BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5028_g1_i1 len=1032 path=[1220:0-479 106:480-1031]

Length=1032
                                                                      Score     E

ref|XP_008242459.1|  PREDICTED: 6-phosphofructokinase 6-like            427   1e-143   
ref|XP_011078226.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    427   2e-143   
ref|XP_009613573.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    427   5e-143   
ref|XP_009613574.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    426   5e-143   
ref|XP_009763926.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    423   6e-142   
ref|XP_009763925.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    424   9e-142   
gb|EYU30678.1|  hypothetical protein MIMGU_mgv1a005513mg                422   2e-141   
ref|XP_007203634.1|  hypothetical protein PRUPE_ppa003994mg             423   3e-141   
ref|XP_008354543.1|  PREDICTED: 6-phosphofructokinase 3-like            419   9e-141   
ref|XP_009337906.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    419   2e-140   
ref|XP_009337915.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    417   3e-140   
ref|XP_008337072.1|  PREDICTED: 6-phosphofructokinase 3-like            411   4e-140   
ref|XP_004253102.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    418   5e-140   
gb|EYU20400.1|  hypothetical protein MIMGU_mgv1a005493mg                417   7e-140   
ref|XP_007137260.1|  hypothetical protein PHAVU_009G112500g             412   8e-140   
gb|EYU20401.1|  hypothetical protein MIMGU_mgv1a005493mg                417   8e-140   
gb|KDP40841.1|  hypothetical protein JCGZ_24840                         419   9e-140   
ref|XP_008375837.1|  PREDICTED: 6-phosphofructokinase 6-like            417   9e-140   
ref|XP_010244403.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    419   1e-139   
ref|XP_009337914.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    416   2e-139   
ref|XP_009337911.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    417   2e-139   
ref|XP_011093663.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    418   2e-139   
ref|XP_008387449.1|  PREDICTED: 6-phosphofructokinase 3-like            418   2e-139   
ref|XP_009337913.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    416   2e-139   
ref|XP_006342512.1|  PREDICTED: 6-phosphofructokinase 3-like            416   3e-139   
ref|XP_006465714.1|  PREDICTED: 6-phosphofructokinase 3-like            417   4e-139   
ref|XP_007012967.1|  6-phosphofructokinase 3                            419   4e-139   
ref|XP_009337916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    416   4e-139   
gb|KDO51846.1|  hypothetical protein CISIN_1g009394mg                   417   4e-139   
ref|XP_006451355.1|  hypothetical protein CICLE_v10007886mg             415   5e-139   
ref|XP_003630682.1|  6-phosphofructokinase                              410   6e-139   
gb|KHG01593.1|  6-phosphofructokinase 3 -like protein                   416   7e-139   
ref|XP_008375836.1|  PREDICTED: 6-phosphofructokinase 3-like            415   9e-139   
ref|XP_006357682.1|  PREDICTED: 6-phosphofructokinase 3-like            416   9e-139   
ref|XP_004302844.1|  PREDICTED: 6-phosphofructokinase 3-like            415   1e-138   
ref|XP_006856644.1|  hypothetical protein AMTR_s01089p00001250          407   2e-138   
ref|XP_006451353.1|  hypothetical protein CICLE_v10007886mg             415   2e-138   
ref|XP_010051556.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    414   2e-138   
ref|XP_004243602.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    414   3e-138   
ref|XP_006426847.1|  hypothetical protein CICLE_v10025255mg             417   3e-138   
ref|XP_007223382.1|  hypothetical protein PRUPE_ppa004610mg             414   4e-138   
ref|XP_009602786.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    414   4e-138   
ref|XP_003526507.1|  PREDICTED: 6-phosphofructokinase 3-like            414   4e-138   
ref|XP_006475360.1|  PREDICTED: 6-phosphofructokinase 3-like            416   4e-138   
ref|XP_006451354.1|  hypothetical protein CICLE_v10007886mg             416   4e-138   
ref|XP_010526423.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    413   4e-138   
ref|XP_004243600.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    414   5e-138   
ref|XP_011094240.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    413   6e-138   
ref|XP_009603443.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    412   8e-138   
ref|XP_009758764.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    412   8e-138   
ref|XP_010267094.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    412   9e-138   
gb|KHM99825.1|  6-phosphofructokinase 3                                 412   9e-138   
ref|XP_003522720.1|  PREDICTED: 6-phosphofructokinase 3-like            413   1e-137   
ref|XP_003524412.1|  PREDICTED: 6-phosphofructokinase 7-like            412   1e-137   
ref|XP_010086908.1|  6-phosphofructokinase 3                            411   2e-137   
ref|XP_007152950.1|  hypothetical protein PHAVU_004G173900g             413   2e-137   
ref|XP_003532467.1|  PREDICTED: 6-phosphofructokinase 3-like            410   3e-137   
gb|KHN16662.1|  6-phosphofructokinase 3                                 410   3e-137   
gb|KCW69691.1|  hypothetical protein EUGRSUZ_F03086                     408   4e-137   
ref|XP_010925504.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    411   4e-137   
emb|CDP03227.1|  unnamed protein product                                410   4e-137   
ref|XP_009367416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    411   4e-137   
gb|AAB88875.1|  pyrophosphate-dependent phosphofructo-1-kinase          403   5e-137   Prunus armeniaca
emb|CBI27972.3|  unnamed protein product                                410   5e-137   
ref|XP_010924465.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    406   5e-137   
gb|AIE47275.1|  phosphofructokinase                                     412   7e-137   
ref|XP_008795494.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   1e-136   
ref|XP_004503509.1|  PREDICTED: 6-phosphofructokinase 3-like            409   1e-136   
ref|XP_002283274.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    411   1e-136   Vitis vinifera
gb|EYU29302.1|  hypothetical protein MIMGU_mgv1a005820mg                409   1e-136   
ref|XP_008795493.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   1e-136   
gb|KDP33769.1|  hypothetical protein JCGZ_07340                         412   1e-136   
ref|XP_004245136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    410   1e-136   
ref|XP_010925503.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    411   1e-136   
ref|XP_006285534.1|  hypothetical protein CARUB_v10006975mg             409   2e-136   
ref|XP_003630681.1|  6-phosphofructokinase                              408   2e-136   
gb|AIE47274.1|  phosphofructokinase                                     410   3e-136   
ref|XP_010541000.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    409   3e-136   
ref|XP_002514189.1|  phosphofructokinase, putative                      413   4e-136   Ricinus communis
ref|XP_008348488.1|  PREDICTED: 6-phosphofructokinase 6-like            410   4e-136   
gb|AIE47270.1|  phosphofructokinase                                     408   4e-136   
ref|XP_006583562.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    406   4e-136   
ref|XP_008794086.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    409   5e-136   
ref|XP_010526087.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   6e-136   
ref|XP_004513074.1|  PREDICTED: 6-phosphofructokinase 3-like            408   6e-136   
ref|XP_002275308.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   7e-136   Vitis vinifera
ref|XP_004135681.1|  PREDICTED: 6-phosphofructokinase 7-like            408   7e-136   
ref|XP_006285234.1|  hypothetical protein CARUB_v10006594mg             407   7e-136   
ref|XP_007012201.1|  Phosphofructokinase 3 isoform 3                    407   8e-136   
ref|XP_010447879.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   8e-136   
ref|NP_567742.1|  6-phosphofructokinase 3                               407   9e-136   Arabidopsis thaliana [mouse-ear cress]
gb|KHN03217.1|  6-phosphofructokinase 3                                 409   1e-135   
ref|XP_007160266.1|  hypothetical protein PHAVU_002G306800g             407   1e-135   
gb|KFK27231.1|  hypothetical protein AALP_AA8G354500                    407   1e-135   
ref|XP_002309230.2|  hypothetical protein POPTR_0006s15730g             409   1e-135   Populus trichocarpa [western balsam poplar]
ref|XP_007012199.1|  Phosphofructokinase 3 isoform 1                    407   1e-135   
emb|CAB38956.1|  pyrophosphate-dependent phosphofructo-1-kinase         407   1e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081730.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   1e-135   
