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGY  151
             +K  LTY F   TP +   PV  AF  W     F F +++  + DL    +  +HGDG 
Sbjct  158  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  216

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P  G  H+D++E ++  G      D+++VALHEIGH
Sbjct  217  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGH  265



>ref|XP_010273763.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=348

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 99/176 (56%), Gaps = 17/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR----RHRREVAPQYAH-------FPGKPKW  334
            TG LD+ TV QMMMPRCG+PDIINGT  MR     H    AP   H       FP  P+W
Sbjct  131  TGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHAPSSLHTVSHYTFFPNNPRW  190

Query  333  PDNKQVLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYAR  169
            P +K  LTY F +        +       AF  WQ+   F F+   + A++D+    +  
Sbjct  191  PPSKTHLTYRFRSSASVVGLQELRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFHRG  250

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DHGDGY FDGRGG  AH+F P  G  H+D++E+W+   P P   D++SVA+HEIGH
Sbjct  251  DHGDGYSFDGRGGTLAHAFAPTIGRFHYDADESWST-NPQPGVFDLESVAVHEIGH  305



>gb|EPS59674.1| hypothetical protein M569_15132, partial [Genlisea aurea]
Length=260

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 94/160 (59%), Gaps = 6/160 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA T S M + RCGVPDI+NGTNLM   R    P ++ FP + +WP  K  L+Y +
Sbjct  68   TGELDAATASVMSLQRCGVPDIVNGTNLMISWR----PYFSFFPDRQRWPPKKTHLSYLY  123

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGYPFDGRGGEYA  121
                P ++   +  AF  W    RF F R +  S+D+    ++ DHGDG PFDG GG  A
Sbjct  124  LTNVPPEYIPAIDRAFESWASVTRFTFHRVE-DSSDITVGYFSGDHGDGVPFDGPGGVLA  182

Query  120  HSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            HSF P  G  HFD+ E W + G  PD  D+ S+A+HEIGH
Sbjct  183  HSFAPTDGRMHFDAAEPWFD-GVKPDRFDVHSIAMHEIGH  221



>ref|XP_004509890.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=377

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 96/181 (53%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAH-------------FPGKP  340
            TG LD +T+ Q+++PRCGV DIINGT  M   + +    Y H             FPG+P
Sbjct  110  TGELDDNTLRQIVLPRCGVADIINGTTAMNAGKEKETTSYGHSKPKFHTLSHFTVFPGQP  169

Query  339  KWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP+ KQ LTY F  GN            AF  W +     F  T+ Y+SAD+K   +  
Sbjct  170  RWPEGKQELTYAFFPGNDLSKTVKSVFATAFARWSEVTTLTFTETESYSSADMKIGFFEG  229

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIG  4
            DHGDG PFDG  G  AH+F P  G  H D+ E+W   G       P  +D++SVA+HEIG
Sbjct  230  DHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDISKSSLPTAVDLESVAVHEIG  289

Query  3    H  1
            H
Sbjct  290  H  290



>ref|XP_008443669.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=313

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 94/174 (54%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTN--LMRRHRRE-----------VAPQYAHFPGKP  340
            TG L+A+T+SQ+  PRCG PDIIN +   ++  H                  YA FPG+ 
Sbjct  100  TGSLNAETISQLATPRCGNPDIINESTGRMLSEHNNNDSSHDHHHLPHAVSHYAFFPGRR  159

Query  339  KWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDH  163
            +WP  K  LTY F   T      PV  AF  W +   FKF   T+Y  ADLK   Y  +H
Sbjct  160  RWPSTKYRLTYAFLPGTRADAKAPVTRAFATWARNTHFKFSLITNYRRADLKIGFYRGNH  219

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDGYPFDG GG  AH+F P  G  H+DS E WA  G      D+Q+VALHEIGH
Sbjct  220  GDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVKGRYDLQTVALHEIGH  272



>ref|XP_008222422.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=319

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 97/174 (56%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREV---------APQYAHFPGKP  340
            TG+LD  TVS+MMMPRCGV DIING   M    ++HR               Y+ F GK 
Sbjct  106  TGILDTKTVSKMMMPRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKGKL  165

Query  339  KWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDH  163
            KWP +K  LTY F   TP +   P+  AF  W     F+F R+ +Y  AD+K      DH
Sbjct  166  KWPRSKHHLTYAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYGDH  225

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDG  FDG GG  AH++ P  G  H+D+EE W+  G      D+++VALHEIGH
Sbjct  226  GDGNSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGYYDLETVALHEIGH  278



>ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis]
 gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis]
Length=321

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 97/179 (54%), Gaps = 20/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------------APQYAH  355
            +G+LD++T S+MMMPRCGV DIINGT  M   R+                       Y+ 
Sbjct  103  SGLLDSETASKMMMPRCGVADIINGTTWMESGRKHHRHPHRHHHRRHGPKSLHKVSHYSF  162

Query  354  FPGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHL  178
            F G PKWP +K  LTY F    P     PV  AF  W     F F  T DY ++D+    
Sbjct  163  FSGNPKWPPSKYHLTYSFLPGFPTAAVNPVANAFETWAANTHFSFSWTRDYINSDILISF  222

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            Y  DHGDG+PFDG GG  AH+F P+ G+ H+D++E W+  G      D+++ ALHEIGH
Sbjct  223  YRGDHGDGHPFDGPGGTLAHAFAPQNGLFHYDADERWS-IGAVLGAYDLETTALHEIGH  280



>ref|XP_008230963.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 91/170 (54%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR---------EVAPQYAHFPGKPKWPD  328
            TG LDA TVS MMMPRCGV DIINGT+ MR  ++              Y+ F G P WP 
Sbjct  104  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGQKRHPHHHHRGHTVANYSFFQGNPTWPA  163

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  LTY F   TP +   PV  AF  W     F F    +  + DL       DHGDG 
Sbjct  164  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGT  223

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P  G  H+D++E ++  G      D +++ALHEIGH
Sbjct  224  PFDGPGGTIAHAFAPTNGRLHYDADERFS-VGAVSGAYDFETIALHEIGH  272



>ref|XP_006448955.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
 gb|ESR62195.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
Length=241

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 92/163 (56%), Gaps = 4/163 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG +D  TVS M  PRCGVPD+IN T  M+         Y  +PG+PKWP  KQ+++Y F
Sbjct  58   TGHMDLKTVSMMGKPRCGVPDVINRTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISYAF  117

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPFDGRG--G  130
               T      PV  AF+ W K   F ++   DY +AD+K      DHGDGYPF G G   
Sbjct  118  LPGTRTDVQEPVRQAFLTWSKYTPFSYEFVQDYDAADIKISFQRGDHGDGYPFGGPGPYN  177

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              AHSF P  G  H+D +ENW      P  +D+Q+VALHE+GH
Sbjct  178  LLAHSFSPTDGRAHYDGDENWTVVA-VPGAVDMQTVALHELGH  219



>ref|XP_010091950.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB47730.1| Metalloendoproteinase 1 [Morus notabilis]
Length=370

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 92/186 (49%), Gaps = 27/186 (15%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR-------------HRR------------E  376
            TG LD+ T+S+MMMPRC V DIIN    MR              HR+            +
Sbjct  144  TGTLDSQTLSKMMMPRCAVADIINNDTRMRSKKKSTTSSTKNHVHRKLLGQKYVSTDDLQ  203

Query  375  VAPQYAHFPGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YAS  199
                Y+ F GKPKWP +K  LTY F      +    VG AF  W     F F R      
Sbjct  204  TVSHYSFFSGKPKWPSSKYSLTYSFAEGMLSEDVEAVGRAFQTWASNTHFSFSRAQGNTK  263

Query  198  ADLKFHLYARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVA  19
            AD++      DHGDG  FDG GG  AH+F P  G  HFD++E WA  G   D  D+++VA
Sbjct  264  ADIRVSFERGDHGDGDAFDGAGGVLAHAFSPTDGRLHFDADETWA-IGEVADAFDVETVA  322

Query  18   LHEIGH  1
            LHEIGH
Sbjct  323  LHEIGH  328



>ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66657.1| hypothetical protein Csa_1G654860 [Cucumis sativus]
Length=314

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 94/174 (54%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGT----------NLMRR---HRREVAPQYAHFPGKP  340
            TG L+A+T+SQ+  PRCG PDIIN T          N+      H       YA FPG+ 
Sbjct  101  TGSLNAETLSQLATPRCGNPDIINETTGRMLSEDIDNVSSHDHHHLPHAVSHYAFFPGRL  160

Query  339  KWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDH  163
            +WP  K  LTY F   T      PV  AF  W +   FKF   T+Y  ADLK   Y  +H
Sbjct  161  RWPSTKYRLTYAFLPGTRADAKAPVARAFATWARNTHFKFTLVTNYRRADLKIGFYRGNH  220

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDGYPFDG GG  AH+F P  G  H+DS E WA  G      D+Q+VALHEIGH
Sbjct  221  GDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVRGRYDLQTVALHEIGH  273



>emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera]
Length=437

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 100/171 (58%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWP-  331
            TG LD++TVS+MM  RCGV DI+NGT+ M+  ++              Y  FPG P+WP 
Sbjct  112  TGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPGSPRWPT  171

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             N   LTY F   TP +  IPV  AF  W  A  F F +T D+ +A+L    ++  HGD 
Sbjct  172  SNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHSLLHGDW  231

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG GG  AH++ P  G  H+D++E W+  G  P  LD+++VALHEIGH
Sbjct  232  NPFDGPGGTIAHAYAPTDGRFHYDADEEWS-VGAVPGXLDVETVALHEIGH  281



>ref|XP_004139163.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66654.1| hypothetical protein Csa_1G654840 [Cucumis sativus]
Length=315

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 95/175 (54%), Gaps = 16/175 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN---GTNLMRRHRRE-----------VAPQYAHFPGK  343
            TG L+A+T+SQ+  PRCG PDI+N   G  L+  +  +             P Y+ FPG+
Sbjct  99   TGSLNAETLSQLATPRCGNPDILNEATGRMLLENNNNDSSHDHYHQLSHAVPHYSFFPGR  158

Query  342  PKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARD  166
            P+WP  K  LTY F   T      PV  AF  W +   FKF   T+   ADLK   Y  +
Sbjct  159  PRWPPTKYHLTYEFLPNTHADAKAPVTRAFATWARHTHFKFSLATNSRRADLKIGFYRGN  218

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            HGDGYPFDG GG  AH+F P  G  HFDS E W   G      D+++VALHEIGH
Sbjct  219  HGDGYPFDGSGGTLAHAFTPTDGRVHFDSTEKWV-VGAVRGRFDLETVALHEIGH  272



>ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52414.1| hypothetical protein Csa_5G632130 [Cucumis sativus]
Length=316

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 92/173 (53%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG ++A T+  M  PRCG  DI++G   M+  ++ V               YA F G PK
Sbjct  104  TGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNPK  163

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            WP +K  LTYGF   TP K    +G AF  W     F F +T  Y  AD+K      DHG
Sbjct  164  WPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDHG  223

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG+ FDG  G  AH F P+ G  HFD+ E+WA  G   D  D++++ALHEIGH
Sbjct  224  DGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGH  275



>ref|XP_003628627.1| Matrix metalloproteinase-9 [Medicago truncatula]
 gb|AET03103.1| matrix metalloproteinase [Medicago truncatula]
Length=373

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 94/181 (52%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-------------RHRREVAPQYAHFPGKP  340
            TG LD  T+ Q+M+PRCGV DIINGT  M              + R      +  FPG+P
Sbjct  106  TGELDDMTLRQVMLPRCGVADIINGTTTMNAGKDTETTSNSDSKLRFHTVSHFTVFPGQP  165

Query  339  KWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP+ KQ LTY F  GN            AF  W +    KF  T  Y+ AD+K   +  
Sbjct  166  RWPEGKQELTYAFFPGNELTETVKSVFATAFARWSEVTTLKFTETTLYSGADIKIGFFNG  225

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIG  4
            DHGDG PFDG  G  AH+F P+ G  H D+ E+W   G       P  +D++SVA+HEIG
Sbjct  226  DHGDGEPFDGSLGTLAHAFSPRNGRFHLDAAEDWVVSGDVSKSSLPTAVDLESVAVHEIG  285

Query  3    H  1
            H
Sbjct  286  H  286



>ref|XP_007226174.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
 gb|EMJ27373.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
Length=321

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 96/174 (55%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREV---------APQYAHFPGKP  340
            TG LDA TVS+MMM RCGV DIING   M    ++HR               Y+ F GK 
Sbjct  108  TGTLDAKTVSKMMMSRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKGKL  167

Query  339  KWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDH  163
            KWP +K  LT+ F   TP +   P+  AF  W     F+F R+ +Y  AD+K      DH
Sbjct  168  KWPRSKHHLTFAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYGDH  227

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDG  FDG GG  AH++ P  G  H+D+EE W+  G      D+++VALHEIGH
Sbjct  228  GDGSSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGYYDLETVALHEIGH  280



>ref|XP_011073059.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 91/165 (55%), Gaps = 10/165 (6%)
 Frame = -1

Query  477  GVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-----EVAPQYAHFPGKPKWPDNKQVL  313
            G++DA+T++QM  PRCGVPD  N   L R H        +A  Y  FPG+PKWP  K+ L
Sbjct  111  GIMDANTITQMSPPRCGVPDSFN---LNRSHELYLRIPTLASHYIFFPGEPKWPPTKRSL  167

Query  312  TYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGR  136
            TY F +  P      +  A   W     F F  T DY  AD+K     RDHGDG PFDG 
Sbjct  168  TYSFPSGAPTDVTNSILHATQIWASVSPFTFSYTPDYDQADIKISFQNRDHGDGNPFDGP  227

Query  135  GGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GG  AH++ P  G  HFD +E W + G  P   D+Q+V LHE+GH
Sbjct  228  GGILAHAYAPSDGRLHFDGDERWVD-GVTPGAFDLQTVGLHELGH  271



>ref|XP_011072962.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 92/165 (56%), Gaps = 10/165 (6%)
 Frame = -1

Query  477  GVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-----EVAPQYAHFPGKPKWPDNKQVL  313
            G++DA+ V++M  PRCGVPD  N   L R H+       +A  Y  FPG+PKWP  K+ L
Sbjct  111  GIMDANIVAKMSHPRCGVPDSFN---LNRSHKLYLRIPTLASHYTFFPGEPKWPPTKRSL  167

Query  312  TYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPFDGR  136
            TY F    P      +  A   W     F+F  RT+Y  AD+K     RDHGDGYPFDG 
Sbjct  168  TYSFPLGGPTNVNSSILHATQIWASVTPFRFSYRTNYDQADIKISFQYRDHGDGYPFDGP  227

Query  135  GGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GG  AH+F P  G  HFD +E W + G      D+Q+V LHE+GH
Sbjct  228  GGILAHAFAPSDGRLHFDGDERWVD-GVTLGAFDMQTVGLHELGH  271



>ref|XP_007216923.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
 gb|EMJ18122.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
Length=264

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 85/161 (53%), Gaps = 8/161 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TVS+MMMPRCG             H       YA F G  KWP NK  LTYGF
Sbjct  71   TGTLDTKTVSKMMMPRCGKK------RHPHHHGGHTVAHYAFFQGSAKWPANKYHLTYGF  124

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGDGYPFDGRGGEY  124
               TP      V  AF  W     F F R     SADLK    + +HGDG PFDG GG  
Sbjct  125  AQGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGQPFDGPGGVL  184

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH++ P  G  H+D++E W   G  P G+D+++VALHEIGH
Sbjct  185  AHAYAPTNGRFHYDADETWV-VGAVPGGMDLETVALHEIGH  224



>ref|XP_008798076.1| PREDICTED: metalloendoproteinase 1-like, partial [Phoenix dactylifera]
Length=410

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 93/171 (54%), Gaps = 11/171 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TV+Q+++PRCGV DI+NGT+ MR  +      YA+FPG P WP  K+ LTY  
Sbjct  102  TGSLDDSTVNQLIIPRCGVADIVNGTSSMRSAKLPGRNLYAYFPGNPTWPSWKRDLTYAL  161

Query  300  GNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGYPFDG  139
             + +               AF  W  A    F  TD AS AD+K   Y+ DHGDG PFDG
Sbjct  162  VSTSAVSIDTSAISTVFARAFGRWSAATTLTFTETDSASDADIKIGFYSGDHGDGEPFDG  221

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPD-----GLDIQSVALHEIGH  1
              G  AH+F P  G  H D+ E W   G   +      +D++SVA+HEIGH
Sbjct  222  VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTEASSSVAVDLESVAVHEIGH  272



>gb|EYU29748.1| hypothetical protein MIMGU_mgv1a025409mg, partial [Erythranthe 
guttata]
Length=262

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 86/161 (53%), Gaps = 14/161 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+LDA TVS M++PRCGVPDIIN               Y  F G PKWP +K  LTYGF
Sbjct  74   TGILDASTVSTMIIPRCGVPDIIN------------VSHYTFFSGNPKWPPSKYNLTYGF  121

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASA-DLKFHLYARDHGDGYPFDGRGGEY  124
             +  P     P   AF +W  A  F F R       DL       +HGDG  FDG GG  
Sbjct  122  LSNVPANAVAPAERAFQNWDNATHFTFKRASSGQTPDLTIGFLRGNHGDGASFDGPGGTL  181

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D++E W+   P  +   +++VALHEIGH
Sbjct  182  AHAFAPTNGRLHYDADERWS-VDPVANTFHLETVALHEIGH  221



>ref|XP_007216839.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
 gb|EMJ18038.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
Length=296

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 85/161 (53%), Gaps = 14/161 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA TVS MMMPRCGV DIIN               Y+ F G PKWP +K  LTY F
Sbjct  108  TGTLDAKTVSNMMMPRCGVADIIN------------VAHYSFFQGNPKWPASKYHLTYAF  155

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDY-ASADLKFHLYARDHGDGYPFDGRGGEY  124
               TP +   PV  AF  W     F F       + DL    +  +HGDG PFDG GG  
Sbjct  156  LQGTPAEAMGPVSSAFQTWAANKHFTFSEVQSNQNPDLTVSFHRGNHGDGAPFDGPGGTI  215

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D+ E WA  G      D+QSVALHEIGH
Sbjct  216  AHAFAPTNGRFHYDAAEAWA-VGAVTGAFDLQSVALHEIGH  255



>ref|XP_011085865.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=283

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 99/173 (57%), Gaps = 16/173 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM--RRHRRE----------VAPQYAHFPGKPK  337
            TG +DA+T+++M++PRCG  DI++GTN M  R +++E             QY+ FPG  +
Sbjct  74   TGAVDAETIAKMVIPRCGNRDIVHGTNTMLPRPNKKENSNSSTNSIHTVSQYSFFPGNLR  133

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            W  +K  LTYGF   TP     PV  AF  W  A  F F R  +    DL    + RDHG
Sbjct  134  W--SKTHLTYGFSPNTPTATIDPVIRAFAKWDSATHFTFSRAQNNQRPDLIIGFHRRDHG  191

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG PFDG GG  AH+F P  G  H+DS+E W+   P  +   +++VALHEIGH
Sbjct  192  DGSPFDGPGGTIAHAFAPSDGRFHYDSDEAWS-MSPVGNAFHLETVALHEIGH  243



>ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=457

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 92/173 (53%), Gaps = 14/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG ++A T+  M  PRCG  DI++G   M+  ++ V               YA F G PK
Sbjct  245  TGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNPK  304

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            WP +K  LTYGF   TP K    +G AF  W     F F +T  Y  AD+K      DHG
Sbjct  305  WPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDHG  364

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG+ FDG  G  AH F P+ G  HFD+ E+WA  G   D  D++++ALHEIGH
Sbjct  365  DGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGH  416


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 2/102 (2%)
 Frame = -1

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG  FDG GG 
Sbjct  2    FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGV  61

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G   +  ++ +VALHE+GH
Sbjct  62   VGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGH  102



>ref|XP_010913461.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=366

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 91/171 (53%), Gaps = 11/171 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TVSQ+++PRCGV DIINGT+ MR  +      YA+FPG P WP  K+ LTY  
Sbjct  107  TGSLDDSTVSQLIIPRCGVADIINGTSSMRSAKLPGRNLYAYFPGSPTWPSWKRDLTYAL  166