ref|XP_003516323.2|  PREDICTED: 6-phosphofructokinase 3-like            408   1e-135   
ref|XP_008794084.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    409   1e-135   
ref|XP_008450803.1|  PREDICTED: 6-phosphofructokinase 7-like            407   2e-135   
ref|XP_010540999.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    409   2e-135   
ref|XP_010438324.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    406   2e-135   
ref|XP_007215486.1|  hypothetical protein PRUPE_ppa003635mg             409   2e-135   
ref|XP_002515946.1|  phosphofructokinase, putative                      408   2e-135   Ricinus communis
gb|KCW79599.1|  hypothetical protein EUGRSUZ_C00956                     406   2e-135   
ref|XP_004287498.1|  PREDICTED: 6-phosphofructokinase 3-like            407   2e-135   
gb|AIU64848.1|  6-phosphofructokinase                                   408   2e-135   
emb|CDX94352.1|  BnaC01g18320D                                          406   3e-135   
ref|XP_010451175.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   4e-135   
ref|XP_009337910.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   4e-135   
ref|XP_002867420.1|  phosphofructokinase family protein                 405   4e-135   
ref|XP_002516495.1|  phosphofructokinase, putative                      405   4e-135   Ricinus communis
ref|XP_006413209.1|  hypothetical protein EUTSA_v10025029mg             405   5e-135   
emb|CAN74837.1|  hypothetical protein VITISV_023326                     405   5e-135   Vitis vinifera
ref|XP_006280374.1|  hypothetical protein CARUB_v10026301mg             405   6e-135   
gb|KDO79934.1|  hypothetical protein CISIN_1g012056mg                   405   6e-135   
gb|AIE47276.1|  phosphofructokinase                                     408   6e-135   
ref|XP_010047648.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   7e-135   
ref|XP_011007273.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   8e-135   
ref|XP_010438323.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    407   8e-135   
ref|XP_010433122.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    404   9e-135   
ref|NP_194651.1|  6-phosphofructokinase 1                               404   9e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228400.1|  PREDICTED: 6-phosphofructokinase 6-like            406   9e-135   
ref|XP_008375840.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    404   1e-134   
emb|CDP08198.1|  unnamed protein product                                404   1e-134   
ref|XP_009142127.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    404   1e-134   
ref|XP_010438777.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    404   1e-134   
ref|XP_006371963.1|  phosphofructokinase family protein                 404   2e-134   
ref|XP_006412866.1|  hypothetical protein EUTSA_v10024824mg             402   2e-134   
gb|KEH36099.1|  6-phosphofructokinase                                   405   2e-134   
gb|EPS62819.1|  hypothetical protein M569_11969                         402   2e-134   
emb|CDY69051.1|  BnaAnng29210D                                          404   2e-134   
gb|KDP34145.1|  hypothetical protein JCGZ_07716                         404   2e-134   
ref|XP_006355296.1|  PREDICTED: 6-phosphofructokinase 3-like            404   2e-134   
ref|XP_009128951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   2e-134   
ref|XP_006450746.1|  hypothetical protein CICLE_v10008181mg             403   2e-134   
ref|XP_006853746.1|  hypothetical protein AMTR_s00056p00183670          404   2e-134   
ref|XP_010539385.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    404   2e-134   
ref|XP_010914787.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   2e-134   
ref|XP_010924464.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   3e-134   
ref|XP_003529065.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    405   3e-134   
ref|XP_010536840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   3e-134   
ref|XP_009387228.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   3e-134   
ref|XP_010433524.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   3e-134   
gb|KHN40360.1|  6-phosphofructokinase 3                                 405   4e-134   
ref|XP_009757482.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    396   4e-134   
ref|XP_008799762.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   4e-134   
ref|XP_010915352.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   4e-134   
ref|XP_009344489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   4e-134   
ref|XP_003620763.1|  6-phosphofructokinase                              403   6e-134   
gb|AAM91591.1|  pyrophosphate-dependent phosphofructo-1-kinase-li...    402   6e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010049142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   6e-134   
ref|XP_008375838.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    403   6e-134   
ref|XP_010433121.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    405   6e-134   
gb|ACU20351.1|  unknown                                                 395   8e-134   Glycine max [soybeans]
ref|XP_006412865.1|  hypothetical protein EUTSA_v10024824mg             402   8e-134   
emb|CDY06829.1|  BnaC01g09280D                                          402   8e-134   
ref|XP_011006431.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    402   9e-134   
ref|XP_008375839.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    402   1e-133   
ref|XP_011016327.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    402   1e-133   
emb|CDX68896.1|  BnaC01g05570D                                          401   1e-133   
ref|XP_004517277.1|  PREDICTED: 6-phosphofructokinase 3-like            403   1e-133   
emb|CDX75291.1|  BnaA01g04110D                                          401   1e-133   
ref|XP_010049141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    402   1e-133   
ref|XP_009125389.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    401   1e-133   
ref|XP_010443317.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    401   2e-133   
ref|XP_007024343.1|  6-phosphofructokinase 3                            403   2e-133   
ref|XP_008798601.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    404   2e-133   
ref|XP_009395051.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   2e-133   
ref|XP_010483140.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    401   2e-133   
ref|XP_009395050.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    403   2e-133   
emb|CDY32769.1|  BnaA10g10800D                                          397   3e-133   
gb|KFK29896.1|  hypothetical protein AALP_AA7G192500                    400   3e-133   
ref|XP_006412864.1|  hypothetical protein EUTSA_v10024824mg             403   3e-133   
ref|XP_004158491.1|  PREDICTED: 6-phosphofructokinase 3-like            402   3e-133   
emb|CDY20715.1|  BnaA02g08550D                                          400   4e-133   
ref|XP_010098164.1|  6-phosphofructokinase 4                            397   5e-133   
gb|KGN58020.1|  hypothetical protein Csa_3G435010                       402   5e-133   
ref|XP_010545328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    400   6e-133   
emb|CDY41800.1|  BnaC02g12110D                                          400   7e-133   
ref|XP_011091507.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    399   8e-133   
ref|XP_006401301.1|  hypothetical protein EUTSA_v10013372mg             400   1e-132   
ref|XP_006283577.1|  hypothetical protein CARUB_v10004629mg             400   1e-132   
ref|XP_003543617.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    399   2e-132   
ref|XP_007150587.1|  hypothetical protein PHAVU_005G165100g             398   2e-132   
gb|AFW80261.1|  hypothetical protein ZEAMMB73_064922                    395   2e-132   
ref|XP_002864472.1|  phosphofructokinase family protein                 399   2e-132   
ref|XP_009132191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    399   2e-132   
ref|XP_009126929.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    399   2e-132   
ref|XP_011072633.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    397   2e-132   
gb|KCW90883.1|  hypothetical protein EUGRSUZ_A02923                     397   3e-132   
ref|NP_568842.1|  6-phosphofructokinase 7                               398   3e-132   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09881.1|  pyrophosphate-dependent phosphofructo-1-kinase-l...    398   3e-132   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11911.1|  BnaC03g13370D                                          398   4e-132   
ref|NP_001054859.1|  Os05g0194900                                       390   4e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095449.1|  6-phosphofructokinase 3                            398   5e-132   
ref|XP_004149188.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    398   7e-132   
ref|XP_008447566.1|  PREDICTED: 6-phosphofructokinase 6-like            399   7e-132   
gb|KCW90878.1|  hypothetical protein EUGRSUZ_A02923                     396   1e-131   
ref|XP_011022362.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    397   1e-131   
gb|EYU20177.1|  hypothetical protein MIMGU_mgv1a004503mg                397   2e-131   
ref|XP_006385829.1|  hypothetical protein POPTR_0003s15090g             397   2e-131   
gb|KHN39263.1|  6-phosphofructokinase 3                                 395   2e-131   
ref|XP_010447333.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   3e-131   
ref|XP_006583042.1|  PREDICTED: 6-phosphofructokinase 3-like            395   3e-131   
ref|XP_010690141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   3e-131   
ref|XP_011076434.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    397   3e-131   
ref|XP_010447334.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   3e-131   
ref|XP_002867225.1|  phosphofructokinase family protein                 394   3e-131   
ref|XP_002511010.1|  phosphofructokinase, putative                      397   3e-131   Ricinus communis
ref|XP_010432655.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   3e-131   
ref|XP_010437846.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   4e-131   
gb|AHB32113.1|  6-phosphofructokinase 3-like protein                    395   4e-131   
ref|XP_010668815.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   5e-131   
ref|XP_006412426.1|  hypothetical protein EUTSA_v10025143mg             394   5e-131   
emb|CDX88580.1|  BnaA03g10690D                                          395   5e-131   
ref|XP_009395732.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    396   6e-131   
ref|XP_003546601.1|  PREDICTED: 6-phosphofructokinase 3 isoform X1      395   7e-131   
ref|XP_009409366.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    397   7e-131   
ref|XP_009388585.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   7e-131   
gb|EAZ10866.1|  hypothetical protein OsJ_00706                          395   8e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006421534.1|  hypothetical protein CICLE_v10004702mg             396   8e-131   
emb|CDY32873.1|  BnaC09g33200D                                          394   1e-130   
ref|XP_010668810.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   1e-130   
ref|NP_001042273.1|  Os01g0191700                                       395   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009120176.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    394   1e-130   
ref|XP_006490011.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    395   1e-130   
ref|XP_010062614.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   2e-130   
ref|XP_010275416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   2e-130   
ref|XP_004969889.1|  PREDICTED: 6-phosphofructokinase 3-like            389   2e-130   
ref|XP_010275417.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    394   3e-130   
ref|XP_009388583.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    395   4e-130   
ref|XP_002457198.1|  hypothetical protein SORBIDRAFT_03g003140          394   5e-130   Sorghum bicolor [broomcorn]
ref|XP_011019558.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    392   5e-130   
ref|XP_007038279.1|  Phosphofructokinase 4                              394   5e-130   
ref|XP_007135617.1|  hypothetical protein PHAVU_010G143900g             395   6e-130   
gb|KHN05322.1|  6-phosphofructokinase 3                                 391   6e-130   
ref|XP_003533035.1|  PREDICTED: 6-phosphofructokinase 3-like            391   6e-130   
dbj|BAK01448.1|  predicted protein                                      392   7e-130   
ref|XP_008654297.1|  PREDICTED: uncharacterized protein LOC100192...    394   9e-130   
dbj|BAD69330.1|  putative pyrophosphate-dependent phosphofructo-1...    394   1e-129   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99719.1|  hypothetical protein OsI_21704                          394   1e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_006643863.1|  PREDICTED: 6-phosphofructokinase 3-like            393   1e-129   
ref|NP_195010.1|  6-phosphofructokinase 6                               391   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564709.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    394   1e-129   
ref|XP_004968501.1|  PREDICTED: 6-phosphofructokinase 3-like            393   2e-129   
ref|NP_001266546.1|  6-phosphofructokinase 2                            393   2e-129   
gb|ACL53548.1|  unknown                                                 393   2e-129   Zea mays [maize]
ref|XP_007219544.1|  hypothetical protein PRUPE_ppa003986mg             392   3e-129   
ref|NP_001151911.1|  6-phosphofructokinase                              392   3e-129   Zea mays [maize]
ref|NP_001147976.1|  6-phosphofructokinase 2                            392   3e-129   Zea mays [maize]
gb|KDP22466.1|  hypothetical protein JCGZ_26297                         392   4e-129   
gb|AAM65566.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    389   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    392   5e-129   
ref|NP_001241814.1|  6-phosphofructokinase 2                            391   6e-129   
gb|KHG19950.1|  6-phosphofructokinase 4, chloroplastic -like protein    391   6e-129   
gb|AIE47272.1|  phosphofructokinase                                     391   6e-129   
gb|EMT19126.1|  6-phosphofructokinase 3                                 391   7e-129   
gb|EMS52572.1|  6-phosphofructokinase 3                                 391   7e-129   
emb|CDM81680.1|  unnamed protein product                                391   7e-129   
dbj|BAJ85701.1|  predicted protein                                      391   9e-129   
ref|XP_004309023.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    390   1e-128   
ref|XP_008234443.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    391   1e-128   
ref|NP_001148080.1|  6-phosphofructokinase 2                            390   2e-128   Zea mays [maize]
emb|CDY02131.1|  BnaA03g40360D                                          390   2e-128   
gb|ACN34221.1|  unknown                                                 390   2e-128   Zea mays [maize]
gb|AFW75541.1|  hypothetical protein ZEAMMB73_660971                    390   3e-128   
ref|XP_002437847.1|  hypothetical protein SORBIDRAFT_10g003650          390   3e-128   Sorghum bicolor [broomcorn]
ref|XP_003597663.1|  6-phosphofructokinase                              387   3e-128   
ref|XP_003564328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    390   3e-128   
ref|XP_010443983.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    389   4e-128   
ref|XP_002439415.1|  hypothetical protein SORBIDRAFT_09g006030          389   4e-128   Sorghum bicolor [broomcorn]
gb|AAT38069.1|  putative pyrophosphate-fructose-6-phosphate-1-pho...    390   4e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CDY23054.1|  BnaC07g31330D                                          389   4e-128   
dbj|BAJ85856.1|  predicted protein                                      389   5e-128   
ref|XP_010457508.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    389   5e-128   
gb|EAY96852.1|  hypothetical protein OsI_18773                          389   5e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_006656646.1|  PREDICTED: 6-phosphofructokinase 3-like            390   5e-128   
ref|XP_008453875.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    385   5e-128   
ref|XP_008648820.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    389   5e-128   
ref|XP_002864742.1|  phosphofructokinase family protein                 389   7e-128   
ref|XP_002282309.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    389   7e-128   
ref|XP_004964832.1|  PREDICTED: 6-phosphofructokinase 7-like            389   9e-128   
ref|XP_009362710.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    389   9e-128   
ref|XP_010483840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    388   1e-127   
gb|KFK27910.1|  hypothetical protein AALP_AA8G446100                    388   2e-127   
ref|XP_004235183.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    387   3e-127   
ref|XP_006394490.1|  hypothetical protein EUTSA_v10003971mg             387   3e-127   
ref|XP_002463719.1|  hypothetical protein SORBIDRAFT_01g004810          387   5e-127   
ref|NP_200966.2|  6-phosphofructokinase 4                               386   6e-127   
ref|XP_003566456.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    386   7e-127   
gb|KGN58018.1|  hypothetical protein Csa_3G434990                       384   7e-127   
ref|XP_003536274.2|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    386   9e-127   
ref|XP_008375682.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    386   1e-126   
ref|XP_008453872.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    385   1e-126   