Query  300  GNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGYPFDG  139
             + +               AF  W  A    F  +D  S AD++   Y+ DHGDG PFDG
Sbjct  167  VSTSAVSIDTSALRTVFARAFGRWAAATTLTFTESDSVSDADIQIGFYSGDHGDGEPFDG  226

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPD-----GLDIQSVALHEIGH  1
              G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  227  VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTQASSNVAVDLESVAVHEIGH  277



>ref|XP_011071055.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=374

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 97/174 (56%), Gaps = 14/174 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR------RHRREVAPQYAHFPGKPKWPDNKQ  319
            TG +DA+T+ ++++PRCG PDI+NGT+ M                Y+ FP +P+WP +K 
Sbjct  107  TGQIDAETIKRIVVPRCGNPDIVNGTSAMHPGKPSANSTIHTVAHYSFFPNRPRWPPSKS  166

Query  318  VLTYGFGNPTPFKFFIPVGL--AFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYP  148
             LTY F         +      AF  W +     F + + +  AD++   ++R+HGDG P
Sbjct  167  QLTYAFLPENQLSDVVKTVFSRAFERWSEVTTLTFTEISSFNRADIRIGFFSREHGDGEP  226

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWA---EF--GPPPDGLDIQSVALHEIGH  1
            FDG  G  AH+F P  G CHFD EENW    +F  G P   +D++SVA+HEIGH
Sbjct  227  FDGVLGTLAHAFSPPTGRCHFDGEENWVIDGDFLNGAPLSAVDLESVAVHEIGH  280



>ref|XP_002533939.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28446.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=226

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 99/171 (58%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDII--NGTNLMRRHRREVA----PQYAHFPGKPKWPDNKQ  319
            TG+LD  TVSQMM PRCG+PD++  NGT     +R+ ++      Y  F G+P+WP  + 
Sbjct  15   TGILDNYTVSQMMKPRCGMPDVVTNNGTKHQSHNRKLMSIHSLVHYKFFHGEPRWPAERT  74

Query  318  VLTYGFGNPTPFKFFIPVG----LAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             L Y F + T       +G     AF  W +   F F+     A A+++   + R HGDG
Sbjct  75   HLRYRFRSSTQVPGTQNIGSICARAFQKWAEVTHFTFEEVASNAQAEIEIGFHRRSHGDG  134

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            +PFDGR G  AH+  P  G+ HFD +ENW+E  P  + +D++SVA+HEIGH
Sbjct  135  HPFDGRSGTLAHATAPTGGMFHFDGDENWSE-NPEANEVDLESVAVHEIGH  184



>ref|XP_003530663.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=370

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAH-----------FPGKPKW  334
            TGVLD  TV Q+++PRCGV DIINGT  M   +      ++            FPG P+W
Sbjct  108  TGVLDDATVQQIVLPRCGVADIINGTTTMNAAKENETASFSKPKFHTVAHFTLFPGMPRW  167

Query  333  PDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDH  163
            P+  Q LTY F  GN            AF  W +    KF  T  Y  AD++   ++ DH
Sbjct  168  PEGTQELTYAFFPGNGLSDAVKGVFAAAFARWAEVTSLKFRETASYFGADIRIGFFSGDH  227

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            GDG PFDG  G  AH+F P  G  H D+ E+W   G       P  +D++SVA+HEIGH
Sbjct  228  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTRSALPTAVDLESVAVHEIGH  286



>ref|XP_010255269.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=316

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 94/176 (53%), Gaps = 17/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR----RHRRE--------VAPQYAHFPGKPK  337
            TG LD +TV QMM+PRCG PDIING   MR    ++RR          +  YA F    K
Sbjct  100  TGSLDFETVKQMMLPRCGFPDIINGETWMRSGKEKNRRLGGRKTAVGFSSHYAFFNNSLK  159

Query  336  WPDNKQVLTYGFGNPTPFKFFIPVGLAFV---HWQKAVRFKFDRT-DYASADLKFHLYAR  169
            WP +K  L Y      PF   +   L +V    W     F F+RT D +SAD+    +  
Sbjct  160  WPPSKMHLKYALDTNVPFDDVVMNPLCYVAFDKWAAISDFTFERTYDLSSADILISFFKG  219

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DHGDG+ FDG GG  AHSF P  G  H+D EENW   G      D++SVA+HEIGH
Sbjct  220  DHGDGHLFDGPGGVLAHSFAPTGGRLHYDLEENWVA-GIRAGSFDLESVAVHEIGH  274



>gb|ACJ24812.1| matrix metalloproteinase [Pinus taeda]
Length=364

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 98/171 (57%), Gaps = 16/171 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TGVLD  T+SQ+M+PRCG  DIING++ MR   R + P    FPG P+W  +K+VL+Y F
Sbjct  114  TGVLDEATISQLMVPRCGREDIINGSSAMRG--RGLFP---FFPGSPRWGPDKRVLSYAF  168

Query  300  G-------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPF  145
                      +  +    VG AF  W   +   F + +DY+SAD+K   Y+ DHGDG+PF
Sbjct  169  SPDHEVLSEISLAELSTVVGRAFKRWADVIPITFTESSDYSSADIKVGFYSGDHGDGHPF  228

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            DG  G  AHSF P  G  H D+ E+W            +D++S+A HEIGH
Sbjct  229  DGPLGTLAHSFSPPDGRFHLDAAESWTVDLSSDSAATAIDLESIATHEIGH  279



>gb|EYU18042.1| hypothetical protein MIMGU_mgv1a018853mg [Erythranthe guttata]
Length=287

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 88/161 (55%), Gaps = 14/161 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+LDA TVS M++PRCGVPDIIN               Y  F G PKWP +K  LTY F
Sbjct  99   TGILDAATVSTMIIPRCGVPDIIN------------VSHYTFFLGNPKWPASKYNLTYEF  146

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDY-ASADLKFHLYARDHGDGYPFDGRGGEY  124
             +  P     PV  AF +W  A  F F R+    +ADL        HGDG  FDG GG  
Sbjct  147  LSNVPSNAVAPVERAFQNWDNATHFTFRRSSSDQTADLIIEFQRGYHGDGASFDGPGGTL  206

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D++E W+   P  +   +++VALHEIGH
Sbjct  207  AHAFAPTNGRFHYDADERWS-VDPVANTFHLETVALHEIGH  246



>ref|XP_002275671.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=303

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 88/164 (54%), Gaps = 5/164 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG+LDA T +QM   RCGVPD   + N  N        +   YA FP KP+WP  K+ L 
Sbjct  101  TGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRHLL  160

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRG  133
            Y   + +  +    V  AF  W     F F+RT D   A+L      RDHGDG PFDGRG
Sbjct  161  YSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRPFDGRG  220

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+F P  G  HFD +E W   G   + +D+Q+VA HEIGH
Sbjct  221  GILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGH  263



>emb|CBI34987.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 88/164 (54%), Gaps = 5/164 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG+LDA T +QM   RCGVPD   + N  N        +   YA FP KP+WP  K+ L 
Sbjct  94   TGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRHLL  153

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRG  133
            Y   + +  +    V  AF  W     F F+RT D   A+L      RDHGDG PFDGRG
Sbjct  154  YSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRPFDGRG  213

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+F P  G  HFD +E W   G   + +D+Q+VA HEIGH
Sbjct  214  GILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGH  256



>ref|XP_010272073.1| PREDICTED: metalloendoproteinase 1 [Nelumbo nucifera]
Length=371

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 86/174 (49%), Gaps = 14/174 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR-------HRREVAPQYAHFPGKPKWPDNK  322
            TGVLD  T+ Q++ PRCGV DIINGTN M         H       Y  FP +P WP ++
Sbjct  110  TGVLDNSTIQQLIRPRCGVADIINGTNTMSSGKSAASTHSLHTVGHYTFFPHQPTWPSSR  169

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
              LTYGF   N            AF  W       F  TD Y+ AD+K   Y  DH DG 
Sbjct  170  LDLTYGFLPDNQLSDTVKAVFAKAFARWAAVTPLTFTMTDSYSMADIKIAFYTGDHSDGE  229

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENW----AEFGPPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D  ENW    A        +D++SVA+HEIGH
Sbjct  230  PFDGVLGTLAHAFSPTDGRFHLDGAENWVVDDASKSSISSAVDLESVAVHEIGH  283



>ref|XP_006300509.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
 gb|EOA33407.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
Length=380

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 95/181 (52%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  106  TGELDALTIKHIVIPRCGNPDVVNGTSLMHNGRRKTFEVNFSRSHLHAVKRYTLFPGEPR  165

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARD  166
            WP N++ LTY F   NP   +       AF  W       F    D+ S+D+    Y  D
Sbjct  166  WPRNRRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTPSEDFTSSDITIGFYTGD  225

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  226  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  285

Query  3    H  1
            H
Sbjct  286  H  286



>ref|XP_002887284.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63543.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 97/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  104  TGELDAMTIKHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            WP N++ LTY F   NP   +       AF  W       F  +D ++++D+    Y  D
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSDSFSTSDITIGFYTGD  223

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  3    H  1
            H
Sbjct  284  H  284



>ref|XP_010512095.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=378

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            WP +++ LTY F   NP   +       AF  W       F R++ ++++D+    Y  D
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  3    H  1
            H
Sbjct  285  H  285



>ref|XP_006602365.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=368

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-----------VAPQYAHFPGKPKW  334
            TGVLD  T+ ++++PRCGV DIINGT  M   +                 ++ FPG P+W
Sbjct  101  TGVLDDATLQKIVLPRCGVADIINGTTTMNAGKENETASFSKPKFHTVAHFSLFPGMPRW  160

Query  333  PDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDH  163
            P+  Q LTY F  GN            AF  W +    KF +   Y  AD++   ++ DH
Sbjct  161  PEGTQELTYAFFPGNELSDTVKGVFATAFARWAEVTSLKFRESASYFGADIRIGFFSGDH  220

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            GDG PFDG  G  AH+F P  G  H D+ E+W   G       P  +D++SVA+HEIGH
Sbjct  221  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTLSALPTAVDLESVAVHEIGH  279



>ref|XP_009410261.1| PREDICTED: metalloendoproteinase 1 [Musa acuminata subsp. malaccensis]
Length=361

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 87/171 (51%), Gaps = 11/171 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TV Q+++PRCG+PDIINGT+ M          YA+FPG P WP +K  L Y  
Sbjct  100  TGELDDATVEQLIVPRCGMPDIINGTSTMNSSFVRGRNLYAYFPGTPTWPSDKTELKYAI  159

Query  300  GNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGYPFDG  139
               +     + V       AF  W  A    F  TD +S AD+    Y   HGDG PFDG
Sbjct  160  TATSAVSIDLSVLKTVFARAFGRWSAATTLTFTETDSSSDADITIGFYNGSHGDGEPFDG  219

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPD-----GLDIQSVALHEIGH  1
              G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  220  VLGTLAHAFSPTDGRFHLDAAETWVAEGDVTQADSDVAVDLESVAVHEIGH  270



>ref|XP_007153680.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
 gb|ESW25674.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
Length=376

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 93/179 (52%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-----------RHRREVAPQYAHFPGKPKW  334
            TGVLD  T+ Q+++PRCGV DIINGT  M            + R      +A FPG P+W
Sbjct  110  TGVLDDATLQQIVLPRCGVADIINGTTTMNAGKQNETASFSKPRFHTVAHFALFPGNPRW  169

Query  333  PDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDH  163
            P+  + LTY F  GN            AF  W +     F  T  Y +AD++   ++ DH
Sbjct  170  PEGTEELTYAFNPGNDLSNTVKGVFASAFARWAEVTSLTFRETASYFNADIRIGFFSGDH  229

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            GDG PFDG  G  AH+F P  G  H D++E+W   G          +D++SVA+HEIGH
Sbjct  230  GDGEPFDGSLGTLAHAFSPTNGRFHLDADEDWVVSGDVTQSALSSAVDLESVAVHEIGH  288



>ref|XP_006856883.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
 gb|ERN18350.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
Length=357

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 91/168 (54%), Gaps = 9/168 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-REVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG LD+ TV QMM PRCGVPD++NGT  M R R      +Y  FPG P+WP  K+ LTY 
Sbjct  98   TGSLDSGTVRQMMSPRCGVPDVVNGTTTMMRSRGLSSVMRYTFFPGNPRWPVWKRNLTYA  157

Query  303  F-------GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGYPF  145
                     + T  +       A       + F  + T Y++AD++   +  DHGDG PF
Sbjct  158  IRPGTFSTSDDTAARAVFARAFARWAAATTLSFT-ESTSYSTADIRIAFFGGDHGDGEPF  216

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG  G  AH+F P  G  H D+ E W   G    G+D++SVA+HEIGH
Sbjct  217  DGALGTLAHAFSPPDGRLHLDAAELWVVSGNSRLGIDLESVAVHEIGH  264



>ref|XP_010415694.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  105  TGELDAFTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRSRLHAVKRYTLFPGEPR  164

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            WP +++ LTY F   NP   +       AF  W       F R++ ++++D+    Y  D
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  3    H  1
            H
Sbjct  285  H  285



>dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=378

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 97/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            WP N++ LTY F   NP   +       AF  W       F  ++ ++++D+    Y  D
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  3    H  1
            H
Sbjct  284  H  284



>ref|NP_177174.1| matrix metalloproteinase [Arabidopsis thaliana]
 gb|AAB61099.1| Similar to Glycine metalloendoproteinase (gb|U63725) [Arabidopsis 
thaliana]
 gb|AEE35027.1| matrix metalloproteinase [Arabidopsis thaliana]
Length=378

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 97/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            WP N++ LTY F   NP   +       AF  W       F  ++ ++++D+    Y  D
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  3    H  1
            H
Sbjct  284  H  284



>ref|XP_003517862.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 90/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVA--------PQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCGV DIINGT  M   +              Y+ F G+P+WP  
Sbjct  118  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKTNTTDSPTFHTVAHYSFFDGQPRWPVG  177

Query  324  KQVLTYGFGNPTPFKFFIPV--GLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             Q LTY F         I    G AF  W +     F  T  Y +AD++   Y  DHGDG
Sbjct  178  TQELTYAFDPDNALDDVIKTVFGNAFSRWSEVTTISFRETASYVAADIRIGFYGGDHGDG  237

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G+ H DS E+W   G        + +D++SVA+HEIGH
Sbjct  238  EPFDGVLGTLAHAFSPTNGMFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGH  293



>ref|XP_010264870.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=318

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 93/182 (51%), Gaps = 23/182 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGK--------------  343
            TG LD  TV QMM+PRCGVPDII G   MR  + +   +     G+              
Sbjct  96   TGSLDVATVKQMMLPRCGVPDIIKGETWMRSGKEKKEKRLLGVSGRKTTLGFSSHYTFFN  155

Query  342  ----PKWPDNKQVLTYGFGNPTPFKFFI--PVG-LAFVHWQKAVRFKFDRT-DYASADLK  187
                PKWP  K  L Y   +  P    +  P+  +AF  W     F F+ T D +SAD++
Sbjct  156  NTPTPKWPPYKMHLKYVLDSTVPVDDLLMHPLCYVAFARWAAVSNFTFEETQDLSSADIR  215

Query  186  FHLYARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEI  7
            F  +  DHGDG PFDG GG  AH++ P  G  HFDSEE W   G   D +D  SVA+HEI
Sbjct  216  FSFFKGDHGDGNPFDGPGGVLAHAYAPIDGRVHFDSEERWTT-GIRADWIDTASVAMHEI  274

Query  6    GH  1
            GH
Sbjct  275  GH  276



>ref|XP_006390919.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
 gb|ESQ28205.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
Length=383

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 98/186 (53%), Gaps = 26/186 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-----------------RRHRREVAPQYAHF  352
            TG LDA T+  +++PRCG PD++NGT+LM                 RR R     +Y  F
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSLMHGERRRKTFEVNFSPGGRRPRFHSVKRYTLF  163

Query  351  PGKPKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFH  181
            PG+P+WP +++ LTY F   NP   +       AF  W +     F + + +++AD+   
Sbjct  164  PGEPRWPSDRRDLTYAFDPRNPLTEEVKSVFSRAFGRWSEVTELNFTKIESFSTADITIG  223

Query  180  LYARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVA  19
             Y  DHGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA
Sbjct  224  FYTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVA  283

Query  18   LHEIGH  1
            +HEIGH
Sbjct  284  VHEIGH  289



>ref|XP_003519796.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 91/176 (52%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVA--------PQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCGV DIINGT  M   +              Y+ F G+P+WP+ 
Sbjct  117  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKSNTTDSPKFHSVAHYSFFDGQPRWPEG  176

Query  324  KQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
             Q LTY F   N          G AF  W +     F  T  YA+AD++   Y  DHGDG
Sbjct  177  TQELTYAFDPDNALDDVSKTVFGNAFSRWSEVTTISFRETSSYAAADIRIGFYGGDHGDG  236

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H DS E+W   G        + +D++SVA+HEIGH
Sbjct  237  EPFDGVLGTLAHAFSPTNGRFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGH  292



>gb|KDO82628.1| hypothetical protein CISIN_1g021444mg [Citrus sinensis]
Length=312

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 92/182 (51%), Gaps = 23/182 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--------------HRREVAPQYAHFPGK  343
            TG LD+ T+  ++ PRCG PDI+NGT  M                H   V   Y+ FPG 
Sbjct  48   TGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVG-HYSFFPGM  106

Query  342  PKWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYA  172
            P+WP NK+ LTY F   N    +       AF  W +A    F RTD Y +AD++   + 
Sbjct  107  PRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFT  166

Query  171  RDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENW-----AEFGPPPDGLDIQSVALHEI  7
             DHGDG PFDG  G  AH+F P  G  H D +ENW              +D++SVA+HEI
Sbjct  167  GDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEI  226

Query  6    GH  1
            GH
Sbjct  227  GH  228



>ref|XP_010039144.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=315

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 94/176 (53%), Gaps = 18/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-----RHRREV-----APQYAHFPGKPKWP  331
            TG LD  T S+MM PRCGV DIINGT  M      R+ R +        YA   G P+WP
Sbjct  102  TGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEGSPRWP  161

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             +   LTYGF   TP     PV  AF  W    RF F    D+  A+++      DHGDG
Sbjct  162  ASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDG  221

Query  153  Y--PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG---LDIQSVALHEIGH  1
                FDG GG  AH+F P  G+ H+D++E WA    PP G    ++++VALHEIGH
Sbjct  222  AHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEIGH  275



>ref|XP_004965108.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=368

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 90/175 (51%), Gaps = 18/175 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREVAPQYAHFPGKPKWPDNKQVL  313
            TGV+DA TV+QMM PRCGV D+INGT+ M      H R +   Y++FPG P WP +K+ L
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNL---YSYFPGSPSWPRSKKRL  164

Query  312  TYGFGNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGDGY  151
            TY   +                 AF  W  A    F  T  A  AD+    +A DHGDG 
Sbjct  165  TYAITDTAATTIDRATLSRVFARAFARWSAATTLNFTETASARDADITIGFHAGDHGDGE  224

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  225  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVAAGDVSRASSDVAVDLESVAVHEIGH  279



>emb|CDY11609.1| BnaC06g31300D [Brassica napus]
Length=373

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 94/177 (53%), Gaps = 17/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV--------APQYAHFPGKPKWPDN  325
            TG LDA T+  +++PRCG PD++NGT+LM   RR+            Y  FPG+P+WP +
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  324  KQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            ++ LTY F   NP   +       AF  W       F   + + ++D+    Y  DHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIGH
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGH  280



>ref|XP_006438497.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
 ref|XP_006483764.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
 gb|ESR51737.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
Length=371

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 92/182 (51%), Gaps = 23/182 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--------------HRREVAPQYAHFPGK  343
            TG LD+ T+  ++ PRCG PDI+NGT  M                H   V   Y+ FPG 
Sbjct  107  TGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVG-HYSFFPGM  165

Query  342  PKWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYA  172
            P+WP NK+ LTY F   N    +       AF  W +A    F RTD Y +AD++   + 
Sbjct  166  PRWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFT  225