dbj|BAK02245.1|  predicted protein                                      386   1e-126   
ref|XP_006358222.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    385   1e-126   
gb|KHN37911.1|  6-phosphofructokinase 4, chloroplastic                  385   2e-126   
ref|XP_002458460.1|  hypothetical protein SORBIDRAFT_03g034060          385   3e-126   
ref|XP_004960908.1|  PREDICTED: 6-phosphofructokinase 3-like            385   3e-126   
dbj|BAD86939.1|  putative pyrophosphate-dependent phosphofructo-1...    385   4e-126   
ref|XP_010546132.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    384   4e-126   
ref|XP_004146902.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    384   4e-126   
emb|CDP05378.1|  unnamed protein product                                384   7e-126   
ref|XP_006644676.1|  PREDICTED: 6-phosphofructokinase 7-like            384   7e-126   
ref|XP_004149187.1|  PREDICTED: 6-phosphofructokinase 3-like            382   9e-126   
gb|ACR36601.1|  unknown                                                 383   3e-125   
ref|NP_001147854.1|  6-phosphofructokinase                              383   3e-125   
gb|ABR17197.1|  unknown                                                 384   4e-125   
ref|XP_009588737.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    382   5e-125   
ref|NP_001032120.1|  6-phosphofructokinase 4                            381   5e-125   
ref|NP_001056090.1|  Os05g0524400                                       382   7e-125   
ref|XP_009804348.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    381   7e-125   
ref|XP_006654136.1|  PREDICTED: 6-phosphofructokinase 3-like            381   1e-124   
gb|EMS48156.1|  6-phosphofructokinase 3                                 388   1e-124   
ref|XP_006654672.1|  PREDICTED: 6-phosphofructokinase 3-like            380   3e-124   
ref|XP_010546134.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    379   3e-124   
gb|EMS54289.1|  6-phosphofructokinase 3                                 378   3e-124   
gb|EEC79555.1|  hypothetical protein OsI_20679                          380   3e-124   
gb|EMT10635.1|  6-phosphofructokinase 3                                 380   4e-124   
ref|XP_008447679.1|  PREDICTED: 6-phosphofructokinase 6-like            378   4e-124   
gb|EAZ13474.1|  hypothetical protein OsJ_03390                          386   5e-124   
ref|XP_008649450.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    378   7e-124   
ref|XP_003568068.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    378   2e-123   
ref|XP_008672828.1|  PREDICTED: 6-phosphofructokinase isoform X1        384   3e-123   
ref|XP_008672829.1|  PREDICTED: 6-phosphofructokinase isoform X2        384   3e-123   
ref|XP_002867573.1|  phosphofructokinase family protein                 375   3e-123   
gb|KHG00436.1|  6-phosphofructokinase 3 -like protein                   377   3e-123   
ref|XP_004496087.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    376   5e-123   
ref|XP_002440110.1|  hypothetical protein SORBIDRAFT_09g026150          377   7e-123   
ref|XP_008649908.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    377   7e-123   
ref|XP_006837361.1|  hypothetical protein AMTR_s00111p00106690          377   1e-122   
ref|XP_004961440.1|  PREDICTED: 6-phosphofructokinase 7-like            375   5e-122   
ref|XP_002975191.1|  hypothetical protein SELMODRAFT_150344             372   7e-122   
ref|XP_010688378.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    372   7e-122   
ref|XP_002977595.1|  hypothetical protein SELMODRAFT_176350             372   7e-122   
ref|XP_007144193.1|  hypothetical protein PHAVU_007G136000g             372   8e-122   
gb|EEE64418.1|  hypothetical protein OsJ_19262                          373   2e-121   
ref|XP_003591658.1|  6-phosphofructokinase                              371   5e-121   
ref|XP_003637099.1|  6-phosphofructokinase                              371   6e-121   
ref|XP_006354082.1|  PREDICTED: 6-phosphofructokinase 3-like            369   8e-121   
gb|KCW79598.1|  hypothetical protein EUGRSUZ_C00956                     368   8e-121   
ref|XP_003569758.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    378   9e-121   
ref|XP_004238509.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    369   1e-120   
gb|KDO79936.1|  hypothetical protein CISIN_1g012056mg                   367   1e-120   
ref|XP_001766110.1|  predicted protein                                  364   5e-119   
ref|XP_010047298.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    362   3e-118   
gb|KDO79935.1|  hypothetical protein CISIN_1g012056mg                   359   1e-117   
gb|ABD96051.1|  putative phosphofructokinase                            360   2e-117   
ref|XP_004496088.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    358   4e-117   
ref|XP_002309528.2|  hypothetical protein POPTR_0006s25170g             358   6e-117   
ref|XP_001770890.1|  predicted protein                                  359   7e-117   
gb|EPS73018.1|  hypothetical protein M569_01738                         355   1e-116   
ref|XP_006280423.1|  hypothetical protein CARUB_v10026356mg             357   2e-116   
ref|XP_004494953.1|  PREDICTED: 6-phosphofructokinase 3-like            359   4e-116   
gb|EEC71448.1|  hypothetical protein OsI_03669                          361   1e-115   
ref|XP_001780597.1|  predicted protein                                  352   2e-114   
ref|XP_004172311.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    339   7e-112   
gb|AFW80260.1|  hypothetical protein ZEAMMB73_064922                    338   4e-111   
ref|NP_001131170.1|  uncharacterized protein LOC100192478               338   5e-111   
gb|KCW90880.1|  hypothetical protein EUGRSUZ_A02923                     343   5e-111   
gb|KCW90879.1|  hypothetical protein EUGRSUZ_A02923                     343   2e-110   
gb|KHG29071.1|  6-phosphofructokinase 3 -like protein                   342   9e-110   
ref|XP_010050463.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    333   2e-109   
gb|AFW85828.1|  hypothetical protein ZEAMMB73_244047                    342   4e-109   
ref|XP_001782327.1|  predicted protein                                  340   4e-109   
gb|EAZ35851.1|  hypothetical protein OsJ_20149                          340   5e-109   
ref|XP_001764541.1|  predicted protein                                  339   5e-109   
gb|AFW80264.1|  hypothetical protein ZEAMMB73_064922                    337   2e-108   
gb|ACN31923.1|  unknown                                                 333   5e-106   
ref|XP_008343688.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    318   1e-104   
gb|KCW79592.1|  hypothetical protein EUGRSUZ_C00952                     317   3e-104   
gb|KDO55889.1|  hypothetical protein CISIN_1g0098041mg                  316   1e-103   
gb|AFK48605.1|  unknown                                                 308   1e-100   
ref|XP_010047299.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    306   1e-96    
tpg|DAA57730.1|  TPA: hypothetical protein ZEAMMB73_790705              297   3e-96    
ref|XP_005709060.1|  6-phosphofructokinase                              300   7e-96    
ref|XP_005702907.1|  6-phosphofructokinase                              299   2e-93    
ref|XP_005537083.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    300   2e-93    
ref|XP_011096141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    294   8e-93    
gb|AIE47271.1|  phosphofructokinase                                     294   6e-92    
gb|AGT16840.1|  6-phosphofructokinase                                   294   1e-91    
gb|KDP35553.1|  hypothetical protein JCGZ_08991                         293   2e-91    
emb|CDX77799.1|  BnaC07g20530D                                          291   3e-91    
ref|XP_009101383.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    291   5e-91    
ref|XP_010530089.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    291   9e-91    
ref|XP_004293419.1|  PREDICTED: 6-phosphofructokinase 2-like            291   1e-90    
ref|XP_002525025.1|  phosphofructokinase, putative                      294   1e-90    
emb|CDY17703.1|  BnaA06g35220D                                          290   1e-90    
ref|XP_006857658.1|  hypothetical protein AMTR_s00061p00151020          290   2e-90    
ref|XP_007213751.1|  hypothetical protein PRUPE_ppa004167m1g            284   3e-90    
gb|KHG28031.1|  6-phosphofructokinase 2 -like protein                   290   6e-90    
ref|XP_010503512.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    287   1e-89    
ref|XP_010426370.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    287   2e-89    
ref|XP_006350241.1|  PREDICTED: 6-phosphofructokinase 2-like            287   2e-89    
ref|XP_010515191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    286   3e-89    
ref|XP_004236642.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    287   3e-89    
ref|XP_008440953.1|  PREDICTED: 6-phosphofructokinase 2                 286   3e-89    
ref|XP_004499341.1|  PREDICTED: 6-phosphofructokinase 2-like            286   3e-89    
ref|NP_199592.1|  6-phosphofructokinase 2                               286   4e-89    
ref|XP_004134815.1|  PREDICTED: 6-phosphofructokinase 2-like            286   4e-89    
gb|ACN41013.1|  unknown                                                 285   4e-89    
ref|XP_006398483.1|  hypothetical protein EUTSA_v10000886mg             285   7e-89    
ref|XP_011040110.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    286   1e-88    
ref|XP_006291021.1|  hypothetical protein CARUB_v10017134mg             286   1e-88    
ref|XP_006449986.1|  hypothetical protein CICLE_v10015031mg             286   2e-88    
ref|XP_010942916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    286   2e-88    
dbj|BAG92288.1|  unnamed protein product                                278   3e-88    
gb|KDO78652.1|  hypothetical protein CISIN_1g042534mg                   284   3e-88    
ref|XP_007026417.1|  Phosphofructokinase 2                              285   3e-88    
ref|XP_010096496.1|  6-phosphofructokinase 2                            285   3e-88    
ref|XP_010246561.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    284   4e-88    
ref|XP_009779364.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    283   5e-88    
gb|KDO40004.1|  hypothetical protein CISIN_1g0094441mg                  275   6e-88    
ref|XP_006467226.1|  PREDICTED: 6-phosphofructokinase 2-like            284   6e-88    
gb|KFK31346.1|  hypothetical protein AALP_AA6G100300                    283   6e-88    
ref|XP_007154072.1|  hypothetical protein PHAVU_003G088700g             283   6e-88    
ref|XP_009349890.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    285   6e-88    
ref|XP_008779196.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    284   7e-88    
ref|XP_006373566.1|  hypothetical protein POPTR_0016s00450g             283   1e-87    
ref|XP_010052498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    283   1e-87    
ref|XP_008779034.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    282   2e-87    
ref|XP_009401489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    283   2e-87    
ref|XP_003635479.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    282   3e-87    
ref|XP_005710269.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    283   7e-87    
ref|NP_001063482.1|  Os09g0479800                                       281   8e-87    
gb|EEE69916.1|  hypothetical protein OsJ_29767                          281   8e-87    
ref|XP_006653509.1|  PREDICTED: 6-phosphofructokinase 2-like            278   1e-86    
emb|CBI41063.3|  unnamed protein product                                281   2e-86    
gb|EEC77447.1|  hypothetical protein OsI_16253                          278   3e-86    
ref|XP_008795495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    275   3e-86    
gb|EEE61159.1|  hypothetical protein OsJ_15126                          278   6e-86    
ref|XP_009617768.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    278   2e-85    
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2                 281   2e-85    
emb|CAE75963.1|  OSJNBa0016O02.24                                       276   2e-85    
emb|CAH67040.1|  OSIGBa0124N08.2                                        278   2e-85    
ref|NP_001053045.1|  Os04g0469500                                       278   3e-85    
ref|XP_006584114.1|  PREDICTED: 6-phosphofructokinase 2-like            276   4e-85    
ref|XP_003579939.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    276   4e-85    
ref|NP_001130878.1|  uncharacterized protein LOC100191982               276   6e-85    
gb|EMT24858.1|  6-phosphofructokinase 2                                 270   9e-85    
ref|XP_003637592.1|  6-phosphofructokinase                              275   1e-84    
ref|XP_004975916.1|  PREDICTED: 6-phosphofructokinase 2-like            275   2e-84    
ref|XP_009418212.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    275   2e-84    
ref|XP_002448010.1|  hypothetical protein SORBIDRAFT_06g019610          275   3e-84    
ref|XP_010683074.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    275   3e-84    
ref|XP_005707027.1|  6-phosphofructokinase isoform 1                    276   4e-84    
ref|XP_002963124.1|  hypothetical protein SELMODRAFT_438337             273   6e-84    
ref|XP_010928044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    273   8e-84    
gb|EMS53637.1|  6-phosphofructokinase 2                                 272   2e-83    
ref|XP_002980196.1|  hypothetical protein SELMODRAFT_178124             272   3e-83    
gb|EPS70355.1|  hypothetical protein M569_04403                         271   5e-83    
ref|XP_004039656.1|  phosphofructokinase, putative                      269   2e-82    
ref|XP_005707028.1|  6-phosphofructokinase isoform 2                    271   2e-82    
dbj|BAK02022.1|  predicted protein                                      270   2e-82    
gb|EYU27630.1|  hypothetical protein MIMGU_mgv1a005772mg                268   8e-82    
ref|XP_005536329.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    268   8e-82    
ref|XP_001008692.1|  Phosphofructokinase family protein                 265   5e-80    
ref|XP_004037415.1|  phosphofructokinase family protein, putative       260   2e-78    
emb|CDP04555.1|  unnamed protein product                                260   3e-78    
gb|KEH21328.1|  6-phosphofructokinase                                   255   5e-78    
gb|EEC84763.1|  hypothetical protein OsI_31779                          269   6e-78    
ref|XP_006293956.1|  hypothetical protein CARUB_v10022950mg             259   7e-78    
ref|XP_009409144.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    255   1e-77    
ref|XP_002993249.1|  hypothetical protein SELMODRAFT_187341             256   1e-77    
ref|XP_009404386.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    256   8e-77    
ref|XP_002969111.1|  hypothetical protein SELMODRAFT_146031             252   2e-76    
emb|CDW89434.1|  6-phosphofructokinase 3-like                           258   2e-76    
ref|XP_001439166.1|  hypothetical protein                               255   2e-76    
ref|XP_010429169.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    255   4e-76    
ref|XP_010417006.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    255   4e-76    
ref|XP_009409142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    254   5e-76    
ref|XP_006404705.1|  hypothetical protein EUTSA_v10000117mg             255   5e-76    
ref|XP_008781839.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    254   5e-76    
ref|XP_008781840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    254   6e-76    
ref|XP_010472236.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    254   7e-76    
ref|NP_850025.1|  6-phosphofructokinase 5                               254   7e-76    
ref|XP_002994206.1|  hypothetical protein SELMODRAFT_138352             251   7e-76    
gb|ADE76905.1|  unknown                                                 250   9e-76    
ref|XP_002505771.1|  phosphofructokinase                                254   1e-75    
emb|CCA20233.1|  unnamed protein product                                252   2e-75    
emb|CDY13756.1|  BnaA09g42580D                                          253   2e-75    
ref|XP_002878619.1|  phosphofructokinase family protein                 253   2e-75    
ref|XP_010917037.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    253   3e-75    
emb|CDX76918.1|  BnaC08g35040D                                          253   4e-75    
gb|KFK32811.1|  hypothetical protein AALP_AA6G290900                    252   4e-75    
ref|XP_010257275.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    252   5e-75    
ref|XP_002973951.1|  hypothetical protein SELMODRAFT_100675             251   7e-75    
emb|CCI46577.1|  unnamed protein product                                250   9e-75    
ref|XP_010662251.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    248   2e-74    
ref|XP_009109420.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    250   2e-74    
emb|CDX90382.1|  BnaA08g16020D                                          250   2e-74    
tpg|DAA50031.1|  TPA: hypothetical protein ZEAMMB73_945143              242   2e-74    
ref|XP_003063812.1|  phosphofructokinase                                251   2e-74    
ref|XP_009112522.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    250   2e-74    
ref|XP_006827209.1|  hypothetical protein AMTR_s00010p00259410          250   3e-74    
ref|XP_010526665.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    250   3e-74    
ref|XP_010258381.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    249   3e-74    
ref|XP_006353187.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    250   3e-74    