Query  171  RDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENW-----AEFGPPPDGLDIQSVALHEI  7
             DHGDG PFDG  G  AH+F P  G  H D +ENW              +D++SVA+HEI
Sbjct  226  GDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEI  285

Query  6    GH  1
            GH
Sbjct  286  GH  287



>gb|EYU31381.1| hypothetical protein MIMGU_mgv1a023026mg, partial [Erythranthe 
guttata]
Length=267

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 88/162 (54%), Gaps = 5/162 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG+LDA TV  +++PRCGV D +N   +  +     +A  Y  FPG+PKWP  K  LTY 
Sbjct  69   TGILDAKTVKNLLLPRCGVADFVNLNASQFKNKIPTLASHYTFFPGEPKWP--KTNLTYS  126

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F   T       +  A   W     FKF    DY  AD+K      +HGDG PFDGRGG 
Sbjct  127  FPPGTRADALQAIKDATQMWASVSNFKFTYIADYDHADIKISFQVWEHGDGTPFDGRGGA  186

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             AHS  P   + HFD +E WA+ G  P   D+Q++ LHE+GH
Sbjct  187  LAHSSGPYDSLLHFDGDELWAD-GVVPGKYDLQTIGLHELGH  227



>emb|CDY38799.1| BnaA07g28710D [Brassica napus]
Length=370

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 95/177 (54%), Gaps = 17/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV--------APQYAHFPGKPKWPDN  325
            TG LDA T+  +++PRCG PD++NGT+LM   RR+            Y  FPG+P+WP +
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  324  KQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            ++ LTY F   NP   +       AF  W +     F   + + ++D+    Y  DHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIGH
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGH  280



>ref|XP_007216922.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
 gb|EMJ18121.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
Length=297

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 84/161 (52%), Gaps = 14/161 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA TVS MMMPRCGV DIIN  N            Y+ F   P WP +K  LTY F
Sbjct  109  TGTLDAKTVSNMMMPRCGVADIINVAN------------YSFFEENPTWPASKYHLTYAF  156

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGGEY  124
               TP +   PV  AF  W     F F    +  + DL       DHGDG PFDG GG  
Sbjct  157  LQGTPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGTPFDGPGGTI  216

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  H+D++E ++  G      D ++VALHEIGH
Sbjct  217  AHAFAPTNGRLHYDADERFS-VGAVSGAYDFETVALHEIGH  256



>ref|XP_006448956.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
 gb|ESR62196.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
Length=314

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR--REVAPQYAHFPGKPKWPDNKQVLTY  307
            TG LD  T+S M  PRCG+PDIINGT  M+R    ++    YA F G P+WP  K+ +T+
Sbjct  113  TGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSADKKYDIHYAFFEG-PRWPLTKKTVTF  171

Query  306  GFGNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPFDGRGG  130
             F   T      PV +A + W     F F+   DY +AD+K      DHGDG PFDG   
Sbjct  172  AFQPGTRADIHEPVRVALLLWSNWAPFAFEGSNDYENADIKISFQRGDHGDGTPFDGPWH  231

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              AH+F     + HF+ + NW   G    G D+Q+VALHE+GH
Sbjct  232  TLAHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGH  273



>ref|XP_004965107.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=321

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 92/178 (52%), Gaps = 24/178 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREVAPQYAHFPGKPKWPDNKQVL  313
            TGV+DA TV+QMM PRCGV D+INGT+ M      H R +   Y++FPG P WP +K+ L
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNL---YSYFPGSPSWPRSKKRL  164

Query  312  TYGFGN--------PTPFKFFIPVGLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHG  160
            TY   +         T  + F     AF  W  A    F  T  A  AD+    +A DHG
Sbjct  165  TYAITDTAATTIDRATLSRVF---ARAFARWSAATTLNFTETASARDADITIGFHAGDHG  221

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            DG  FDG  G  AH+F P  G  H D+ E W   G           D++SVA+HEIGH
Sbjct  222  DGEAFDGPLGTLAHAFAPTDGRFHLDAAEAWVAAGDVSRASSDVAYDLESVAVHEIGH  279



>gb|KDO37620.1| hypothetical protein CISIN_1g039712mg, partial [Citrus sinensis]
Length=211

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 85/143 (59%), Gaps = 5/143 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA+TV++M  PRCGV DI+NGT  MR  +++   Q  HF    +WP +K  LTY F
Sbjct  19   TGFLDANTVAKMRTPRCGVADIVNGTTRMRSGKKK-QQQNNHFHTVSQWPASKFSLTYAF  77

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRG---  133
               T      PV  AF  W    +F+F +  D+A AD+K    +R+HGDG PFDGRG   
Sbjct  78   RLGTRGDAITPVARAFQTWAANTQFRFSKIEDFAGADIKISFESRNHGDGRPFDGRGGPD  137

Query  132  GEYAHSFRPKKGICHFDSEENWA  64
            G  AH+F P  G  H+D++E WA
Sbjct  138  GTLAHAFAPTNGRFHYDADEPWA  160



>emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=363

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TGVLDA T+  ++ PRCG  D++NGT+ M   +      Y+ FPG+PKWP+ K  LTY F
Sbjct  106  TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYAF  165

Query  300  --GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGG  130
               N            AF  W +     F     + SAD+K      DH DG PFDG  G
Sbjct  166  LPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPMG  225

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPD---------GLDIQSVALHEIGH  1
              AH+F P  G  H D EENW   G P +          +D++SVA+HEIGH
Sbjct  226  TLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGH  277



>gb|EYU35921.1| hypothetical protein MIMGU_mgv1a019701mg [Erythranthe guttata]
Length=304

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 85/162 (52%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
             G+LDA TV  +++PRCGV D +N   +  +     +A  Y  FPG+PKWP  K  LTY 
Sbjct  104  NGILDAKTVEHLLLPRCGVADFVNLNASQFKNEIPTIASHYTFFPGEPKWPPGKTNLTYS  163

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F      +    +  A   W     FKF   TDY  AD+K      DH DG  FDGRGG 
Sbjct  164  FPPGASNEVMQAIKDATQLWAGVTHFKFTYITDYDHADIKISFQVWDHKDGAAFDGRGGI  223

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             AH+F P  G  HFD +E W + G  P   D+Q V LHE+GH
Sbjct  224  LAHAFAPSDGRLHFDGDEVWVD-GVVPGKFDLQMVGLHELGH  264



>ref|NP_001266203.1| matrix metalloproteinase precursor [Solanum lycopersicum]
 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=367

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-------REVAPQYAHFPGKPKWPDNK  322
            TGVLDA+T+  ++ PRCG  D++NGT+ M   +             Y+ FPG P+WP NK
Sbjct  104  TGVLDANTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGSPRWPANK  163

Query  321  QVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGY  151
            + LTY F   N       I    AF  W +     F     Y SAD+K   ++ DH DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTRAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP---------DGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D EENW   G P            +D++SVA+HEIGH
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGH  282



>ref|XP_010255281.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=378

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 87/174 (50%), Gaps = 14/174 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR-------HRREVAPQYAHFPGKPKWPDNK  322
            TGVLD  T+ QM+ PRCGV DIINGT+ M         H       Y+ FP +P WP +K
Sbjct  115  TGVLDESTIQQMVRPRCGVADIINGTSTMNSGKSAKSTHSIHTVAHYSFFPYRPTWPPSK  174

Query  321  QVLTYGFGNPTPFKFFIPVGLA--FVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            + LTY F         +    A  F  W       F  +  Y +AD+K   +  DH DG 
Sbjct  175  RDLTYAFLPANQLSDTVKAVFAHSFARWSAVTPLSFTESSVYLTADIKIAFFRGDHNDGE  234

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENW----AEFGPPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D  ENW    A     P  +D++SVA+HEIGH
Sbjct  235  PFDGVLGTLAHAFSPPDGRFHLDGAENWVVDDARKSSIPSAVDLESVAVHEIGH  288



>ref|XP_010471013.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 97/181 (54%), Gaps = 21/181 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV------------APQYAHFPGKPK  337
            TG LDA T+  +++PRCG PD++NGT+LM   RR+               +Y  FPG+P+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  336  WPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARD  166
            W  +++ LTY F   NP   +       AF  W       F R++ ++++D+    Y  D
Sbjct  165  WRKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIG  4
            HGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  3    H  1
            H
Sbjct  285  H  285



>ref|XP_006363533.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=370

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-------REVAPQYAHFPGKPKWPDNK  322
            TGVLDA T+  ++ PRCG  D++NGT+ M   +             Y+ FPG+P+WP NK
Sbjct  104  TGVLDASTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGRPRWPANK  163

Query  321  QVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGY  151
            + LTY F   N       I    AF  W +     F     Y SAD+K   ++ DH DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTHAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP---------DGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D EENW   G P            +D++SVA+HEIGH
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGH  282



>ref|XP_004237082.2| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=387

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TGVLDA T+  ++ PRCG  D++NGT+ M   +      Y+ FPG+PKWP+ K  LTY F
Sbjct  130  TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYAF  189

Query  300  --GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGG  130
               N            AF  W +     F     + SAD+K      DH DG PFDG  G
Sbjct  190  LPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPMG  249

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPD---------GLDIQSVALHEIGH  1
              AH+F P  G  H D EENW   G P +          +D++SVA+HEIGH
Sbjct  250  TLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGH  301



>ref|XP_006416025.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
 gb|ESQ34378.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
Length=382

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 97/185 (52%), Gaps = 25/185 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV--------------APQYAHFPGK  343
            TG LD  T+  ++MPRCGVPDI+NGT+ M   RR                  +Y+ FPG+
Sbjct  106  TGELDELTLKHVVMPRCGVPDIVNGTSTMHNGRRRTYEVSFSGKGPRFHAVKRYSFFPGE  165

Query  342  PKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYA  172
            P+WP+  + LTY F   N    +       AFV W + +   F R + ++ +D++   Y+
Sbjct  166  PRWPERNRDLTYAFDPRNSLTEEVKSVFSRAFVRWAEVIPVTFTRVEVFSISDIRIGFYS  225

Query  171  RDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG--------PPPDGLDIQSVAL  16
             DHGDG PFDG  G  AH+F P  G  H D +ENW   G             +D++SVA+
Sbjct  226  GDHGDGEPFDGVMGTLAHAFSPPNGHFHLDGDENWIVSGDVGGDRLLSVTAAVDLESVAV  285

Query  15   HEIGH  1
            HEIGH
Sbjct  286  HEIGH  290



>gb|KDO75344.1| hypothetical protein CISIN_1g037265mg [Citrus sinensis]
Length=305

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 89/163 (55%), Gaps = 5/163 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR--REVAPQYAHFPGKPKWPDNKQVLTY  307
            TG LD  T+S M  PRCG+PDIINGT  M+R    ++    YA F G P+WP  K+ +TY
Sbjct  104  TGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSTDKKYDIHYAFFEG-PRWPLTKKTVTY  162

Query  306  GFGNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPFDGRGG  130
             F   T      PV +A + W     F F+   DY +AD+K      DHGDG PFDG   
Sbjct  163  AFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHGDGTPFDGPWH  222

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
               H+F     + HF+ + NW   G    G D+Q+VALHE+GH
Sbjct  223  TLGHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGH  264



>ref|XP_006387200.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
 gb|ABK94796.1| unknown [Populus trichocarpa]
 gb|ERP46114.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
Length=309

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 10/169 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNL---MRRHRREVAPQYAHFP-GKPKWPDNKQVL  313
            TG LD+ T+ QM++PRCG PDIIN  +      + + +     AH+  G  KWP +K  L
Sbjct  100  TGNLDSSTIQQMVIPRCGTPDIINTPSTKPNSTKSKHKKVHMVAHYAFGAEKWPPSKYAL  159

Query  312  TYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYP  148
            TY FG+                AF  W K  +F F + T  ASAD+    Y+ DHGD YP
Sbjct  160  TYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFQEATAGASADIVIEFYSGDHGDRYP  219

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            FDG G   AH+F P+ G  H+D++ENW+   P  D  D++SV +HEIGH
Sbjct  220  FDGPGKTLAHAFYPQDGRLHYDADENWST-DPAMDQTDLESVTVHEIGH  267



>gb|KDP21290.1| hypothetical protein JCGZ_21761 [Jatropha curcas]
Length=371

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 92/178 (52%), Gaps = 18/178 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LD  T+SQ++ PRCG  DI+NGT  M   +                Y  FPG P+WP
Sbjct  109  TGELDEQTLSQLIKPRCGNADIVNGTTAMNSGKWTPPFNTTSHFHTVGHYTFFPGSPRWP  168

Query  330  DNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
            D+K+ LTY F  GN    +       AF  W   +   F  TD +  AD++   ++ DHG
Sbjct  169  DSKRDLTYAFWPGNNLTTEAKSVFTRAFDRWSTVIPMTFAETDSFTIADIRIGFFSGDHG  228

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPD-----GLDIQSVALHEIGH  1
            DG PFDG  G  AH+F P  G  H D +ENW   G   D      +D++SVA+HEIGH
Sbjct  229  DGEPFDGVLGTLAHAFSPPSGRFHLDGDENWVVSGDISDSSIISAVDLESVAVHEIGH  286



>ref|XP_002325947.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
 gb|EEF00329.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
Length=308

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 97/171 (57%), Gaps = 14/171 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIING-----TNLMRRHRR-EVAPQYAHFPGKPKWPDNKQ  319
            TG LD+ T+ QMM+PRCG+PDIIN       +   +H++  V   YA   G  KWP +K 
Sbjct  99   TGNLDSSTIQQMMIPRCGMPDIINTPSAKPNSTKSKHKKVHVVAHYAF--GAQKWPPSKY  156

Query  318  VLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDG  154
             LTY FG+                AF  W K  +F F + T  ASAD+    ++ DHGD 
Sbjct  157  ALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFREATGGASADIVIEFFSGDHGDQ  216

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             PFDG G + AH+F P+ G  H+D++ENW+   P  D +D+++V +HEIGH
Sbjct  217  SPFDGPGNQLAHAFYPQDGRLHYDADENWST-DPAMDQIDLETVTVHEIGH  266



>ref|XP_010030761.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=311

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 86/172 (50%), Gaps = 16/172 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGT----NLMRRHRREVAPQYAHFPGKPKWPDNKQVL  313
            TG LDADTV+QM  PRCGVPD ++      N  +  +  +  +Y  FP KP+WP  K  L
Sbjct  103  TGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTHL  162

Query  312  TYGFGNPTPFKFFIPV-------GLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGD  157
             Y FG   P    IP+         AF  W     F F         DL    Y  DHGD
Sbjct  163  NYAFG---PVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGD  219

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GYPFDG G   AHSF P  G  H+D EE W+   P     D++SV LHEIGH
Sbjct  220  GYPFDGPGKILAHSFSPTDGRFHYDVEEQWST-NPSSTQFDLESVTLHEIGH  270



>gb|KFK44477.1| hypothetical protein AALP_AA1G261400 [Arabis alpina]
Length=378

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 99/184 (54%), Gaps = 24/184 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV--------------APQYAHFPGK  343
            TG LD  T+  +++PRCGVPD++NGT+ M  H R                  +Y+ FPG+
Sbjct  102  TGELDELTLIHVVIPRCGVPDVVNGTSTMHGHGRRTYEVSFTGRGPRFHAVRRYSFFPGE  161

Query  342  PKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYA  172
            P+WP++++ LTY F   N    +       AFV W +     F R + + +AD++   Y+
Sbjct  162  PRWPNHRRDLTYAFDPRNALTEEVKNVFSRAFVRWAEVTPLTFTRAESFLTADIRVGFYS  221

Query  171  RDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALH  13
             DHGDG PFDG  G  AH+F P  G  H D +ENW       DG       +D++SVA+H
Sbjct  222  GDHGDGEPFDGVMGTLAHAFSPPSGHFHLDGDENWVVSDSGGDGFLSVTAAVDLESVAVH  281

Query  12   EIGH  1
            EIGH
Sbjct  282  EIGH  285



>ref|XP_011080437.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=308

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 87/160 (54%), Gaps = 3/160 (2%)
 Frame = -1

Query  474  VLDADTVSQMMMPRCGVPDI-INGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGFG  298
            ++D +TV+QM  PRCGVPD  +N +N +       A  Y   P KP WP  K+ LTY F 
Sbjct  110  IMDDNTVTQMSRPRCGVPDFNLNTSNELFLQIPTSASHYTFLPNKPTWPRTKRNLTYSFP  169

Query  297  NPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGGEYA  121
                   +  +  A   W     FKF  T +Y  AD+K      +HGDGYPFDGRGG   
Sbjct  170  VIARRDVYPAIEHATELWAFFSSFKFSYTQNYDRADIKISFQYGNHGDGYPFDGRGGILG  229

Query  120  HSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            H+  P  GI H+D++ENW   G  P   D+Q++ LHE+GH
Sbjct  230  HALPPTIGILHYDADENWVN-GETPGAFDLQTIGLHELGH  268



>gb|KCW56124.1| hypothetical protein EUGRSUZ_I01878 [Eucalyptus grandis]
Length=294

 Score =   124 bits (310),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 86/172 (50%), Gaps = 16/172 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGT----NLMRRHRREVAPQYAHFPGKPKWPDNKQVL  313
            TG LDADTV+QM  PRCGVPD ++      N  +  +  +  +Y  FP KP+WP  K  L
Sbjct  86   TGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTHL  145

Query  312  TYGFGNPTPFKFFIPV-------GLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGD  157
             Y FG   P    IP+         AF  W     F F         DL    Y  DHGD
Sbjct  146  NYAFG---PVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGD  202

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GYPFDG G   AHSF P  G  H+D EE W+   P     D++SV LHEIGH
Sbjct  203  GYPFDGPGKILAHSFSPTDGRFHYDVEEQWST-NPSSTQFDLESVTLHEIGH  253



>ref|XP_007216495.1| hypothetical protein PRUPE_ppa023859mg, partial [Prunus persica]
 gb|EMJ17694.1| hypothetical protein PRUPE_ppa023859mg, partial [Prunus persica]
Length=172

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 76/130 (58%), Gaps = 2/130 (2%)
 Frame = -1

Query  387  HRREVAPQYAHFPGKPKWPDNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD  208
            H      QYA FPG PKWP +K  LTY F   TP +   PV  AF  W    +F F + +
Sbjct  2    HEGLTVSQYAFFPGNPKWPSSKYRLTYAFLQGTPNQAKDPVKRAFQTWANNTQFTFSQVE  61

Query  207  -YASADLKFHLYARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDI  31
             Y + DL      RDHGDGYPFDGRGG  AH+F P  G  H+D++E W   G    G+D+
Sbjct  62   EYGTPDLTISFQRRDHGDGYPFDGRGGITAHAFSPTDGRFHYDADEMWV-VGSVNGGMDL  120

Query  30   QSVALHEIGH  1
            QSVA+HEIGH
Sbjct  121  QSVAVHEIGH  130



>ref|XP_004297896.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 90/164 (55%), Gaps = 6/164 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNL---MRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TVS+M  PRCGV D I    +    + H  EV+  Y+ F  K KWP +K  LT
Sbjct  110  TGTLDGKTVSKMTKPRCGVSDHIGVHKIDYSKKDHIHEVS-HYSFFSSKQKWPPSKYHLT  168

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGYPFDGRG  133
            Y F   T  +   P+  AF  W  +  FKF R  DY  AD+K      DHGDG  FDG G
Sbjct  169  YAFAPGTLSEAMTPIAQAFQTWAASTHFKFRRHRDYKKADIKISFEQGDHGDGSSFDGTG  228

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH++ P  G  H+D++E W+  G      D+++VALHEIGH
Sbjct  229  GILAHAYAPTYGKLHYDADEPWS-IGALEGYYDLETVALHEIGH  271



>gb|KFK41437.1| hypothetical protein AALP_AA2G130300 [Arabis alpina]
Length=380

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 94/185 (51%), Gaps = 25/185 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAP----------------QYAHFP  349
            TG LDA T+  M++PRCG PD++NGT+LM   RR+                    Y  FP
Sbjct  104  TGELDALTIKHMVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSPGGRGPRLHTFKHYTLFP  163