>ref|XP_008242459.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=487

 Score =   427 bits (1099),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 230/248 (93%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  211  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVESESVENGIGVVKLMGRYSGFIAMY  270

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE + S 
Sbjct  271  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSEIMHSM  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHFSK+ KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  331  AK-QDASGNKLLQDVGLWISQKIKDHFSKRHKMTINLKYIDPTYMIRAVPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP++RI E QN VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDVIE  745
            LR +DVIE
Sbjct  450  LRAKDVIE  457



>ref|XP_011078226.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=488

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 232/249 (93%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEA+RAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDSAVEEAERAITAAHVEATSIENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLS++L S+
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSDSLRST  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IKDHFSKQ+KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NQ-QDASGNKLLQDVGLWISQRIKDHFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP+ RI E +N VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFYRINESRNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            L  +DV E+
Sbjct  453  LSAKDVAEA  461



>ref|XP_009613573.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=516

 Score =   427 bits (1097),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 233/249 (94%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  242  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  301

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQEL+SE+L  +
Sbjct  302  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEHRLKENGHMVIVIAEGAGQELVSESLRCT  361

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  362  GK-QDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  420

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  421  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITETQNKVVITDRMWARLLSSTNQPSF  480

Query  722  LRTRDVIES  748
            LRTRD+I++
Sbjct  481  LRTRDIIKA  489



>ref|XP_009613574.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009613575.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=491

 Score =   426 bits (1095),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 233/249 (94%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQEL+SE+L  +
Sbjct  277  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEHRLKENGHMVIVIAEGAGQELVSESLRCT  336

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  337  GK-QDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  395

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  396  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITETQNKVVITDRMWARLLSSTNQPSF  455

Query  722  LRTRDVIES  748
            LRTRD+I++
Sbjct  456  LRTRDIIKA  464



>ref|XP_009763926.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009763927.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
Length=490

 Score =   423 bits (1088),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 231/249 (93%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGA QEL+SE+L  +
Sbjct  276  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEHRLKENGHMVIVIAEGAAQELVSESLRCT  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  336  GK-QDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  394

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP+N ITE QN VVITDRMWARLL STNQPSF
Sbjct  395  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNGITETQNKVVITDRMWARLLSSTNQPSF  454

Query  722  LRTRDVIES  748
            LRTRD+I++
Sbjct  455  LRTRDIIKA  463



>ref|XP_009763925.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Nicotiana sylvestris]
Length=515

 Score =   424 bits (1089),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 231/249 (93%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  241  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  300

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGA QEL+SE+L  +
Sbjct  301  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEHRLKENGHMVIVIAEGAAQELVSESLRCT  360

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  361  GK-QDPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  419

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP+N ITE QN VVITDRMWARLL STNQPSF
Sbjct  420  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFNGITETQNKVVITDRMWARLLSSTNQPSF  479

Query  722  LRTRDVIES  748
            LRTRD+I++
Sbjct  480  LRTRDIIKA  488



>gb|EYU30678.1| hypothetical protein MIMGU_mgv1a005513mg [Erythranthe guttata]
Length=481

 Score =   422 bits (1084),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 230/248 (93%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEA+RAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAERAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            AT+ASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMVIV+AEGAGQE+LSE+L   
Sbjct  274  ATIASRDVDCCLIPESPFYLEGRGGLFEYIEKRLKEFGHMVIVIAEGAGQEMLSESLNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQKIKDHFSK++KM INLKYIDPTYMIRAIPS+ASDNVYCT
Sbjct  333  ---KDASGNKLLQDVGLWISQKIKDHFSKERKMTINLKYIDPTYMIRAIPSSASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR+AYIP++RI E QN VVITDRMWARLL ST+QPSF
Sbjct  390  LLAQSAVHGAMAGYTGFTVGPVNGRYAYIPFHRINERQNKVVITDRMWARLLSSTSQPSF  449

Query  722  LRTRDVIE  745
            L T+DV+E
Sbjct  450  LSTKDVVE  457



>ref|XP_007203634.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
 gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
Length=536

 Score =   423 bits (1088),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 229/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  260  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVESESVENGIGLVKLMGRYSGFIAMY  319

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE+ HMVIV+AEGAGQELLSE++ S 
Sbjct  320  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVIAEGAGQELLSESMRSM  379

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHFSK+ KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  380  AK-QDASGNKLLQDVGLWISQKIKDHFSKRNKMTINLKYIDPTYMIRAVPSNASDNVYCT  438

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP++ I E QN VVITDRMWARLL STNQPSF
Sbjct  439  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHSIIEQQNKVVITDRMWARLLSSTNQPSF  498

Query  722  LRTRDVIE  745
            L  +DVIE
Sbjct  499  LCAKDVIE  506



>ref|XP_008354543.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=447

 Score =   419 bits (1076),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 228/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  170  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVESESIENGIGVVKLMGRYSGFIAMY  229

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK L E+ HMVIV+AEGAGQELLSE++ S 
Sbjct  230  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLIENGHMVIVMAEGAGQELLSESIHSM  289

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHF +  KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  290  TK-QDASGNKLLQDVGLWISQKIKDHFKEGNKMSINLKYIDPTYMIRAVPSNASDNVYCT  348

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP++RI E QN VVITDRMWARLL STNQPSF
Sbjct  349  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPSF  408

Query  722  LRTRDVIE  745
            L T+DVIE
Sbjct  409  LSTKDVIE  416



>ref|XP_009337906.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337907.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337917.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337918.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=484

 Score =   419 bits (1077),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 225/246 (91%), Gaps = 4/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQ AISAAHVEA S ENGIGLVKLMGR+SGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQGAISAAHVEAGSIENGIGLVKLMGRFSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELL E++   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERILKENGHMVIVIAEGAGQELLPESMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHFSKQ+KM INLKYIDPTYMIRAIP NASDNVY T
Sbjct  333  ---QDASGNKLLQDVGLWLSQNIRDHFSKQRKMTINLKYIDPTYMIRAIPGNASDNVYST  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDV  739
            L  +DV
Sbjct  450  LDLKDV  455



>ref|XP_009337915.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X4 [Pyrus x bretschneideri]
Length=451

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 223/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  184  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIAMY  243

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  244  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  302

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  303  ---QDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIYCT  359

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  360  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  419

Query  722  L  724
            L
Sbjct  420  L  420



>ref|XP_008337072.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=300

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI++AHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  23   GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINSAHVEAESIENGIGVVKLMGRYSGFIAMY  82

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQ+LLSE+L S 
Sbjct  83   ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVIAEGAGQDLLSESLQSM  142

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK L+DVGLW+S++IK HF +Q+K+ INLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  143  NQ-QDASGNKXLKDVGLWISERIKSHFGRQQKLAINLKYIDPTYMIRAIPSNAADNVYCT  201

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH+YIP+N ITE QN VVITDRMWARLL STNQPSF
Sbjct  202  LLAQSAVHGAMAGYTGFICGPVNGRHSYIPFNHITEKQNKVVITDRMWARLLSSTNQPSF  261

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  262  LNPKDVTE  269



>ref|XP_004253102.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Solanum 
lycopersicum]
Length=485

 Score =   418 bits (1075),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVD CLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELL+E    +
Sbjct  274  ATLASRDVDLCLIPESPFYLEGDGGLFEYIEKRLKENGHMVIVIAEGAGQELLAEENAHA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N++DASGNK+L+DVGLW+SQKI+DHF+K+ KMPI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  KNEQDASGNKLLQDVGLWISQKIRDHFAKKTKMPITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSCVHGAMAGYTGFTSGLVNGRQTYIPFNRITEKQNMVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            LR +D+ E
Sbjct  454  LRVKDIEE  461



>gb|EYU20400.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   417 bits (1073),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 221/246 (90%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRY GFIAMY
Sbjct  206  GIPKTIDNDILVIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYCGFIAMY  265

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEKTLKE+ HMVIV+AEGAGQELL+      
Sbjct  266  ATLASRDVDCCLIPESPFYLEGQGGLFEYIEKTLKENGHMVIVIAEGAGQELLAAKDE--  323

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHFSKQ K+PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  324  ---QDASGNKLLQDVGLWISQKIKDHFSKQGKLPITLKYIDPTYMIRAIPSNASDNVYCT  380

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP NRITEGQN VVITDRMWARLL STNQPSF
Sbjct  381  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEGQNKVVITDRMWARLLSSTNQPSF  440