Query  348  GKPKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHL  178
            G+P+WP N++ LTY F   NP   +       AF  W       F   D +  +D+    
Sbjct  164  GEPRWPRNRRDLTYAFDPRNPLTEEVKGVFSRAFQRWSDVTALNFTLIDSFTRSDITIGF  223

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVAL  16
            Y+ DHGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+
Sbjct  224  YSGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  15   HEIGH  1
            HEIGH
Sbjct  284  HEIGH  288



>emb|CDY16241.1| BnaA09g29750D [Brassica napus]
Length=384

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 101/186 (54%), Gaps = 26/186 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-----RRHRREVA-----------PQYAHFP  349
            TG LD  T+  +++PRCGVPD++NGT+ M     RR   EV+            +Y+ FP
Sbjct  106  TGELDELTLQHVVIPRCGVPDVVNGTSTMLSGGGRRRTYEVSFSGRSQRFHAVKRYSFFP  165

Query  348  GKPKWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHL  178
            G+P+WP+ ++ LTY F   N    +       AFV W + +   F R + ++++D+    
Sbjct  166  GEPRWPERRRNLTYAFEPQNALTEEVKSVFSRAFVRWAEVIPLTFRRVESFSTSDISIGF  225

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVA  19
            Y  +HGD  PFDG  G  AH+F P  G  H DS ENW   G   DG       +D++SVA
Sbjct  226  YTGEHGDREPFDGFMGTLAHAFSPPNGHFHLDSAENWIVSGEGGDGFLTERAAVDLESVA  285

Query  18   LHEIGH  1
            +HEIGH
Sbjct  286  VHEIGH  291



>gb|KCW49215.1| hypothetical protein EUGRSUZ_K02795 [Eucalyptus grandis]
Length=405

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 94/176 (53%), Gaps = 18/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-----RHRREV-----APQYAHFPGKPKWP  331
            TG LD  T S+MM PRCGV DIINGT  M      R+ R +        YA   G P+WP
Sbjct  192  TGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEGSPRWP  251

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
             +   LTYGF   TP     PV  AF  W    RF F    D+  A+++      DHGDG
Sbjct  252  ASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDG  311

Query  153  Y--PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG---LDIQSVALHEIGH  1
                FDG GG  AH+F P  G+ H+D++E WA    PP G    ++++VALHEIGH
Sbjct  312  AHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEIGH  365



>ref|NP_001267680.1| metalloendoproteinase 1-like precursor [Cucumis sativus]
 emb|CAB76364.1| matrix metalloproteinase [Cucumis sativus]
 gb|KGN52412.1| hypothetical protein Csa_5G632110 [Cucumis sativus]
Length=320

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 90/170 (53%), Gaps = 11/170 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHF---------PGKPKWPD  328
            +G+LD++T++Q+ MPRCGV D+I      +R++      + HF          G  KWP 
Sbjct  112  SGILDSNTIAQIAMPRCGVQDVIKNKKTKKRNQNFTNNGHTHFHKVSHFTFFEGNLKWPS  171

Query  327  NKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
            +K  L+YGF    P     PV  AF  W     FKF    DY  AD+K      +HGD  
Sbjct  172  SKLHLSYGFLPNYPIDAIKPVSRAFSKWSLNTHFKFSHVADYRKADIKISFERGEHGDNA  231

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH++ P  G  HFD ++ W+  G      D+++VALHEIGH
Sbjct  232  PFDGVGGVLAHAYAPTDGRLHFDGDDAWS-VGAISGYFDVETVALHEIGH  280



>ref|XP_006363534.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=363

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 88/172 (51%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+ D  T+  ++ PRCG  D++NGT+ M   +      Y+ FPG+PKWP++K  LTY F
Sbjct  105  TGLFDEPTIQNLIKPRCGNADVVNGTSTMNAGKPHTVAHYSFFPGRPKWPESKTDLTYSF  164

Query  300  --GNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGYPFDGRGG  130
               N            AF  W +     F     + SAD+K   +  DH DG PFDG  G
Sbjct  165  LPANNLTEDIKSVFSRAFDRWSEVTPLSFTEIASFQSADIKIGFFTGDHNDGEPFDGPMG  224

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPD---------GLDIQSVALHEIGH  1
              AH+F P  G  H D EENW   G P +          +D++SVA+HEIGH
Sbjct  225  TLAHAFSPPAGHFHLDGEENWVVDGVPVNDGNFFSILSAVDLESVAVHEIGH  276



>ref|NP_173824.2| putative metalloproteinase [Arabidopsis thaliana]
 gb|AAU90055.1| At1g24140 [Arabidopsis thaliana]
 gb|AEE30482.1| putative metalloproteinase [Arabidopsis thaliana]
Length=384

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 97/183 (53%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-------------RRHRREVAPQYAHFPGKP  340
            TGVLD  T+  +++PRCG PD++NGT+ M             R  R      Y+ FPG+P
Sbjct  107  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  166

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W++     F R + ++++D+    Y+ 
Sbjct  167  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  226

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D EENW   G   DG       +D++SVA+HE
Sbjct  227  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  286

Query  9    IGH  1
            IGH
Sbjct  287  IGH  289



>ref|XP_007217804.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
 gb|EMJ19003.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
Length=406

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 87/163 (53%), Gaps = 11/163 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDA TV +M MPRCG     +G+     H       YA F G PKWP NK  LTYGF
Sbjct  212  TGTLDAKTVKKMEMPRCGKKRGGHGSTHTVGH-------YAFFQGNPKWPANKYHLTYGF  264

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY--PFDGRGG  130
               T  +    V  AF  WQ    F F +   + SADLK      DHGDG    FDG G 
Sbjct  265  LQGTQSEAVGAVARAFATWQSNTHFTFSQAQSFESADLKIGFGRGDHGDGANNAFDGPGK  324

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              AH+FRP  G  H+D++E W   G  P G D+++VALHEIGH
Sbjct  325  TIAHAFRPTNGRFHYDADETWV-VGAVPGGFDLETVALHEIGH  366



>gb|AAC00572.1| similar to zinc metalloproteinases [Arabidopsis thaliana]
Length=377

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 97/183 (53%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-------------RRHRREVAPQYAHFPGKP  340
            TGVLD  T+  +++PRCG PD++NGT+ M             R  R      Y+ FPG+P
Sbjct  100  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  159

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W++     F R + ++++D+    Y+ 
Sbjct  160  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  219

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D EENW   G   DG       +D++SVA+HE
Sbjct  220  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  279

Query  9    IGH  1
            IGH
Sbjct  280  IGH  282



>ref|XP_010460187.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=381

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 95/183 (52%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-------------RRHRREVAPQYAHFPGKP  340
            TGVLD  T+  +M+PRCG PD++NGT+ M             R  R     +Y+ FPG+P
Sbjct  108  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  167

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W +     F R   + ++D+    YA 
Sbjct  168  RWPSNRRDLTYAFDPRNKLTEEVKTVFSRAFARWAQVTPLTFTRVQSFRTSDIFIGFYAG  227

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D+EENW       DG       +D++SVA+HE
Sbjct  228  EHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISSEGGDGVLSVTEAIDLESVAVHE  287

Query  9    IGH  1
            IGH
Sbjct  288  IGH  290



>ref|XP_007010134.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY18944.1| Matrixin family protein, putative [Theobroma cacao]
Length=288

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 92/165 (56%), Gaps = 7/165 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LDADTV QMM  RCG+ D++N  N  R      A +Y  F G PKWP +K  LTY F
Sbjct  84   TGNLDADTVKQMMKSRCGIADVMNSNN-SRSIYGIGASRYEFFLGNPKWPLSKTHLTYNF  142

Query  300  GNPTPFKFFIPVGL----AFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGR  136
             +         V      AF  W    RF F+   +Y  AD++   ++ +HGDG PFDG 
Sbjct  143  HSSVEVPLAENVRSVCVRAFQRWANVSRFTFEEVAEYYVADIEIGFHSGEHGDGNPFDGP  202

Query  135  GGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             G  AH+  P  G  H+D++E+W+   P PD +D++SV +HEIGH
Sbjct  203  QGTLAHASPPTDGKLHYDADEDWST-NPGPDEVDLESVTVHEIGH  246



>gb|EAZ24565.1| hypothetical protein OsJ_08327 [Oryza sativa Japonica Group]
Length=372

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 89/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ----YAHFPGKPKWPDNKQVL  313
            TG LD DTV QM+ PRCGV D+INGT+ M R+    A +    Y++FPG P WP  ++ L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSSAALRGRNLYSYFPGGPMWPPFRRNL  167

Query  312  TYGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGY  151
             Y     +               AF  W  A R +F     AS AD+    Y+ DHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP------DGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G           +D++SVA+HEIGH
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGH  283



>dbj|BAJ98922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 90/173 (52%), Gaps = 16/173 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--HRREVAPQYAHFPGKPKWPDNKQVLTY  307
            TG LDA TV++MM PRCGV DIINGT+ M +  H R +   Y++FPG P WP +K+ L Y
Sbjct  108  TGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNL---YSYFPGSPSWPRSKKSLRY  164

Query  306  GFGNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGYPF  145
                 T               AF  W  A    F  T  AS AD+    ++ DHGDG  F
Sbjct  165  AITAATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAF  224

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP-----DGLDIQSVALHEIGH  1
            DG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  225  DGPLGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGH  277



>dbj|BAJ93963.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89432.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 90/173 (52%), Gaps = 16/173 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--HRREVAPQYAHFPGKPKWPDNKQVLTY  307
            TG LDA TV++MM PRCGV DIINGT+ M +  H R +   Y++FPG P WP +K+ L Y
Sbjct  108  TGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNL---YSYFPGSPSWPRSKKSLRY  164

Query  306  GFGNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGYPF  145
                 T               AF  W  A    F  T  AS AD+    ++ DHGDG  F
Sbjct  165  AITAATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAF  224

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP-----DGLDIQSVALHEIGH  1
            DG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  225  DGPLGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGH  277



>ref|XP_002893327.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69586.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 96/183 (52%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------------VAPQYAHFPGKP  340
            TGVLD  T+  +++PRCG PD++NGT+ M   RR                  Y+ FPG+P
Sbjct  107  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRRTFEVSFAGRGQRFHTVKHYSFFPGEP  166

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W +     F R + ++++D+    Y+ 
Sbjct  167  RWPRNRRDLTYAFDPRNSLTEEVKSVFSRAFARWAEVTPLTFTRVERFSTSDISIGFYSG  226

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D EENW   G   DG       +D++SVA+HE
Sbjct  227  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVDEAVDLESVAVHE  286

Query  9    IGH  1
            IGH
Sbjct  287  IGH  289



>gb|KCW85819.1| hypothetical protein EUGRSUZ_B02562 [Eucalyptus grandis]
Length=374

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 88/176 (50%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCG PDI+NG+  M   + E            Y  FPG P+WPD 
Sbjct  111  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  170

Query  324  KQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            K  LTY F   N            AF  W       F  TD Y +AD+K   ++ DHGDG
Sbjct  171  KSDLTYAFLPANQLSDDEKAVFSRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHGDG  230

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
              FDG  G  AH+F P  G  H D +ENW   G          +D++SVA+HEIGH
Sbjct  231  EAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGH  286



>gb|EYU46220.1| hypothetical protein MIMGU_mgv1a010241mg [Erythranthe guttata]
Length=318

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TGVLDA TV+QMM PRCGV D   ++N T+LM      +A  Y  FPGKP W   K  LT
Sbjct  117  TGVLDAATVNQMMQPRCGVADNFSVLNQTHLMTE-SPVIAKHYTFFPGKPVWWPGKTDLT  175

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRG  133
            Y F     +     +  A   W     FKF    DY  AD+K      DHGD  PFDG G
Sbjct  176  YSFPAGASYDLDEGIFEATGLWNNNSIFKFAYIKDYDKADVKISFQVWDHGDRAPFDGPG  235

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+F P  G  HFD  E W + G      D+QSV LHE+GH
Sbjct  236  GVLAHAFAPTDGRLHFDGSEKWVD-GVKDGAFDVQSVGLHELGH  278



>ref|NP_001048075.1| Os02g0740700 [Oryza sativa Japonica Group]
 dbj|BAD15762.1| putative zinc metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAF09989.1| Os02g0740700 [Oryza sativa Japonica Group]
Length=372

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 89/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ----YAHFPGKPKWPDNKQVL  313
            TG LD DTV QM+ PRCGV D+INGT+ M R+    A +    Y++FPG P WP  ++ L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  312  TYGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGY  151
             Y     +               AF  W  A R +F     AS AD+    Y+ DHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP------DGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G           +D++SVA+HEIGH
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGH  283



>ref|NP_001057259.1| Os06g0239100 [Oryza sativa Japonica Group]
 dbj|BAD37871.1| putative metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAD37908.1| putative metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAF19173.1| Os06g0239100 [Oryza sativa Japonica Group]
 gb|EAZ36428.1| hypothetical protein OsJ_20758 [Oryza sativa Japonica Group]
Length=371

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 86/175 (49%), Gaps = 18/175 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-YAHFPGKPKWPDNKQVLTYG  304
            TG LDA TVSQMM PRCGV D++NGT+ M           Y++FPG P+WP ++  L Y 
Sbjct  111  TGDLDAATVSQMMAPRCGVADVVNGTSTMGGGGGVRGRGLYSYFPGSPRWPRSRTTLRYA  170

Query  303  FG--------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
                        T  K F     AF  W  A    F +    A AD+    Y  DHGDG 
Sbjct  171  ITATSQTSIDRATLSKVFAS---AFARWSAATTLNFTEAASAADADITIGFYGGDHGDGE  227

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  228  AFDGPLGTLAHAFSPTNGRLHLDASEAWVAGGDVTRASSNAAVDLESVAVHEIGH  282



>gb|EAY87473.1| hypothetical protein OsI_08881 [Oryza sativa Indica Group]
Length=372

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 89/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ----YAHFPGKPKWPDNKQVL  313
            TG LD DTV QM+ PRCGV D+INGT+ M R+    A +    Y++FPG P WP  ++ L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  312  TYGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGY  151
             Y     +               AF  W  A R +F     AS AD+    Y+ DHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP------DGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G           +D++SVA+HEIGH
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGH  283



>gb|EAZ00310.1| hypothetical protein OsI_22327 [Oryza sativa Indica Group]
Length=371

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 86/175 (49%), Gaps = 18/175 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-YAHFPGKPKWPDNKQVLTYG  304
            TG LDA TVSQMM PRCGV D++NGT+ M           Y++FPG P+WP ++  L Y 
Sbjct  111  TGDLDAATVSQMMAPRCGVADVVNGTSTMGGGGGVRGRGLYSYFPGSPRWPRSRTTLRYA  170

Query  303  FG--------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
                        T  K F     AF  W  A    F +    A AD+    Y  DHGDG 
Sbjct  171  ITATSQTSIDRATLSKVFAS---AFARWSAATTLNFTEAASAADADITIGFYGGDHGDGE  227

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  228  AFDGPLGTLAHAFSPTNGRLHLDASEAWVAGGDVTRASSNAAVDLESVAVHEIGH  282



>gb|KGN51345.1| hypothetical protein Csa_5G522910 [Cucumis sativus]
Length=295

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM  PRCGV D+    +N       E++  Y  FPG  KWPD K+ LTY 
Sbjct  96   SGILDQETLDQMFKPRCGVRDVFKFNSNKNLEDDLEMSSHYTLFPGNLKWPDYKRHLTYV  155

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG PFDG GG 
Sbjct  156  FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPFDGPGGV  215

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D ++ W+  G     +++ +VALHE+GH
Sbjct  216  VGHAFAPTDGRLHLDGDDTWSA-GMEVQKVNVMNVALHELGH  256



>ref|XP_004159085.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 88/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +GVLD +T+ QM  PRCGV D+    ++       E++  YA FPG P+WPD K+ LTY 
Sbjct  96   SGVLDQETLDQMFKPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNPQWPDYKRHLTYV  155

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG PFDG GG 
Sbjct  156  FTNNFPIDFVPSVTEAMARWAGQSLFTFSEASDAQSADINISFQIKDHADGLPFDGPGGI  215

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G     +++ + ALHE+GH
Sbjct  216  VGHAFAPTDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGH  256



>ref|XP_009105693.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=378

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 95/185 (51%), Gaps = 25/185 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV----------------APQYAHFP  349
            TG LDA T+  +++PRCG PD++NGT+LM   RR+                    Y  FP
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVNFSPGGKVPRLHTVKHYTLFP  163

Query  348  GKPKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHL  178
            G+P+WP +++ LTY F   NP   +       AF  W +     F   + + ++D+    
Sbjct  164  GEPRWPRDRRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGF  223

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVAL  16
            Y  DHGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  15   HEIGH  1
            HEIGH
Sbjct  284  HEIGH  288



>ref|XP_007044491.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY00323.1| Matrixin family protein, putative [Theobroma cacao]
Length=369

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 93/178 (52%), Gaps = 19/178 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR----------HRREVAPQYAHFPGKPKWP  331
            TG LD  T+ Q++ PRCG  DI+NGT+ M            H R  A  YA FPG+P WP
Sbjct  107  TGQLDDQTLQQIVRPRCGNADIVNGTSSMNSGKSSSFHTTGHFRTTA-HYAFFPGRPFWP  165

Query  330  DNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
             N++ LTYGF   N    +       AF  W       F +TD + SAD+K   Y+ DHG
Sbjct  166  ANRRDLTYGFLPANELSDEVKAVFTRAFEKWSAVTPLTFTQTDSFFSADIKIAFYSGDHG  225

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            DG PFDG  G  AH+F P  G  H D  ENW   G          +D++SVA+HEIGH
Sbjct  226  DGEPFDGVLGTLAHAFSPTNGRFHLDLAENWVVSGDVTTSSLSSAVDLESVAVHEIGH  283



>ref|XP_009104967.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=381

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 95/185 (51%), Gaps = 25/185 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV----------------APQYAHFP  349
            TG LDA T+  +++PRCG PD++NGT++M   RR+                    Y  FP
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSVMHNGRRKTFEVNFSPGGRIPRLHTVKHYTLFP  163

Query  348  GKPKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHL  178
            G+P+WP +++ LTY F   NP   +       AF  W +     F   + + ++D+    
Sbjct  164  GEPRWPKDRRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGF  223

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVAL  16
            Y  DHGDG PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  15   HEIGH  1
            HEIGH
Sbjct  284  HEIGH  288



>gb|ACB59207.1| matrixin family protein [Brassica oleracea]
 emb|CDY14666.1| BnaC05g19230D [Brassica napus]
Length=383

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 25/185 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREVA-----------PQYAHFPG  346
            TG LD  T+  +++PRCGVPD++NGT+ M    RR   EV+            +Y+ FPG
Sbjct  106  TGELDELTLQHVVIPRCGVPDVVNGTSTMLNGGRRRTYEVSFSGRSQRFHAVKRYSFFPG  165

Query  345  KPKWPDNKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLY  175
            +P+WP+ ++ LTY F   N    +       AFV W + +   F R + ++++D+    Y
Sbjct  166  EPRWPERRRNLTYAFEPQNNLAEEVKSVFSRAFVRWAEVIPLTFRRVESFSTSDISIGFY  225

Query  174  ARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVAL  16
              +HGD  PFDG  G  AH+F P  G  H D  ENW   G   DG       +D++SVA+
Sbjct  226  TGEHGDREPFDGFMGTLAHAFSPPTGHFHLDGAENWIVSGEGGDGFLTERAAVDLESVAV  285

Query  15   HEIGH  1
            HEIGH
Sbjct  286  HEIGH  290



>ref|XP_009115471.1| PREDICTED: metalloendoproteinase 1 [Brassica rapa]
Length=384

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 100/186 (54%), Gaps = 26/186 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-----RRHRREVA-----------PQYAHFP  349
            TG LD  T+  +++PRCGVPD++NGT+ M     RR   EV+            +Y+ FP
Sbjct  106  TGELDELTLQHVVIPRCGVPDVVNGTSTMLSGGGRRRTYEVSFSGRSQRFHAVKRYSFFP  165

Query  348  GKPKWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHL  178
            G+P+WP+ ++ LTY F   N    +       AFV W + +   F R + ++++D+    
Sbjct  166  GEPRWPERRRNLTYAFDPRNALTEEVKSVFSRAFVRWAEVIPLTFRRVESFSTSDISIGF  225

Query  177  YARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVA  19
            Y  +HGD  PFDG  G  AH+F P  G  H D  ENW   G   DG       +D++SVA
Sbjct  226  YTGEHGDREPFDGFMGTLAHAFSPPNGHFHLDGAENWIVSGEGGDGFLTERAAVDLESVA  285

Query  18   LHEIGH  1
            +HEIGH
Sbjct  286  VHEIGH  291



>ref|XP_011010763.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=308

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 91/168 (54%), Gaps = 11/168 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGT---NLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TV+QMM PRCGV DI N T   N  +         Y+ FPG P+W  +K+ L 
Sbjct  102  TGRLDKRTVNQMMKPRCGVADIFNSTKHRNSSKSSDGVANADYSFFPGAPRW--SKKHLK  159

Query  309  YGFGNPTPFKFFIPV----GLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            Y FG          +      +F  W +   F F+   + A AD+K   Y  DHGD  PF
Sbjct  160  YTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEPF  219

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG +AH FRP  G+ HFD++E W+   P    LD++SVA+HEIGH
Sbjct  220  DGPGGIFAHGFRPTIGMLHFDADETWSS-NPGRLELDLESVAVHEIGH  266



>ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=364

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 90/175 (51%), Gaps = 15/175 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-------YAHFPGKPKWPDNK  322
            TG LD  T+ Q++ PRCG  DIING+  M   + +           Y+ FPG P+WPD+K
Sbjct  106  TGELDEQTLDQLVRPRCGNADIINGSTTMNSGKWQTTTTSFHAVGHYSFFPGTPRWPDSK  165

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            + LTY F   N            AF  W   +   F  T+ Y  AD++   ++ DHGDG 
Sbjct  166  RDLTYAFWPSNQLTEVEKSVFTRAFDRWSTVIPMNFTETESYNVADIRIGFFSGDHGDGE  225

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D EENW   G          +D++SVA+HEIGH
Sbjct  226  PFDGVLGTLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGH  280



>ref|XP_006304956.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
 gb|EOA37854.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
Length=381

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 101/183 (55%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR--EVA-----------PQYAHFPGKP  340
            TGVLD  T+ Q+++PRCG PD++NGT+ M   RR  EV+            +Y+ FPG+P
Sbjct  106  TGVLDELTLKQVVIPRCGNPDVVNGTSTMHSGRRTYEVSFSGGGQRFHAVKRYSFFPGEP  165

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP +++ LTY F   N    +       AF  W +     F R + ++++D+    Y+ 
Sbjct  166  RWPRHRRDLTYAFNPRNMLTEEVKTVFSRAFARWAEVTPLTFTRVESFSNSDIFIGFYSG  225

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-------PPPDGLDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D EENW   G         P+ +D++SVA+HE
Sbjct  226  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDREENWIISGEGGDGVISVPEAVDLESVAVHE  285

Query  9    IGH  1
            IGH
Sbjct  286  IGH  288



>ref|XP_010552627.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=376

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 95/182 (52%), Gaps = 22/182 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-------------RRHRREVAPQYAHFPGKP  340
            +G LD  TV  +++PRCG PDI+NG++ M             R  R     +Y+ FPG+P
Sbjct  106  SGELDELTVRHLVIPRCGNPDIVNGSSAMHGGKKYEVNFAGRRGQRFHALKRYSLFPGEP  165

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP++++ LTY F   N    +     G AF  W    +  F R + +  +D+    Y  
Sbjct  166  RWPEDRRQLTYAFDPRNALTEEVKGVFGRAFARWAAVTKLTFTRVETFPDSDITIGFYTG  225

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG------PPPDGLDIQSVALHEI  7
            DHGDG PFDG  G  AH+F P  G  H DS+ENW   G           +D++SVA+HEI
Sbjct  226  DHGDGEPFDGVLGTLAHAFSPPSGRFHLDSDENWVVSGDVGGILSMTSAVDLESVAVHEI  285

Query  6    GH  1
            GH
Sbjct  286  GH  287



>ref|XP_009624303.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=365

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-------REVAPQYAHFPGKPKWPDNK  322
            TGVLDA T+  ++ PRCG  D++NGT+ M   +             Y+ FPG+P+WP +K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSPSMHTVAHYSFFPGRPRWPASK  161

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
              LTY F   N            AF  W +     F  T  + SAD+K   +A DH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFERWSEVTPLTFSETASFQSADIKIGFFAGDHNDGE  221

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPD---------GLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D +ENW   G P D          +D++SVA+HEIGH
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVINGVPIDEGNFFSILSAVDLESVAVHEIGH  280



>gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum]
Length=365

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAH-------FPGKPKWPDNK  322
            TGVLDA T+  ++ PRCG  D++NGT+ M   +     Q  H       FPG+P+WPD+K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
              LTY F   N            AF  W +     F  T  + SAD+K   +A DH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP---------DGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D +ENW   G P            +D++SVA+HEIGH
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGH  280



>ref|NP_001235535.1| metalloendoproteinase 1 precursor [Glycine max]
 sp|P29136.2|MEP1_SOYBN RecName: Full=Metalloendoproteinase 1; AltName: Full=SMEP1; Flags: 
Precursor [Glycine max]
 gb|AAB26959.1| metalloproteinase [Glycine max]
Length=305

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 89/169 (53%), Gaps = 12/169 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG  D +T+ Q+M PRCGVPDII  TN  +     +   Y  F   P+W      LTY F
Sbjct  97   TGKFDINTLKQIMTPRCGVPDIIINTN--KTTSFGMISDYTFFKDMPRWQAGTTQLTYAF  154

Query  300  GNPTPF---KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRG  133
             +P P     F   +  AF  W   V   F + T Y +A++K    +++HGD YPFDG G
Sbjct  155  -SPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPG  213

Query  132  GEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            G   H+F P  G CHFD++E W   G     P     D++SVA+HEIGH
Sbjct  214  GILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGH  262



>ref|XP_010498935.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=425

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 96/183 (52%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM-------------RRHRREVAPQYAHFPGKP  340
            TGVLD  T+  +M+PRCG PD++NGT+ M             R  R     +Y+ FPG+P
Sbjct  152  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  211

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W +     F   + + ++D+    Y+ 
Sbjct  212  RWPRNRRDLTYAFDPRNKLTEEVKTVFSRAFARWAEVTPLTFTHVESFRTSDIFIGFYSG  271

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D+EENW   G   DG       +D++SVA+HE
Sbjct  272  EHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISGEGGDGVLSVTEAIDLESVAVHE  331

Query  9    IGH  1
            IGH
Sbjct  332  IGH  334



>ref|XP_009758591.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=365

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAH-------FPGKPKWPDNK  322
            TGVLDA T+  ++ PRCG  D++NGT+ M   +     Q  H       FPG+P+WPD+K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY  151
              LTY F   N            AF  W +     F  T  + SAD+K   +A DH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP---------DGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D +ENW   G P            +D++SVA+HEIGH
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGH  280



>gb|ACU20327.1| unknown [Glycine max]
Length=305

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 89/169 (53%), Gaps = 12/169 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG  D +T+ Q+M PRCGVPDII  TN  +     +   Y  F   P+W      LTY F
Sbjct  97   TGKFDINTLKQIMTPRCGVPDIIINTN--KTTSFGMISDYTFFKDMPRWQAGTTQLTYAF  154

Query  300  GNPTPF---KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRG  133
             +P P     F   +  AF  W   V   F + T Y +A++K    +++HGD YPFDG G
Sbjct  155  -SPEPRLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPG  213

Query  132  GEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            G   H+F P  G CHFD++E W   G     P     D++SVA+HEIGH
Sbjct  214  GILGHAFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGH  262



>ref|NP_001142095.1| hypothetical protein precursor [Zea mays]
 gb|ACF87634.1| unknown [Zea mays]
 gb|AFW85192.1| hypothetical protein ZEAMMB73_264759 [Zea mays]
Length=370

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 88/178 (49%), Gaps = 18/178 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYA-------HFPGKPKWPDNK  322
            TGV+DA TV+QMM PRCGV DIINGT+ M       +  +A       +FPG P WP ++
Sbjct  109  TGVMDASTVAQMMAPRCGVADIINGTSTMGGGSASASAAHARGRNLFTYFPGSPSWPRSR  168

Query  321  QVLTYGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
            + LTY     +            +  AF  W  A    F  T     AD+    YA DHG
Sbjct  169  KSLTYAVTQTSLTSIDRATLSQVLARAFARWSAATTLTFTETASERDADITIGFYAGDHG  228

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            DG  FDG  G  AH+F P  G  H D+ E W   G          +D++SVA+HEIGH
Sbjct  229  DGEAFDGPLGTLAHAFSPTDGRFHLDAAEAWDASGDVARAASDVAVDLESVAVHEIGH  286



>ref|XP_010524412.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=351

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 91/171 (53%), Gaps = 12/171 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWP-DNKQVLTYG  304
            TG  D+DT++Q+++PRCG PD++      R        +Y +FPG+P+W  D    LTY 
Sbjct  95   TGKPDSDTLTQILLPRCGSPDVVEPET-TRNPAFHTNQKYVYFPGRPRWARDVPMALTYA  153

Query  303  FGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPF  145
            F       +  P  +      AFV W   +   F  TD YA AD+K   Y  DHGDG PF
Sbjct  154  FSQENLIPYLTPTDIRRVFRRAFVKWASVIPVSFLETDDYAFADIKIGFYGGDHGDGEPF  213

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            DG  G  AHSF P+ G  H D  E WA +F        +D++SVA+HEIGH
Sbjct  214  DGVLGVLAHSFSPESGRLHLDVAETWAVDFRAEKSAVAVDLESVAVHEIGH  264



>ref|XP_002311051.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
 gb|EEE88418.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
Length=295

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 90/168 (54%), Gaps = 11/168 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGT---NLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TV+QMM PRCGV DI N T   N  +         Y+ FPG P+W  + + L 
Sbjct  89   TGRLDKRTVNQMMKPRCGVADIFNSTKHHNSSKSSDGVANADYSFFPGAPRW--SSKHLK  146

Query  309  YGFGNPTPFKFFIPV----GLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            Y FG          +      +F  W +   F F+   + A AD+K   Y  DHGD  PF
Sbjct  147  YTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEPF  206

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            DG GG +AH FRP  G+ HFD++E W+   P    LD++SVA+HEIGH
Sbjct  207  DGPGGIFAHGFRPTIGMLHFDADETWSS-NPGSLELDLESVAVHEIGH  253



>ref|XP_002511639.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF50308.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=363

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 91/171 (53%), Gaps = 19/171 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKW-PDNKQVLTYG  304
            TG LD +TVSQ+M PRCGVPD          H+  V+  Y +FPGKP+W  D    LTY 
Sbjct  112  TGELDFNTVSQLMAPRCGVPDT--------GHKLHVSRNYVYFPGKPRWGRDIPMNLTYA  163

Query  303  FGNPTPFKFFIPVGL------AFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPF  145
            F       +     L      AF  W+  +   F + +DY+ AD+K   Y  DHGDG PF
Sbjct  164  FSPENLISYLKISDLQEVFKRAFSRWESVIPVSFIEISDYSYADIKIGFYNGDHGDGEPF  223

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            DG  G  AHSF P+ G  H D+ E WA   E       +D++SVA+HEIGH
Sbjct  224  DGILGVLAHSFSPESGKFHLDAAETWAVDFESEKSKVAVDLESVAVHEIGH  274



>emb|CDX68356.1| BnaA07g23960D [Brassica napus]
Length=373

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 92/177 (52%), Gaps = 17/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM--------RRHRREVAPQYAHFPGKPKWPDN  325
            TG LDA T+  +++PRCG PD++NGT+          R  R      Y  FPG+P+WP +
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  324  KQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            ++ LTY F   NP   +       AF  W +     F   + + ++D+    Y  DHGDG
Sbjct  164  RRDLTYAFDPRNPLTNEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIGH
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGH  280



>gb|AES96374.2| matrix metalloproteinase [Medicago truncatula]
Length=368

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 91/179 (51%), Gaps = 23/179 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------VAPQYAHFPGKPKWPDNK  322
            TG LD  T++ ++ PRCGV DIINGT  M   +             Y+ FPG+P+WP+  
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  321  QVLTYGFG------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDH  163
            Q LTY F       + T   F      AF  W K     F + T Y+S+D+K   Y+ DH
Sbjct  172  QTLTYAFDPSENLDDATKQVF----ANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDH  227

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            GDG  FDG  G  AH+F P  G  H D  E+W   G        + +D++SV +HEIGH
Sbjct  228  GDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGH  286



>ref|XP_002267298.2| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
Length=373

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 88/176 (50%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCG  DI NG++ M   +              Y+ F GKP WP++
Sbjct  112  TGQLDEATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPES  171

Query  324  KQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            K+ LTYGF   N            AF  W       F  +D Y SADL+   Y  DHGDG
Sbjct  172  KRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDG  231

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
              FDG  G  AH+F P  G  H D EENW   G          +D++SVA+HEIGH
Sbjct  232  EAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGH  287



>emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera]
Length=364

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 88/176 (50%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCG  DI NG++ M   +              Y+ F GKP WP++
Sbjct  103  TGQLDXATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPES  162

Query  324  KQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            K+ LTYGF   N            AF  W       F  +D Y SADL+   Y  DHGDG
Sbjct  163  KRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDG  222

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
              FDG  G  AH+F P  G  H D EENW   G          +D++SVA+HEIGH
Sbjct  223  EAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGH  278



>emb|CDY23516.1| BnaC06g24850D [Brassica napus]
Length=373

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 92/177 (52%), Gaps = 17/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM--------RRHRREVAPQYAHFPGKPKWPDN  325
            TG LDA T+  +++PRCG PD++NGT+          R  R      Y  FPG+P+WP +
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  324  KQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            ++ LTY F   NP   +       AF  W +     F   + + ++D+    Y  DHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWA------EFGPPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D++ENW        F      +D++SVA+HEIGH
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGH  280



>ref|XP_004159086.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM  PRCGV D+    ++       E++  YA FPG  KWPD K+ LTY 
Sbjct  94   SGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRHLTYV  153

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG PFDG GG 
Sbjct  154  FTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDGPGGV  213

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G     +++ + ALHE+GH
Sbjct  214  VGHAFAPIDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGH  254



>ref|XP_004142459.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 87/162 (54%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM  PRCGV D+    ++       E++  YA FPG  KWPD K+ LTY 
Sbjct  94   SGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRHLTYV  153

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG PFDG GG 
Sbjct  154  FTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDGPGGV  213

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G     +++ + ALHE+GH
Sbjct  214  VGHAFAPIDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGH  254



>ref|XP_003613416.1| Matrix metalloproteinase-9 [Medicago truncatula]
Length=393

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 91/179 (51%), Gaps = 23/179 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE-------VAPQYAHFPGKPKWPDNK  322
            TG LD  T++ ++ PRCGV DIINGT  M   +             Y+ FPG+P+WP+  
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  321  QVLTYGFG------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDH  163
            Q LTY F       + T   F      AF  W K     F + T Y+S+D+K   Y+ DH
Sbjct  172  QTLTYAFDPSENLDDATKQVF----ANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDH  227

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            GDG  FDG  G  AH+F P  G  H D  E+W   G        + +D++SV +HEIGH
Sbjct  228  GDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGH  286



>ref|XP_008458917.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=295

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR--REVAPQYAHFPGKPKWPDNKQVLTY  307
            +G+LD  T+ Q+  PRCG+PD+I  +N  +      E++  YA FPG  KWPD K+ LTY
Sbjct  95   SGILDQQTLDQIFKPRCGLPDVIMKSNSNKNTEDDLEISSHYALFPGNQKWPDYKRHLTY  154

Query  306  GFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRGG  130
             F N  P  F   V  A   W     F F +  D    D+       DHGDG PFDG GG
Sbjct  155  TFTNNFPIDFVPSVTEAMKEWAAHSLFTFSQAADDQVPDINISFQVGDHGDGVPFDGPGG  214

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
               H+F P  G  H D ++ W+  G     +++ + ALHE+GH
Sbjct  215  VVGHAFAPTDGRLHLDGDDKWSA-GLETQKVNVMNAALHELGH  256



>emb|CBI34986.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 87/164 (53%), Gaps = 5/164 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG+LDA T + M  PRCGVPD   + N TN        +   +A FP  P+WP  +  L 
Sbjct  101  TGILDAPTAALMSRPRCGVPDNPSVTNNTNSHGHSHLNIGTHFAFFPNNPRWPPGQTHLL  160

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGRG  133
            Y   + +  +    VG AF  W    +F F++T D   A+L      R+HGDG PFDG G
Sbjct  161  YVLDSGSHSEAADAVGKAFGAWAAISKFTFEQTSDPTVANLNISFQIREHGDGSPFDGPG  220

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+  P  G  HFD +E W   G   + +D+Q+VA HEIGH
Sbjct  221  GTIAHAAPPTDGRFHFDGDETWV-VGAVANSIDLQTVATHEIGH  263



>gb|KCW49214.1| hypothetical protein EUGRSUZ_K02794, partial [Eucalyptus grandis]
Length=227

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 87/166 (52%), Gaps = 24/166 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  T S+MM PRCGV DIINGT  M                 P+WP +   LTYGF
Sbjct  40   TGTLDPQTTSKMMRPRCGVADIINGTTRM----------------GPRWPASNYHLTYGF  83

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGY--PFDGRGG  130
               TP     PV  AF  W    RF F    D+  A+++      DHGDG    FDG GG
Sbjct  84   LPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDGAHNSFDGPGG  143

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDG---LDIQSVALHEIGH  1
              AH+F P  G+ H+D++E WA    PP G    ++++VALHEIGH
Sbjct  144  TLAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEIGH  187



>ref|XP_004142465.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52409.1| hypothetical protein Csa_5G632080 [Cucumis sativus]
Length=295

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 94/165 (57%), Gaps = 6/165 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREVAPQYAHFPGKPKWPDNKQVL  313
            +GV+D +T++ M +PRCG+PDI++  N+M    + +       +  FP   KWP +K  L
Sbjct  91   SGVIDEETLTLMSLPRCGIPDIMHNINVMDNNVQMNSSSFHSHFTFFPDNLKWPVSKYNL  150

Query  312  TYGFGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGR  136
             Y F +  P  F  PV  A   W     F+F +  +   AD+ F+    +HGDGYPFDG+
Sbjct  151  RYTFLDDFPNDFKEPVMNAMEQWALFSLFRFSEAVEAQEADITFNFVRGNHGDGYPFDGK  210

Query  135  GGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GG  AH+F P  G  HFD +E+WA+ G     +++  VALHE+GH
Sbjct  211  GGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGH  254



>gb|EYU46222.1| hypothetical protein MIMGU_mgv1a027058mg, partial [Erythranthe 
guttata]
Length=284

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 90/164 (55%), Gaps = 6/164 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG+LD DTV Q+M PRCGV D   ++N T L++     +A +Y  FPGKP WP  K+ LT
Sbjct  83   TGMLDGDTVKQIMEPRCGVADNFAVLNKT-LLQSKMPIIASRYTFFPGKPVWPAGKRSLT  141

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            Y F   T       +  A   W     F F   D YA+AD+K     RDHGDG PFDG  
Sbjct  142  YSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGPL  201

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+F P  G  H D +E W + G      D+Q+V LHE+GH
Sbjct  202  GILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGH  244



>ref|XP_004142468.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159089.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52406.1| hypothetical protein Csa_5G631560 [Cucumis sativus]
Length=295

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G++D +T+ QM  PRCGVPD+    ++       E++  YA FP   KWPD K+ LTY 
Sbjct  96   SGIIDQETLDQMFQPRCGVPDVFKFNSSKNLEDDLEMSSHYALFPNNEKWPDYKRHLTYM  155

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   +  A   W     F F + +D  SAD+      +DH DG+ FDG GG 
Sbjct  156  FTNNFPIDFVPSMTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGFAFDGPGGV  215

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D ++ W+  G     +++ + ALHE+GH
Sbjct  216  VGHAFAPTDGRLHLDGDDTWSA-GLEEKKVNVMNAALHELGH  256



>ref|XP_004167464.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52408.1| hypothetical protein Csa_5G632070 [Cucumis sativus]
Length=306

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 83/167 (50%), Gaps = 7/167 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-----YAHFPGKPKWPDNKQV  316
            +GVLD +T+ QM  PRCGV D                 Q     +  FPGK KWP  K  
Sbjct  99   SGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKWH  158

Query  315  LTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDG  139
            LTYGF +  P K    V  AF  W    +F F       +AD+       DHGDG PFDG
Sbjct  159  LTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFDG  218

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGP-PPDGLDIQSVALHEIGH  1
             GG   H+F P  G  HFD++E WAE G    +  D +SVALHEIGH
Sbjct  219  EGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGH  265



>ref|XP_004142466.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=306

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 83/167 (50%), Gaps = 7/167 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-----YAHFPGKPKWPDNKQV  316
            +GVLD +T+ QM  PRCGV D                 Q     +  FPGK KWP  K  
Sbjct  99   SGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKWH  158

Query  315  LTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDG  139
            LTYGF +  P K    V  AF  W    +F F       +AD+       DHGDG PFDG
Sbjct  159  LTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFDG  218

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGP-PPDGLDIQSVALHEIGH  1
             GG   H+F P  G  HFD++E WAE G    +  D +SVALHEIGH
Sbjct  219  EGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGH  265



>ref|XP_010477738.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=380

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 98/183 (54%), Gaps = 23/183 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR--EVA-----------PQYAHFPGKP  340
            TGVLD  T+  +M+PRCG PD++NGT+ M   RR  EV+            +Y+ FP +P
Sbjct  106  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHSVKRYSLFPAEP  165

Query  339  KWPDNKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYAR  169
            +WP N++ LTY F   N    +       AF  W +     F R + + ++D+    Y+ 
Sbjct  166  RWPSNRRDLTYAFDPRNKLTEEVKTVFSRAFARWAEVTPLTFTRVESFRTSDIFIGFYSG  225

Query  168  DHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDG-------LDIQSVALHE  10
            +HGDG PFDG     AH+F P  G  H D+EENW       DG       +D++SVA+HE
Sbjct  226  EHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISREGGDGVNSVTEAIDLESVAVHE  285

Query  9    IGH  1
            IGH
Sbjct  286  IGH  288



>gb|EYU46221.1| hypothetical protein MIMGU_mgv1a010535mg [Erythranthe guttata]
Length=309

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 90/164 (55%), Gaps = 6/164 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG+LD DTV Q+M PRCGV D   ++N T L++     +A +Y  FPGKP WP  K+ LT
Sbjct  108  TGMLDGDTVKQIMEPRCGVADNFAVLNKT-LLQSKMPIIASRYTFFPGKPVWPAGKRSLT  166

Query  309  YGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            Y F   T       +  A   W     F F   D YA+AD+K     RDHGDG PFDG  
Sbjct  167  YSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGPL  226

Query  132  GEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G  AH+F P  G  H D +E W + G      D+Q+V LHE+GH
Sbjct  227  GILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGH  269



>ref|XP_008458910.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=296

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM----RRHRREVAPQYAHFPGKPKWPDNKQVL  313
            +GVLD +T++ M +PRCG+ DI++  N+M    + +       Y   PG PKWP +K  L
Sbjct  92   SGVLDKETLTLMSLPRCGISDIVHNNNVMDNNIQMNSSSFHSHYTFLPGNPKWPISKYNL  151

Query  312  TYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFDGR  136
             Y F    P  F  PV  A   W     F+F  T      D+ F+    +HGDG+PFDG+
Sbjct  152  KYTFLEGFPNDFKEPVMNAMDQWALFSLFRFSETIGGEEVDITFNFVRGNHGDGHPFDGK  211

Query  135  GGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GG  AH+F P  G  HFD +E+WA+ G     +++  VALHE+GH
Sbjct  212  GGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGH  255



>ref|XP_011003818.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 90/174 (52%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            TG LD+DT+ ++M+PRCGVPD IN     +  R E             Y+ F G P+WP 
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  327  NKQVLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDH  163
            +K  LTY F +        +       AF  W    +F F      S AD+     + DH
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDG PFDG G   AH+F P  G  H+D++E W+   P  D +D++SVA+HEIGH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPSTDEVDLESVAVHEIGH  270



>ref|XP_003560867.1| PREDICTED: metalloendoproteinase 1-like [Brachypodium distachyon]
Length=383

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 90/176 (51%), Gaps = 19/176 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR----HRREVAPQYAHFPGKPKWPDNKQVL  313
            TG LD  TV++MM PRCGV DIINGT+ M +    H R +   Y++FPG P WP +K+ L
Sbjct  120  TGQLDPSTVTKMMSPRCGVADIINGTSTMAKSASIHGRNL---YSYFPGSPSWPRSKKSL  176

Query  312  TYGFGNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS--ADLKFHLYARDHGDG  154
             Y     +               AF  W +A    F  T  A+  AD+    +  +HGDG
Sbjct  177  KYAITATSATTIDRATLSQVFARAFARWSEATTLNFTETTDAAGDADITIGFHGGEHGDG  236

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
              FDG  G  AH+F P  G  H D+ E W   G        D +D++SVA+HEIGH
Sbjct  237  EAFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRAKADDAVDLESVAVHEIGH  292



>ref|XP_010434790.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 89/174 (51%), Gaps = 22/174 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TVS M +PRCGV D   IIN   +           Y +F GKPKW  N+  LT
Sbjct  114  TGRLDTSTVSLMSLPRCGVSDTHMIINDEGI------HTTAHYTYFNGKPKW--NRDTLT  165

Query  309  YGFGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            Y         +     +      AF HW   +   F+  D + +ADLK   Y+ DHGDG 
Sbjct  166  YAISKTHKLDYLTSEDVKTVFRRAFSHWASVIPVSFEEVDDFTTADLKIGFYSGDHGDGL  225

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPD-GLDIQSVALHEIGH  1
            PFDG  G  AH+F P+ G  HFD+ E W    +F   P+  +D++SVA HEIGH
Sbjct  226  PFDGVLGTLAHAFAPENGRLHFDAGETWVADDDFKRSPEVAVDLESVATHEIGH  279



>ref|XP_010414620.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=369

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 93/172 (54%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-EVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG LD+ T+ Q++ PRCG PD+I+G + M   R+     +Y+ FPGKP+WP  K+ LTY 
Sbjct  111  TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  170

Query  303  F--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            F   N    +       AF  W +   F F R++    AD+    ++ +HGDG PFDG  
Sbjct  171  FVPQNNLTDEVKRVFARAFTRWSEVTPFNFTRSESLVGADIVIGFFSGEHGDGEPFDGAM  230

Query  132  GEYAHSFRPKKGICHFDSEENWA--------EFGPPPDGLDIQSVALHEIGH  1
            G  AH+  P  G+ H DS+E+W            P    +D++SV +HEIGH
Sbjct  231  GTLAHASSPPTGMLHLDSDEDWLISDGGISRRILPVTSVVDLESVVVHEIGH  282



>ref|XP_010043822.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=499

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 88/176 (50%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  T++Q++ PRCG PDI+NG+  M   + E            Y  FPG P+WPD 
Sbjct  236  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  295

Query  324  KQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            K  LTY F   N            AF  W       F  TD Y +AD+K   ++ DHGDG
Sbjct  296  KSDLTYAFLPANQLSDDEKAVFSRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHGDG  355

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
              FDG  G  AH+F P  G  H D +ENW   G          +D++SVA+HEIGH
Sbjct  356  EAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGH  411



>ref|XP_010053954.1| PREDICTED: metalloendoproteinase 1 [Eucalyptus grandis]
 gb|KCW78330.1| hypothetical protein EUGRSUZ_D02504 [Eucalyptus grandis]
Length=368

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 95/172 (55%), Gaps = 21/172 (12%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNK-QVLTYG  304
            TG LD +T+ Q++ PRCGV D  +G ++ RR        Y HFPGKP+W  +K  VLTY 
Sbjct  109  TGKLDINTMKQILEPRCGVSDFAHGKHVTRR--------YVHFPGKPRWNRHKPIVLTYA  160

Query  303  FGNPTPFKFFIPVG-------LAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYP  148
            F +P  F  ++           AF  W   +   F +  DY  AD+K   Y+ DHGDG P
Sbjct  161  F-SPDHFINYLTSNDVRRVFKRAFARWAAVIPVSFREANDYGFADIKIGFYSGDHGDGQP  219

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            FDG  G  AHSF P+ G  H D+ E WA +F        +D++SVA+HEIGH
Sbjct  220  FDGVLGILAHSFSPESGKLHLDAAERWAVDFSTEESKVAVDLESVAVHEIGH  271



>gb|KDO75343.1| hypothetical protein CISIN_1g043086mg [Citrus sinensis]
Length=257

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 85/162 (52%), Gaps = 22/162 (14%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG +D  TVS M  PRCGVPD+INGT  M+         Y  +PG+PKWP  KQ+++   
Sbjct  108  TGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISCA-  166

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGYPFDGRG--GE  127
                    F+P            R      DY +AD+K      DHGDGYPFDG G    
Sbjct  167  --------FLP----------GTRTDVQEPDYDAADVKISFQRGDHGDGYPFDGPGPYNL  208

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             AHSF P  G  H+D +ENW   G  P  +D+Q+VALHE+ H
Sbjct  209  LAHSFPPTDGRFHYDGDENWT-VGAVPGAVDMQTVALHELRH  249



>ref|XP_006647869.1| PREDICTED: metalloendoproteinase 1-like [Oryza brachyantha]
Length=373

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 89/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ----YAHFPGKPKWPDNKQVL  313
            TG LD  TV QM++PRCGV D+INGT+ M R+    A +    Y++FPG P+WP  ++ L
Sbjct  111  TGELDTTTVDQMVVPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPRWPPFRRNL  170

Query  312  TYGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGDGY  151
             Y     +               AF  W  A   +F     AS AD+    Y+ DHGDG 
Sbjct  171  RYAITATSATSIDRATLSAVFARAFSRWAAATTLQFTEVASASNADITIGFYSGDHGDGE  230

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP------DGLDIQSVALHEIGH  1
             FDG  G  AH+F P  G  H D+ E W   G           +D++SVA+HEIGH
Sbjct  231  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVANGDVSTASSFGTAVDLESVAVHEIGH  286



>ref|XP_002319607.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
 gb|EEE95530.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
Length=312

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 91/175 (52%), Gaps = 16/175 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LD+DT+ ++M+PRCGVPD IN  +  ++  R               Y+ F G P+WP
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHVDTSKQAGRTEHDSKSSKFHTVSHYSFFGGTPRWP  157

Query  330  DNKQVLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARD  166
             +K  LTY F +        +       AF  W    +F F      S AD+     + D
Sbjct  158  SSKFHLTYTFSSSVQVIDMQELRSACSRAFQKWADVTQFTFQEASEGSQADIVIGFQSGD  217

Query  165  HGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            HGD YPFDG G   AH+F P  G  H+D++E W+   P  D +D++SVA+HEIGH
Sbjct  218  HGDRYPFDGPGRILAHAFAPTDGRFHYDADEKWST-NPSADEVDLESVAVHEIGH  271



>ref|XP_011003815.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 90/174 (52%), Gaps = 15/174 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE---------VAPQYAHFPGKPKWPD  328
            TG LD+DT+ ++M+PRCGVPD IN     +  R E             Y+ F G P+WP 
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  327  NKQVLTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDH  163
            +K  LTY F +        +       AF  W    +F F      S AD+     + DH
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  162  GDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            GDG PFDG G   AH+F P  G  H+D++E W+   P  D +D++SVA+HEIGH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPRTDEVDLESVAVHEIGH  270



>ref|XP_008458715.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=317

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 88/167 (53%), Gaps = 8/167 (5%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE------VAPQYAHFPGKPKWPDNKQ  319
            +G+LD++T++Q+  PRCGV D+I      + ++            +  F G  KWP +K 
Sbjct  112  SGILDSNTLAQIAKPRCGVQDVIKNKKRNQNYKNNGHIHFHKVSHFTFFEGNLKWPSSKF  171

Query  318  VLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFD  142
             L+YGF    P +   PV  AF  W     FKF    DY  AD+K      +HGD  PFD
Sbjct  172  HLSYGFLPNYPIEAIKPVSRAFSKWSLNTHFKFSHVVDYRKADIKISFERGEHGDNAPFD  231

Query  141  GRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            G GG  AH++ P  G  HFD +E W+  G      D+++VALHEIGH
Sbjct  232  GVGGVLAHAYPPTDGRLHFDGDEAWS-VGAISGYFDVETVALHEIGH  277



>emb|CDP00221.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 90/177 (51%), Gaps = 17/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--------HRREVAPQYAHFPGKPKWPDN  325
            TG LDA T+  +  PRCG PDI+NGT  M           R      Y+ FPG P+WP  
Sbjct  115  TGELDAPTLQHITRPRCGNPDIVNGTTSMNSGKVANANSLRPHTVAHYSFFPGMPRWPAG  174

Query  324  KQVLTYGFGNPTPFKFFI--PVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
            K  LTY F      +  +      AF  W +     F  T  ++ AD+K  +++ DHGDG
Sbjct  175  KTDLTYAFLPENQVEDVVRRVFANAFDRWSEVTTLNFTETASFSLADIKIGIFSGDHGDG  234

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPP---DGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D +ENW    +F   P     +D++SVA+HEIGH
Sbjct  235  EPFDGVLGTLAHAFSPPSGRLHLDGDENWVIDGDFFSAPSLASAVDLESVAVHEIGH  291



>ref|XP_010264331.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=359

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 89/171 (52%), Gaps = 17/171 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQV-LTYG  304
            TG LD++T+SQ+M PRCGV D  + T      R      YA+F G+P+W     V LTY 
Sbjct  107  TGKLDSNTLSQIMSPRCGVRDTGHVTQFHATRR------YAYFSGQPRWVRKTPVTLTYA  160

Query  303  FGNPTPFKFFIP------VGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            F       +         V  AF  W   +  +F    DY SAD+K   Y  DHGDG PF
Sbjct  161  FSPENTISYLTTEEIRAVVDRAFTRWAAVIPLRFSEIEDYVSADIKIGFYGGDHGDGEPF  220

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            DG  G  AH+F P  G  HFD+ E WA +FG       +D++SVA HEIGH
Sbjct  221  DGVLGVLAHAFSPTSGKLHFDAAERWAVDFGVERSKVAVDLESVATHEIGH  271



>emb|CDY30915.1| BnaC09g14910D [Brassica napus]
Length=353

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 93/172 (54%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-EVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG LDA T+ Q++ PRCG PD+I+GT+ M   ++     +Y+ FPGKP+WP   + L+Y 
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSYA  165

Query  303  F--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            F   N    +       AF  W       F R++    AD+    +A DHGDG PFDG  
Sbjct  166  FFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGPM  225

Query  132  GEYAHSFRPKKGICHFDSEENWAEFG--------PPPDGLDIQSVALHEIGH  1
            G  AH+  P  G+ H D+EE+W   G        P    +D++SVA+HEIGH
Sbjct  226  GTLAHASSPPTGMFHLDNEEDWLISGEDMSRQILPVTSVVDLESVAVHEIGH  277



>gb|AET01165.2| matrix metalloproteinase [Medicago truncatula]
Length=352

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 94/173 (54%), Gaps = 13/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ--YAHFPGKPKWP-DNKQVLT  310
            TG LD++TVSQM+ PRCGVPD     +    H+  +  +  + +FPGKP+W  D    LT
Sbjct  95   TGKLDSNTVSQMITPRCGVPDTTKTHHYHNHHQNHIHNKTNFVYFPGKPRWSRDMPMTLT  154

Query  309  YGFG------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
            YGF       N +  +       AF  W   +   F +  DY  AD+K   Y+ DHGDG 
Sbjct  155  YGFSSDYMIHNLSIQEIREAFKRAFSRWSSVIPVSFVESEDYGFADIKIGFYSGDHGDGE  214

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            PFDG  G  AHSF P+ G  H D+ E WA +FG       +D++SVA HEIGH
Sbjct  215  PFDGVLGVLAHSFSPEIGRLHLDAAETWAVDFGVTKSEVAIDLESVATHEIGH  267



>ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=373

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 90/178 (51%), Gaps = 18/178 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LDA T+  +++PRCG PD++NGT+ MR  +                Y+ FP +P+WP
Sbjct  108  TGELDAPTLKHIVLPRCGNPDVVNGTSTMRSGKPSNRYSANSTIHTVAHYSFFPNRPRWP  167

Query  330  DNKQVLTYGFGNPTPFKFFIP--VGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHG  160
              +  LTY F         +      AF  W +     F  T  +  ADL+   ++ DHG
Sbjct  168  PGRTRLTYAFLPENQLSDVVKGVFARAFERWSEVTPLTFTETSSFYGADLRIGFFSGDHG  227

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            DG PFDG  G  AH+F P  G  H D +ENW   G      P   +D++SVA+HEIGH
Sbjct  228  DGEPFDGVLGTLAHAFSPPAGRFHLDGDENWVIDGDFLNSSPMSAVDLESVAVHEIGH  285



>ref|XP_007157519.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
 gb|ESW29513.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
Length=377

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 89/175 (51%), Gaps = 15/175 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR-RHRREVAPQ------YAHFPGKPKWPDNK  322
            TG LD  T+ Q++ PRCGV D+INGT  M  +      P+      Y+ F G P+WP   
Sbjct  117  TGELDDATMQQIVRPRCGVADVINGTTTMNGKSNTTTTPKFHTVAHYSFFDGMPRWPQGT  176

Query  321  QVLTYGFGNPTPFKFFIP--VGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
            + LTY F         +      AF  W +     F + + YA AD+    Y+ DHGDG 
Sbjct  177  EELTYAFEPDNGLDDTVKGVFSNAFKRWAEVTTISFSEASSYAVADITIGFYSGDHGDGE  236

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G+ H D  E+W   G        + +D++SVA+HEIGH
Sbjct  237  PFDGVLGTLAHAFSPTNGMFHLDEAEDWVATGDVTEASMSNAVDLESVAVHEIGH  291



>gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana]
Length=364

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 91/179 (51%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAH-------FPGKPKWPDNK  322
            TGVLDA T+  ++ PRCG  D++NGT+ M   +     Q  H       FPG+P+WP++ 
Sbjct  101  TGVLDAPTIEHLIRPRCGNADVVNGTSTMNSGKPSAGSQNIHTVAHFSFFPGRPRWPESN  160

Query  321  QVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
            + LTY F   N            AF  W +     F +   + SAD+K   +A DH DG 
Sbjct  161  RDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLTFTEIASFQSADIKIGFFAGDHNDGE  220

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPP---------DGLDIQSVALHEIGH  1
            PFDG  G  AH+F P  G  H D +ENW   G P            +D++SVA+HEIGH
Sbjct  221  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGAPIVEGNFFSILSAVDLESVAVHEIGH  279



>gb|KDP28814.1| hypothetical protein JCGZ_14585 [Jatropha curcas]
Length=360

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 87/171 (51%), Gaps = 19/171 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNK-QVLTYG  304
            TG LD  T+SQMM PRCGVPD +         +   +  Y +FPGKP+W  +    LTY 
Sbjct  113  TGKLDVLTLSQMMAPRCGVPDTVQ--------KLHFSKNYVYFPGKPRWARHIPMTLTYA  164

Query  303  FGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            F       +     +      AF  W+  +   F  T DY  AD+K   Y+ DHGDG PF
Sbjct  165  FSPVNRISYLSLADIKDVFKRAFGRWESVIPVSFIETNDYGFADIKIGFYSGDHGDGEPF  224

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            DG  G  AHSF P+ G  H D+ E W    E       +D++SVA+HEIGH
Sbjct  225  DGALGVLAHSFSPESGKFHLDASETWTVDFEMEKSKVAVDLESVAIHEIGH  275



>ref|XP_006371427.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
 gb|ERP49224.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
Length=308

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 93/170 (55%), Gaps = 12/170 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIING-----TNLMRRHRREVAPQYAHFPGKPKWPDNKQV  316
            TG LD+ T+ QMM+PRCG+PDIIN       +   +H +     +  F G  KWP +K  
Sbjct  99   TGNLDSSTIQQMMIPRCGMPDIINTPSTKPNSTTSKHNKFHMVVHYDF-GTRKWPPSKYA  157

Query  315  LTYGFGNPTPF----KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
            LTY FG+                AF  W K   F F + TD ASAD+    ++ DHGD  
Sbjct  158  LTYRFGSGVQVVGSDTLRSVCSNAFQTWAKVSPFTFQEATDGASADIVIEFFSGDHGDQD  217

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG G + AH F P+ G  H+D++ENW+   P  D  D++SV +HEIGH
Sbjct  218  PFDGPGKQLAHGFFPQDGRLHYDADENWST-DPAMDQTDLESVTVHEIGH  266



>ref|XP_010440122.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=365

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 89/174 (51%), Gaps = 22/174 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TVS M +PRCGV D   IIN   +           Y +F GKPKW  N+  LT
Sbjct  115  TGRLDTSTVSLMSLPRCGVSDTHMIINDEGI------HTTAHYTYFNGKPKW--NRDTLT  166

Query  309  YGFGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            Y         +     +      AF HW   +   F+  D + +ADLK   Y+ +HGDG 
Sbjct  167  YAISKTHKLDYLTSEDVKTVFRRAFSHWASVIPVSFEEVDDFTTADLKIGFYSGEHGDGL  226

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPD-GLDIQSVALHEIGH  1
            PFDG  G  AH+F P+ G  HFD+ E W    +F   P+  +D++SVA HEIGH
Sbjct  227  PFDGVLGTLAHAFAPENGRLHFDAGETWVVDDDFKRSPEVAVDLESVATHEIGH  280



>dbj|BAJ94792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92632.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 86/172 (50%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVA---PQYAHFPGKPKWPDNKQVLT  310
            TGVLD  TVSQM+ PRCGV D+INGT+ M R+          Y +FPG P WP  ++ L 
Sbjct  109  TGVLDPPTVSQMVAPRCGVADVINGTSTMDRNASAAGHGRHLYTYFPGGPMWPPFRRELR  168

Query  309  YGFGNPTPFK-----FFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYP  148
            Y                     AF  W  A   +F +    + AD+    YA  HGDG  
Sbjct  169  YAITATAATSIDRATLGAVFARAFARWSDATTLRFAEAASESDADITIGFYAGSHGDGEA  228

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENW---AEFGPPPDGLDIQSVALHEIGH  1
            FDG  G  AH+F P  G  H D+ E W    + G  P  +D++SVA+HEIGH
Sbjct  229  FDGPLGTLAHAFSPTDGRFHLDAAEAWVADGQGGDAPGAVDLESVAVHEIGH  280



>ref|XP_006838196.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
 gb|ERN00765.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
Length=355

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 90/170 (53%), Gaps = 16/170 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD DT++Q+M PRCG+PD   G         EV   YA FPG PKWP  K+ LTYG 
Sbjct  109  TGRLDPDTLAQVMTPRCGMPDKGLGGPF-----HEVG-HYAFFPGVPKWPRGKKALTYGI  162

Query  300  GNPTPFKFF------IPVGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPFD  142
                   +       + +  AF  W   +   F  T DY  AD+K   ++ DHGDG PFD
Sbjct  163  SPTNMVNYLDMEDVRMALSRAFDRWSNVIPLNFTETQDYYGADIKIGFFSGDHGDGQPFD  222

Query  141  GRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            G  G  AH+F P  G  H D+ E W+ +FG       +D++SVA HEIGH
Sbjct  223  GVLGILAHAFSPSNGNFHLDASETWSTDFGVQKSRVAIDLESVATHEIGH  272



>ref|XP_011042944.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=373

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 92/177 (52%), Gaps = 20/177 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMR---------RHRREVAPQYAHFPGKPKWPD  328
            TG LD  TV+ +++PRCG PDI+NGT  M          RH   V+  Y+ F G P+W  
Sbjct  114  TGQLDDQTVNHIVLPRCGNPDIVNGTTSMNSGKTHNTSSRHVHTVS-HYSFFTGMPRW--  170

Query  327  NKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGD  157
             K+ LTY F  GN    +       AF  W   +   F +TD   +AD+    Y+ DHGD
Sbjct  171  RKKALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQTDSINTADIGIGFYSGDHGD  230

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            G PFDG  G  AHSF P  G  H D +E+W   G          +D++SVA+HEIGH
Sbjct  231  GEPFDGVLGTLAHSFSPPSGQFHLDGDESWVVTGDVRTSSLTTAVDLESVAVHEIGH  287



>ref|XP_008389591.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=387

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 90/176 (51%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--------HRREVAPQYAHFPGKPKWPDN  325
            TG LD  T+  ++ PRCG PDI+NGT  M           +      Y+ FPG P WP+N
Sbjct  111  TGELDGPTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYSFFPGTPVWPEN  170

Query  324  KQVLTYGFGNPTPFKFFIPVGL--AFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDG  154
            ++ LTY F +       +      AF  W +A    F  T  + SAD+K   +  DHGDG
Sbjct  171  RRDLTYAFVSENELSDTVKAVFVGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDG  230

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D+EENW   G          +D++SVA+HEIGH
Sbjct  231  EPFDGVLGTLAHAFSPPSGRFHLDAEENWVITGDISKTSVTSAVDLESVAVHEIGH  286



>ref|XP_010449738.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 88/174 (51%), Gaps = 22/174 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TV+ M +PRCGV D   IIN               Y +F GKPKW  N+  LT
Sbjct  114  TGRLDTSTVTLMSLPRCGVSDTHMIINDEGF------HTTAHYTYFNGKPKW--NRDTLT  165

Query  309  YGFGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            Y         +     +      AF HW   +   F+  D + +ADLK   Y+ DHGDG 
Sbjct  166  YAISKTHKLDYLTSEDVQTVFRRAFSHWASVIPVSFEEVDDFTAADLKIGFYSGDHGDGL  225

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPD-GLDIQSVALHEIGH  1
            PFDG  G  AH+F P+ G  HFD+ E W    +F   PD  +D++SVA HEIGH
Sbjct  226  PFDGVLGTLAHAFAPENGRLHFDAGEIWVVDDDFKRSPDVAVDLESVATHEIGH  279



>ref|XP_003626689.1| Matrix metalloproteinase-27 [Medicago truncatula]
Length=379

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 94/173 (54%), Gaps = 13/173 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ--YAHFPGKPKWP-DNKQVLT  310
            TG LD++TVSQM+ PRCGVPD     +    H+  +  +  + +FPGKP+W  D    LT
Sbjct  95   TGKLDSNTVSQMITPRCGVPDTTKTHHYHNHHQNHIHNKTNFVYFPGKPRWSRDMPMTLT  154

Query  309  YGFG------NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGY  151
            YGF       N +  +       AF  W   +   F +  DY  AD+K   Y+ DHGDG 
Sbjct  155  YGFSSDYMIHNLSIQEIREAFKRAFSRWSSVIPVSFVESEDYGFADIKIGFYSGDHGDGE  214

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            PFDG  G  AHSF P+ G  H D+ E WA +FG       +D++SVA HEIGH
Sbjct  215  PFDGVLGVLAHSFSPEIGRLHLDAAETWAVDFGVTKSEVAIDLESVATHEIGH  267



>ref|XP_007052204.1| Matrixin family protein [Theobroma cacao]
 gb|EOX96361.1| Matrixin family protein [Theobroma cacao]
Length=361

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 89/171 (52%), Gaps = 17/171 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDN-KQVLTYG  304
            TG LD DT+SQ++ PRCGVPD  +   L           Y +FPGKP+W       LTYG
Sbjct  115  TGKLDFDTLSQILAPRCGVPDAGSSPAL------HATKNYVYFPGKPRWARRIPMTLTYG  168

Query  303  FGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPF  145
            F      ++     +      AF  W+  +  +F  TD Y  AD+K   YA DHGDG PF
Sbjct  169  FSPDYMIRYLSLSDIRKTFKGAFSKWESVIPVRFVETDDYGFADIKIGFYAGDHGDGEPF  228

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            DG  G   HSF P+ G  H D+ E WA   +       +D++SVA+HEIGH
Sbjct  229  DGVLGILGHSFSPESGKLHLDAAETWAVDFQVEKSKVAIDLESVAVHEIGH  279



>ref|XP_008465718.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=362

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 92/171 (54%), Gaps = 11/171 (6%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----VAPQYAHFPGKPKWPDNKQVL  313
            TG+LD  T++Q+ +PRCG+PDIIN +  M   R          Y  FPG+P WP +++ L
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGRHSPHFHSVSHYTFFPGRPIWPAHRRDL  160

Query  312  TYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFD  142
            TY F   NP   +       AF  W       F   + + +AD++   YA DHGDG PFD
Sbjct  161  TYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRTADIRIGFYAGDHGDGEPFD  220

Query  141  GRGGEYAHSFRPKKGICHFDSEENWAEFG----PPPDGLDIQSVALHEIGH  1
            G  G  AH+F P  G  H D +E+W   G     P   +D++SVA+HEIGH
Sbjct  221  GVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGH  271



>gb|ABK95950.1| unknown [Populus trichocarpa]
Length=304

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 7/166 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+LD  T+ QMM+PRCG+ DI          +  +   Y  F G PKW  +K  LTY F
Sbjct  99   TGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYTF  158

Query  300  GNP----TPFKFFIPV-GLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDG  139
            G+             V   AF  W       F + +D ASA++    Y  DHGDGYPFDG
Sbjct  159  GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPFDG  218

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             G   AH+F P+ G  H+D++E W+   P  D +D++SVA+HEIGH
Sbjct  219  PGKILAHAFSPENGRFHYDADEKWST-NPAMDQIDLESVAVHEIGH  263



>ref|XP_006376166.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
 gb|ERP53963.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
Length=304

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 89/166 (54%), Gaps = 7/166 (4%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG+LD  T+ QMM+PRCG+ DI          +  +   Y  F G PKW  +K  LTY F
Sbjct  99   TGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYTF  158

Query  300  GNP----TPFKFFIPV-GLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDG  139
            G+             V   AF  W       F + +D ASA++    Y  DHGDGYPFDG
Sbjct  159  GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPFDG  218

Query  138  RGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
             G   AH+F P+ G  H+D++E W+   P  D +D++SVA+HEIGH
Sbjct  219  PGKILAHAFSPENGRFHYDADEKWST-NPAMDQIDLESVAVHEIGH  263



>gb|KFK40830.1| hypothetical protein AALP_AA2G047000 [Arabis alpina]
Length=364

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 92/172 (53%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR-EVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG LDA T+ Q++ PRCG PD+I+G + M   R+     +Y+ FPGKP+WP  K+ LTY 
Sbjct  105  TGNLDASTLRQIVKPRCGNPDMIDGVSEMNAGRKLRTTERYSFFPGKPRWPKRKRDLTYA  164

Query  303  F--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            F   N    +       AF  W +     F R++    AD+    +A +HGDG PFDG  
Sbjct  165  FVPQNNLTDEVKRVFARAFTRWSEVTPLNFTRSESILRADIVIGFFAGEHGDGEPFDGAM  224

Query  132  GEYAHSFRPKKGICHFDSEENWA--------EFGPPPDGLDIQSVALHEIGH  1
            G  AH+  P  G+ H D +E+W            P    +D++SVA+HEIGH
Sbjct  225  GTLAHASSPPTGMFHLDGDEDWLISEDEISRGILPVTSVVDLESVAVHEIGH  276



>ref|XP_009136800.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=364

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 87/170 (51%), Gaps = 18/170 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TV+ M  PRCGV D     N M      V  +Y +F GKPKW  N+  LTY F
Sbjct  119  TGRLDTSTVTLMSSPRCGVSDTHMINNGM-----HVTARYTYFGGKPKW--NRDTLTYAF  171

Query  300  GN------PTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFD  142
                    PT     +    AF  W   +   F   D Y +A+LK   +A DHGDG PFD
Sbjct  172  SETHKLDYPTSDNVKMVFRRAFGRWASVIPVSFKEVDDYTTANLKIGFFAGDHGDGKPFD  231

Query  141  GRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            G  G  AH+F PK G  HFD+ E W    +FG     +D++SVA HEIGH
Sbjct  232  GVLGTLAHAFAPKNGRVHFDAAETWVVNDDFGSKV-AVDLESVATHEIGH  280



>ref|XP_004297678.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 90/177 (51%), Gaps = 18/177 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLM--------RRHRREVAPQYAHFPGKPKWPDN  325
            TG LD  T++ ++ PRCG PDI+NGT  M           +      Y+ FPG P WP  
Sbjct  110  TGELDDQTINHLVRPRCGNPDIVNGTTTMHSGKPVTFNNSKLHTVGHYSFFPGTPVWPTG  169

Query  324  KQVLTYGF---GNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGD  157
            ++ LT+ F      +     + VG AF  W   +   F + T Y SAD+K   Y  DHGD
Sbjct  170  RRDLTFAFLPDNELSDEAKSVFVG-AFQKWSTVIPMTFTETTSYYSADIKIGFYVGDHGD  228

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            G  FDG  G  AH+F P  G+ H D +ENW   G          +D++SVA+HEIGH
Sbjct  229  GEAFDGVLGTLAHAFSPPSGLFHLDGDENWVIGGDISTSTVTSAIDLESVAVHEIGH  285



>ref|NP_001151749.1| metalloendoproteinase 1 precursor [Zea mays]
 gb|ACG44214.1| metalloendoproteinase 1 precursor [Zea mays]
Length=365

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 87/177 (49%), Gaps = 20/177 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR------HRREVAPQYAHFPGKPKWPDNKQ  319
            TG LD  TVSQM+ PRCGV D+INGT+ M R      H R +   YA+FPG P WP  ++
Sbjct  104  TGALDPSTVSQMVAPRCGVADVINGTSTMARSSSADAHGRHL---YAYFPGGPTWPPFRR  160

Query  318  VLTYGFGNPTPFKFFIPV-----GLAFVHWQKAVRFKFDRTDYAS-ADLKFHLYARDHGD  157
             L Y     +               AF  W  A   +F  T   S AD+    Y+  HGD
Sbjct  161  DLKYAITATSAASIDRSTLSDVFARAFSRWAAATNLRFAETASESDADITIGFYSGSHGD  220

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENW-----AEFGPPPDGLDIQSVALHEIGH  1
            G PFDG  G  AH+F P  G  H D+ E W              +D++SVA+HEIGH
Sbjct  221  GEPFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGSDVSRSSATGAVDLESVAVHEIGH  277



>ref|XP_010910625.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=365

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 94/172 (55%), Gaps = 19/172 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQV-LTYG  304
            T  LDA T+SQ+M PRCGVPD +N       +R     ++A FPG+P+W  +  + LTY 
Sbjct  112  TSKLDARTLSQIMTPRCGVPDSVN------LNRTGGVQRFAFFPGEPRWVRSGPLTLTYA  165

Query  303  FGNPTPFKFFIPVG-------LAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYP  148
             G PT    +IP          AF  W   +  +F+ T +Y +AD+K   Y+ DHGDG P
Sbjct  166  IG-PTDAVDYIPRAEVEAAFRRAFRRWASVIPVRFEETTEYEAADVKVGFYSGDHGDGEP  224

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            FDG  G  AH+F P  G+ H DS E WA           +D++SVA HEIGH
Sbjct  225  FDGVLGVLAHAFSPDSGLLHLDSAERWAVDFRVEGSKVAVDLESVATHEIGH  276



>ref|XP_007216020.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
 gb|EMJ17219.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
Length=296

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 86/170 (51%), Gaps = 30/170 (18%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE----------VAPQYAHFPGKPKWP  331
            TG LDA TVS MMMPRCGV DIINGT+ MR  ++               Y  F G PKWP
Sbjct  106  TGALDAKTVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  330  DNKQVLTYGFGNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYASADLKFHLYARDHGDGY  151
             +K  LTY F   TP +   P                      + DL    +  +HGDG 
Sbjct  166  ASKYHLTYAFLQDTPAEATGPSN-------------------QNPDLTVSFHRGNHGDGA  206

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            PFDG GG  AH+F P  G  H+D++E ++  G      D+++VALHEIGH
Sbjct  207  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGH  255



>ref|XP_010510985.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=367

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQ-YAHFPGKPKWPDNKQVLTYG  304
            TG LD+ T+ Q++ PRCG PD+I+G + M   R+  A + Y+ FPGKP+WP  K+ LTY 
Sbjct  108  TGKLDSSTLRQIVKPRCGNPDMIDGFSEMNGGRKLRATERYSFFPGKPRWPKRKRYLTYA  167

Query  303  FGNPTPFKFFIP--VGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            F         I      AF  W +     F R++    AD+    ++ +HGDG PFDG  
Sbjct  168  FVTQNNLTEEIKRVFARAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  227

Query  132  GEYAHSFRPKKGICHFDSEENWA--------EFGPPPDGLDIQSVALHEIGH  1
            G  AH+  P  G+ H DS+E+W                 +D++SV +HEIGH
Sbjct  228  GTLAHASSPPTGMLHLDSDEDWLISDGGISRRISSVTSVVDLESVVVHEIGH  279



>ref|XP_002870142.1| hypothetical protein ARALYDRAFT_493212 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46401.1| hypothetical protein ARALYDRAFT_493212 [Arabidopsis lyrata subsp. 
lyrata]
Length=362

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 87/174 (50%), Gaps = 22/174 (13%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPD---IINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLT  310
            TG LD  TVS M +PRCGV D   IIN   +           Y +F GKPKW  N+  LT
Sbjct  113  TGRLDTSTVSLMSLPRCGVSDTHMIINNGVI------HTTAHYTYFNGKPKW--NRDTLT  164

Query  309  YGFGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGY  151
            Y         +     +      AF  W   +   F+  D +++ADLK   YA DHGDG 
Sbjct  165  YAISKTHKLDYLTSEDVKTVFRRAFSQWSSVIPVSFEEVDDFSAADLKIGFYAGDHGDGL  224

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWA---EF-GPPPDGLDIQSVALHEIGH  1
            PFDG  G  AH+F P+ G  H D+ E W    +F G     +D++SVA HEIGH
Sbjct  225  PFDGVLGTLAHAFAPENGRLHLDAAETWVVDDDFKGSSEVAVDLESVATHEIGH  278



>ref|XP_008244963.1| PREDICTED: metalloendoproteinase 1 [Prunus mume]
Length=425

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 87/176 (49%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR--------REVAPQYAHFPGKPKWPDN  325
            TG LD  T+  ++ PRCG PDI+NGT  M   +              Y+ FPG P WP N
Sbjct  160  TGELDEPTIQHLVKPRCGNPDIVNGTTTMNSGKPSSSNTSNLHTVAHYSTFPGTPVWPLN  219

Query  324  KQVLTYGFGNPTPFKFFIPVGL--AFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDG  154
            ++ LTY F         +      AF  W  A    F + T + +AD+K   +  DHGDG
Sbjct  220  RRDLTYAFLPENKLADDVKAVFLRAFERWSAATPLNFSETTSFYTADIKIGFFRGDHGDG  279

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D +ENW   G          +D++SVA+HEIGH
Sbjct  280  EPFDGVLGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGH  335



>gb|KHN28682.1| Metalloendoproteinase 1 [Glycine soja]
Length=400

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 90/175 (51%), Gaps = 18/175 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREV--APQYAHFPGKPKWPDNKQVLTY  307
            TG LD +T+ Q+  PRCGVPDIIN     +  +  +     Y+ F G P+WP   + LTY
Sbjct  99   TGKLDNNTLRQLTTPRCGVPDIINTNTTTQHTQLHIHTVSHYSFFNGAPRWPAGTRQLTY  158

Query  306  GFG-----NPTPFKFFIPVGLAFVHWQKAVRFKF---DRTDYASADLKFHLYARDHGDGY  151
             F      N      F     AF  W + V   F     + Y +A++K    + DH DG 
Sbjct  159  AFSPELNLNSAAKSLF---ARAFNRWTQVVNIAFYEIASSSYQTANIKIAFLSGDHNDGL  215

Query  150  PFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            PFDG  GE+ H+F P  G CHFD++E W   G     P    +D++S+A+HEIGH
Sbjct  216  PFDGPLGEWTHAFAPTNGWCHFDADEYWVASGDVTQSPVARAVDLESIAVHEIGH  270



>ref|XP_004504503.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=374

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 92/185 (50%), Gaps = 28/185 (15%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------------VAPQYAHFPGK  343
            TG LD  T++ ++ PRCGV DIINGT  M   +                    Y+ FPG+
Sbjct  111  TGELDNATMNYIVKPRCGVADIINGTTSMNSGKFNFNNTSENKENPKFHTVAHYSFFPGE  170

Query  342  PKWPDNKQVLTYGFG-----NPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFH  181
            P+WP   + LTY F      + T  + F     AF  W K     F + T +++AD+K  
Sbjct  171  PRWPAGTKSLTYAFDPNENLDETTKQVFAN---AFNQWSKVTTITFSETTSFSTADIKIG  227

Query  180  LYARDHGDGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVAL  16
             Y+ DHGDG  FDG  G  AH+F P  G  H D  E+W   G        + +D++SVA+
Sbjct  228  FYSGDHGDGEAFDGVLGTLAHAFSPTDGRFHLDKAEDWVVSGDVTESTLSNAVDLESVAV  287

Query  15   HEIGH  1
            HEIGH
Sbjct  288  HEIGH  292



>gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata]
Length=374

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 89/179 (50%), Gaps = 19/179 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRR----------EVAPQYAHFPGKPKWP  331
            TG LDA T++ +++PRCG  DI+NGT++MR  +                Y+ FP +P+WP
Sbjct  112  TGQLDAPTLNHIVLPRCGNADIVNGTSIMRSGKSPNTYSANSTIHTVAHYSFFPDRPRWP  171

Query  330  DNKQVLTYGFGNPTPFKFFIP--VGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHG  160
                 LTY F         +      AF  W +   F F  T  +  ADLK   +  DHG
Sbjct  172  PGTTQLTYAFLPENQLSDAVKGVFSRAFERWSEVTAFTFVETASFYDADLKIAFFGGDHG  231

Query  159  DGYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG------PPPDGLDIQSVALHEIGH  1
            DG PFDG  G  AH+F P  G  H D +ENW   G           +D++SVA+HEIGH
Sbjct  232  DGEPFDGVMGTLAHAFAPPAGRFHLDGDENWVIDGNFLGAAASVAAVDLESVAVHEIGH  290



>ref|XP_008353003.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=377

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 86/176 (49%), Gaps = 16/176 (9%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR--------HRREVAPQYAHFPGKPKWPDN  325
            TG LD  T+  ++ PRCG  DI+NGT  M           +      Y+ FPG P WP N
Sbjct  111  TGELDGPTLEHLVKPRCGNADIVNGTTTMNSGKPASYNSTKFHSVSHYSFFPGTPVWPQN  170

Query  324  KQVLTYGFGNPTPFKFFIPVGL--AFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDG  154
            ++ LTY F         +      AF  W  A    F + T + SAD+K   +  DHGDG
Sbjct  171  RRDLTYAFLPENELSDEVKTVFVGAFQRWSAATPLTFQETTSFYSADIKIGFFVGDHGDG  230

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AH+F P  G  H D +ENW   G          +D++SVA+HEIGH
Sbjct  231  EPFDGVLGTLAHAFSPPSGRFHLDGDENWVITGDISKFSVESAVDLESVAVHEIGH  286



>emb|CDX90504.1| BnaA03g42770D [Brassica napus]
Length=364

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 86/170 (51%), Gaps = 18/170 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD  TV+ M  PRCGV D     N M      V  +Y +F GKPKW  N+  LTY F
Sbjct  119  TGRLDTSTVTLMSSPRCGVSDTHMINNGM-----HVTARYTYFGGKPKW--NRDTLTYAF  171

Query  300  GN------PTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFD  142
                    PT          AF  W   +   F   D Y +A+LK   +A DHGDG PFD
Sbjct  172  SETHKLDYPTSDDVKTVFRRAFGRWASVIPVSFKEVDDYTTANLKIGFFAGDHGDGKPFD  231

Query  141  GRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            G  G  AH+F PK G  HFD+ E W    +FG     +D++SVA HEIGH
Sbjct  232  GVLGTLAHAFAPKNGRVHFDAAETWVVNDDFGSKV-AVDLESVATHEIGH  280



>ref|XP_011020982.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=253

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 93/163 (57%), Gaps = 5/163 (3%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TGVLD +TV+++ MPRCGVPDII+G   M    R    +YA F G P+WP +K+VL +G 
Sbjct  53   TGVLDPETVARVAMPRCGVPDIIDGKTRMNAAGRNNIIEYAFFNGTPRWPLSKKVLNWGL  112

Query  300  GNPTPFKFFIP-VGLAFVHWQKAVRFKFDRTD--YASADLKFHLYARDHGDGYPFDGRGG  130
               T      P V  AF+ W  A  F ++  D   + AD+K    +   G+   FDG GG
Sbjct  113  QPGTRRDVIDPLVEFAFLSWSGATPFAYNFVDENLSVADIKVGFTSEGQGN-EDFDGPGG  171

Query  129  EYAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            + A++  P  GI  +DS+E W++ GP     D+ SV LHE+GH
Sbjct  172  QLAYANPPPIGIMFYDSDEKWSD-GPVKGAYDMGSVGLHELGH  213



>gb|KFK37298.1| hypothetical protein AALP_AA4G239100 [Arabis alpina]
Length=336

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 89/171 (52%), Gaps = 14/171 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWP-DNKQVLTYG  304
            TG  D+DT++Q+++PRCG PD +        H R+    Y +FPG PKW  DN   LTY 
Sbjct  83   TGKPDSDTLTQILLPRCGFPDNVEELKTSPFHTRQ---SYVYFPGTPKWNRDNPLKLTYA  139

Query  303  FG--NPTPFKFFIPV----GLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            F   N TP      +      AF  W   +   F  T DY  AD+K   +A DHGDG PF
Sbjct  140  FSHENLTPHVTLTDIKRVFSRAFNKWASVIPITFIETEDYVIADIKIGFFAGDHGDGEPF  199

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            DG  G  AH+F P+ G  H D  E W    +       +D++SVA+HEIGH
Sbjct  200  DGVLGVLAHTFSPENGRLHLDKAEIWTVDFDVEKSNVAVDLESVAVHEIGH  250



>gb|KDP32993.1| hypothetical protein JCGZ_13024 [Jatropha curcas]
Length=306

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 85/161 (53%), Gaps = 3/161 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG L ++TVS+MMMPRCGV D+ NGT + +         Y  FPG PKWP +K  LTY  
Sbjct  108  TGSLTSETVSKMMMPRCGVADLTNGT-IKKSSNAYHTSGYTFFPGNPKWPASKYALTYEL  166

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFDR-TDYASADLKFHLYARDHGDGYPFDGRGGEY  124
               TP     P+  AF  W     F F       + D+   LY  DHGDGYPFD  G   
Sbjct  167  RYDTPPHLIPPLQNAFQAWANVTPFTFSPFHGRGNPDITIGLYKGDHGDGYPFDAFGAIA  226

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AHS+ P+ G  HF+S   +   G  P+  D  +VA HEIGH
Sbjct  227  AHSWPPQDGRLHFNSYGRFC-IGAFPNLYDFGTVASHEIGH  266



>ref|XP_006293383.1| hypothetical protein CARUB_v10023542mg [Capsella rubella]
 gb|EOA26281.1| hypothetical protein CARUB_v10023542mg [Capsella rubella]
Length=349

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 91/171 (53%), Gaps = 13/171 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQV-LTYG  304
            TG  D+DT+S +++PRCG PD +   +     R     +Y +FPG+P+W  +  + LTY 
Sbjct  93   TGKPDSDTLSHILLPRCGFPDDVEVESKTPPFRTR--KKYVYFPGRPRWSKDLPLNLTYA  150

Query  303  FGNPTPFKFFIP------VGLAFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            F       +  P       GLAF  W   +   F  T DY  AD+K   +A DHGDG PF
Sbjct  151  FSQENLTPYLTPSEIRRVFGLAFAKWASVIPVSFIETEDYVDADIKIGFFAGDHGDGEPF  210

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPD--GLDIQSVALHEIGH  1
            DG  G  AH+F P+ G  H D  E WA +F        +D++SVA+HEIGH
Sbjct  211  DGVLGVLAHTFSPENGRLHLDKAETWAVDFHEEKSTVAVDLESVAVHEIGH  261



>ref|XP_006371425.1| hypothetical protein POPTR_0019s10250g [Populus trichocarpa]
 gb|ERP49222.1| hypothetical protein POPTR_0019s10250g [Populus trichocarpa]
Length=196

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 7/155 (5%)
 Frame = -1

Query  447  MMMPRCGVPDIINGTNLMRRHRREVAPQYAHFP-GKPKWPDNKQVLTYGFGNPTPF----  283
            MM+PRCG+PDIIN      + + +     AH+  G  KWP +K  LTY FG+        
Sbjct  1    MMIPRCGMPDIINTKPNSTKSKHKKVHMVAHYDFGAQKWPPSKYALTYRFGSGVQVVGSD  60

Query  282  KFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGEYAHSFRP  106
                    AF  W K   F F + TD ASAD+    Y+ DHGD  PFDG G   AH+F P
Sbjct  61   TLRSVCSNAFKTWAKVSPFTFQEATDGASADIVIAFYSGDHGDQAPFDGPGNILAHAFYP  120

Query  105  KKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            + G  H+D++ENW+   P  D +D+++V +HEIGH
Sbjct  121  QDGRLHYDADENWST-DPAMDQIDLETVTVHEIGH  154



>ref|XP_002318762.2| MATRIX METALLOproteinASE [Populus trichocarpa]
 gb|EEE96982.2| MATRIX METALLOproteinASE [Populus trichocarpa]
Length=373

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 88/176 (50%), Gaps = 18/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRRE--------VAPQYAHFPGKPKWPDN  325
            TG LD  TV+ ++ PRCG PDI+NG++ M   +              Y+ F G P+W   
Sbjct  114  TGQLDDQTVNHIVRPRCGNPDIVNGSSSMNSGKTHNTSSSHVHTVSHYSFFTGMPRW--R  171

Query  324  KQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDG  154
            KQ LTY F  GN    +       AF  W   +   F + D   +AD+    Y+ DHGDG
Sbjct  172  KQALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQADSINAADIGIGFYSGDHGDG  231

Query  153  YPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
             PFDG  G  AHSF P  G  H D +ENW   G          +D++SVA+HEIGH
Sbjct  232  EPFDGVLGTLAHSFSPPSGQFHLDGDENWVVTGDVRTSSLTTAVDLESVAVHEIGH  287



>ref|XP_004142843.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM   RCG+ D+    ++       E++  Y  FP   KWPD K+ LTY 
Sbjct  96   SGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYKRHLTYM  155

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG PFDG GG 
Sbjct  156  FTNNFPIDFMPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPFDGPGGV  215

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D ++ W+  G     +++ + ALHE+GH
Sbjct  216  VGHAFAPTDGRLHLDGDDTWSA-GMEVQKVNVMNAALHELGH  256



>gb|KGN52417.1| hypothetical protein Csa_5G633150 [Cucumis sativus]
Length=294

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM   RCG+ D+    ++       E++  Y  FP   KWPD K+ LTY 
Sbjct  95   SGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYKRHLTYM  154

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG  FDG GG 
Sbjct  155  FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGV  214

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G   +  ++ +VALHE+GH
Sbjct  215  VGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGH  255



>ref|XP_011080438.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=306

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 84/161 (52%), Gaps = 4/161 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYGF  301
            TG LD +TV Q+  PRCG+PD     NL           Y +      WP  K+ LT+ +
Sbjct  109  TGRLDKETVKQLQEPRCGLPDFHPNANLTSFVHNWTGALYTYL--GTTWPPGKRNLTFSY  166

Query  300  GNPTPFKFFIPVGLAFVHWQKAVRFKFD-RTDYASADLKFHLYARDHGDGYPFDGRGGEY  124
                     +P+ LAF  W     F F+ R+D+ SAD+K     RDHGDG PFDG  G  
Sbjct  167  PESFRDDAKLPMALAFGRWITVSPFNFEYRSDFGSADVKVSFETRDHGDGSPFDGPNGIL  226

Query  123  AHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
            AH+F P  G  HFD+EENW  +       D+Q+V LHE+GH
Sbjct  227  AHAFWPTDGRMHFDAEENWTPY-VAKGSYDLQTVGLHELGH  266



>ref|XP_006375259.1| hypothetical protein POPTR_0014s05720g [Populus trichocarpa]
 gb|ERP53056.1| hypothetical protein POPTR_0014s05720g [Populus trichocarpa]
Length=357

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 88/172 (51%), Gaps = 18/172 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNK-QVLTYG  304
            TG LD DT++Q+M PRCGVPD          H+   +  Y +FPGKP+W  +    LTY 
Sbjct  108  TGKLDLDTLNQIMAPRCGVPDD------TMFHKLHASRHYFYFPGKPRWTRSIPMTLTYS  161

Query  303  FGNPTPFKFFIPVGL-------AFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYP  148
            F         + +         AF  W   +   F  TD YA AD+K   Y+ DHGDG P
Sbjct  162  FSKENLINVSLSLSDIEEVFKGAFAKWGSVIPVSFVETDDYAFADIKIGFYSGDHGDGEP  221

Query  147  FDGRGGEYAHSFRPKKGICHFDSEENWA---EFGPPPDGLDIQSVALHEIGH  1
            FDG  G  AHSF P+ G  H D+ E WA   +       + ++SVA+HEIGH
Sbjct  222  FDGVLGVLAHSFSPESGRFHLDARETWAIDFDLEKSKVAVHLESVAVHEIGH  273



>ref|XP_004143787.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004157318.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN51182.1| hypothetical protein Csa_5G484630 [Cucumis sativus]
Length=366

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 95/176 (54%), Gaps = 17/176 (10%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR---------HRREVAPQYAHFPGKPKWPD  328
            TG+LD  T++Q+ +PRCG+PDIIN +  M           H   V+  Y+ FPG+P WP 
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGQPTGRQSPHFHSVS-HYSFFPGRPIWPA  159

Query  327  NKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGD  157
            +++ LTY F   NP   +       AF  W       F   + + SAD++   YA DHGD
Sbjct  160  HRRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRSADIRIGFYAGDHGD  219

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG----PPPDGLDIQSVALHEIGH  1
            G PFDG  G  AH+F P  G  H D +E+W   G     P   +D++SVA+HEIGH
Sbjct  220  GEPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGH  275



>ref|XP_011002109.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=372

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 90/177 (51%), Gaps = 19/177 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR---------HRREVAPQYAHFPGKPKWPD  328
            TG LD  TV+ ++ PRCG PDIING+  M           H       Y+ F G+P+W  
Sbjct  111  TGQLDDQTVNHIVRPRCGNPDIINGSTSMNSGKTNNTSSSHHFHTVSHYSFFTGQPRW--  168

Query  327  NKQVLTYGF--GNPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGD  157
             KQ LTY F   N    +       AF  W   +   F +TD   +AD++   ++ DHGD
Sbjct  169  RKQALTYVFLPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDHGD  228

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENWAEFG-----PPPDGLDIQSVALHEIGH  1
            G PFDG  G  AH+F P+ G  H D +E+W   G          +D++SVA+HEIGH
Sbjct  229  GEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTGDVRTSALTSAVDLESVAVHEIGH  285



>ref|XP_004142460.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=294

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 84/162 (52%), Gaps = 3/162 (2%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIIN-GTNLMRRHRREVAPQYAHFPGKPKWPDNKQVLTYG  304
            +G+LD +T+ QM   RCG+ D+    ++       E++  Y  FP   KWPD K+ LTY 
Sbjct  95   SGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNEKWPDYKRHLTYM  154

Query  303  FGNPTPFKFFIPVGLAFVHWQKAVRFKF-DRTDYASADLKFHLYARDHGDGYPFDGRGGE  127
            F N  P  F   V  A   W     F F + +D  SAD+      +DH DG  FDG GG 
Sbjct  155  FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGV  214

Query  126  YAHSFRPKKGICHFDSEENWAEFGPPPDGLDIQSVALHEIGH  1
              H+F P  G  H D +++W+  G   +  ++ +VALHE+GH
Sbjct  215  VGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGH  255



>ref|XP_010508218.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=346

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 91/171 (53%), Gaps = 14/171 (8%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHRREVAPQYAHFPGKPKWPDNKQV-LTYG  304
            TG  D+DT+S +++PRCG PD +        H    + +Y +FPG+P+W  +  + LTY 
Sbjct  91   TGKPDSDTLSHILLPRCGFPDDVVDHKTSPFH---TSKKYVYFPGRPRWTKDVPLNLTYA  147

Query  303  FGNPTPFKFFIPVGL------AFVHWQKAVRFKFDRT-DYASADLKFHLYARDHGDGYPF  145
            F       +  P  +      AF  W   +   F  T DY  AD+K   +A DHGDG PF
Sbjct  148  FSQDNLTPYLTPTEIRRVFRRAFAKWASVIPVSFVETEDYVEADIKIGFFAGDHGDGEPF  207

Query  144  DGRGGEYAHSFRPKKGICHFDSEENWA-EFGPPPDG--LDIQSVALHEIGH  1
            DG  G  AH+F P+ G  H D  E WA +F     G  +D++SVA+HEIGH
Sbjct  208  DGVLGVLAHTFSPENGRLHLDKAETWAVDFDEEKSGEAVDLESVAVHEIGH  258



>ref|NP_176205.1| Matrixin family protein [Arabidopsis thaliana]
 gb|AAD14473.1| Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase 
homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 
comes from this gene [Arabidopsis thaliana]
 dbj|BAD44472.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ABF19013.1| At1g59970 [Arabidopsis thaliana]
 gb|AEE33645.1| Matrixin family protein [Arabidopsis thaliana]
Length=360

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 91/172 (53%), Gaps = 12/172 (7%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRRHR-REVAPQYAHFPGKPKWPDNKQVLTYG  304
            TG LD+ T+ Q++ PRCG PD+I+G + M   +      +Y+ FPGKP+WP  K+ LTY 
Sbjct  103  TGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYA  162

Query  303  FG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTD-YASADLKFHLYARDHGDGYPFDGRG  133
            F   N    +       AF  W +     F R++    AD+    ++ +HGDG PFDG  
Sbjct  163  FAPQNNLTDEVKRVFSRAFTRWAEVTPLNFTRSESILRADIVIGFFSGEHGDGEPFDGAM  222

Query  132  GEYAHSFRPKKGICHFDSEENWA--------EFGPPPDGLDIQSVALHEIGH  1
            G  AH+  P  G+ H D +E+W            P    +D++SVA+HEIGH
Sbjct  223  GTLAHASSPPTGMLHLDGDEDWLISNGEISRRILPVTTVVDLESVAVHEIGH  274



>ref|XP_002322292.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
 gb|EEF06419.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
Length=375

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 89/177 (50%), Gaps = 19/177 (11%)
 Frame = -1

Query  480  TGVLDADTVSQMMMPRCGVPDIINGTNLMRR---------HRREVAPQYAHFPGKPKWPD  328
            TG LD  TV+ ++ PRCG PDIING+  M           H       Y+ F G+P+W  
Sbjct  114  TGELDDQTVNHVVRPRCGNPDIINGSTSMNSGKTNNTSSSHHLHTVSHYSFFTGQPRW--  171

Query  327  NKQVLTYGFG--NPTPFKFFIPVGLAFVHWQKAVRFKFDRTDYA-SADLKFHLYARDHGD  157
             KQ LTY F   N    +       AF  W   +   F +TD   +AD++   ++ DHGD
Sbjct  172  RKQALTYVFSPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDHGD  231

Query  156  GYPFDGRGGEYAHSFRPKKGICHFDSEENW-----AEFGPPPDGLDIQSVALHEIGH  1
            G PFDG  G  AH+F P+ G  H D +E+W              +D++SVA+HEIGH
Sbjct  232  GEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTDDVRTSTLTSAVDLESVAVHEIGH  288



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519922816592