Query  722  LRTRDV  739
            + T+D+
Sbjct  441  VETKDL  446



>ref|XP_007137260.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
 gb|ESW09254.1| hypothetical protein PHAVU_009G112500g [Phaseolus vulgaris]
Length=339

 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  36   GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGVVKLMGRYSGFIAMY  95

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGAGQ+LL+E++ + 
Sbjct  96   ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQDLLTESMQAM  155

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+S KIKDHF+++ K+ INLKYIDPTYMIRAIPSNASDNV CT
Sbjct  156  DQ-KDASGNKLLQDVGLWISHKIKDHFARKDKIAINLKYIDPTYMIRAIPSNASDNVNCT  214

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY+GFTVG VNGRH YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  215  LLAQSAVHGVMAGYSGFTVGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSF  274

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  275  LSPKDLDEA  283



>gb|EYU20401.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   417 bits (1073),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 208/246 (85%), Positives = 221/246 (90%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRY GFIAMY
Sbjct  206  GIPKTIDNDILVIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYCGFIAMY  265

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEKTLKE+ HMVIV+AEGAGQELL+      
Sbjct  266  ATLASRDVDCCLIPESPFYLEGQGGLFEYIEKTLKENGHMVIVIAEGAGQELLAAKDE--  323

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHFSKQ K+PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  324  ---QDASGNKLLQDVGLWISQKIKDHFSKQGKLPITLKYIDPTYMIRAIPSNASDNVYCT  380

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP NRITEGQN VVITDRMWARLL STNQPSF
Sbjct  381  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEGQNKVVITDRMWARLLSSTNQPSF  440

Query  722  LRTRDV  739
            + T+D+
Sbjct  441  VETKDL  446



>gb|KDP40841.1| hypothetical protein JCGZ_24840 [Jatropha curcas]
Length=542

 Score =   419 bits (1078),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 228/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  271  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESFENGIGLVKLMGRYSGFIAMY  330

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+I K LKEH HMVIV+AEGAGQELLSE++ + 
Sbjct  331  ATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLKEHGHMVIVIAEGAGQELLSESIRAM  390

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L+DVGLW+SQKIKDHF+KQK M I LKYIDPTYMIRA+PSNASDNV CT
Sbjct  391  DH-QDASGNKLLQDVGLWISQKIKDHFAKQKNMNITLKYIDPTYMIRAVPSNASDNVCCT  449

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+TE QN VVITDRMWARLL STNQPSF
Sbjct  450  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTERQNKVVITDRMWARLLSSTNQPSF  509

Query  722  LRTRDVIE  745
            L  RDVI+
Sbjct  510  LDPRDVIK  517



>ref|XP_008375837.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=484

 Score =   417 bits (1073),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 207/246 (84%), Positives = 226/246 (92%), Gaps = 4/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAGSIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF K++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  333  ---QDASGNKLLQDVGLWLSQNIRDHFLKRRKMTINLKYIDPTYMIRAIPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T GQN VVITDRMWARLL STNQPSF
Sbjct  390  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTRGQNKVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDV  739
            L  ++V
Sbjct  450  LDLKEV  455



>ref|XP_010244403.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=547

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/247 (84%), Positives = 226/247 (91%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  275  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  334

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEY+EK LKE+ HMVIV+AEGAG ELLS+++ + 
Sbjct  335  ATLASRDVDCCLIPESPFYLEGPGGLFEYLEKRLKENGHMVIVIAEGAGLELLSQSMRNM  394

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLW+SQ+IKDHFS + KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  395  DQ-KDASGNKLLPDVGLWISQRIKDHFSSRNKMSINLKYIDPTYMIRAIPSNASDNVYCT  453

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH YIP+NR+TE QN VVITDRMWARLL ST QPSF
Sbjct  454  LLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRVTERQNKVVITDRMWARLLSSTTQPSF  513

Query  722  LRTRDVI  742
            +R +++I
Sbjct  514  VRPKELI  520



>ref|XP_009337914.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X3 [Pyrus x bretschneideri]
Length=471

 Score =   416 bits (1070),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 223/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  204  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIAMY  263

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  264  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  322

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  323  ---QDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIYCT  379

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  380  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  439

Query  722  L  724
            L
Sbjct  440  L  440



>ref|XP_009337911.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=484

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 223/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  277  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  336  ---QDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  393  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  452

Query  722  L  724
            L
Sbjct  453  L  453



>ref|XP_011093663.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=531

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/249 (85%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEATSTENGIGLVKLMGRYSGFIAMY
Sbjct  257  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEATSTENGIGLVKLMGRYSGFIAMY  316

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL EYIEK +KE+ HMVIV+AEGAGQELLSE+    
Sbjct  317  ATLASRDVDCCLIPESPFYLEGAGGLLEYIEKRIKENGHMVIVIAEGAGQELLSESAELQ  376

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD+FSK KKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  377  NQ-QDASGNKLLQDVGLWISQKIKDYFSKGKKMAINLKYIDPTYMIRAIPSNASDNVYCT  435

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYT FTVG VNGRHAYIP++RITE QN VVITDRMWARLL STNQPSF
Sbjct  436  LLAQSAVHGAMAGYTSFTVGPVNGRHAYIPFHRITERQNKVVITDRMWARLLLSTNQPSF  495

Query  722  LRTRDVIES  748
                 VI++
Sbjct  496  FSKNGVIQA  504



>ref|XP_008387449.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
 ref|XP_008344002.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=538

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 228/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  261  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVESESIENGIGVVKLMGRYSGFIAMY  320

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK L E+ HMVIV+AEGAGQELLSE++ S 
Sbjct  321  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLIENGHMVIVMAEGAGQELLSESIHSM  380

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHF +  KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  381  TK-QDASGNKLLQDVGLWISQKIKDHFKEGNKMSINLKYIDPTYMIRAVPSNASDNVYCT  439

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP++RI E QN VVITDRMWARLL STNQPSF
Sbjct  440  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIEQQNKVVITDRMWARLLSSTNQPSF  499

Query  722  LRTRDVIE  745
            L T+DVIE
Sbjct  500  LSTKDVIE  507



>ref|XP_009337913.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Pyrus x bretschneideri]
Length=471

 Score =   416 bits (1069),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 223/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  204  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIAMY  263

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  264  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  322

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  323  ---QDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIYCT  379

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  380  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  439

Query  722  L  724
            L
Sbjct  440  L  440



>ref|XP_006342512.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=485

 Score =   416 bits (1069),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVD CLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELL+E    +
Sbjct  274  ATLASRDVDLCLIPESPFYLEGDGGLFEYIEKRLKENGHMVIVIAEGAGQELLAEENAHA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N++DASGNK+L+DVGLW+SQKI+DHF+ + KMPI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  KNEQDASGNKLLQDVGLWISQKIRDHFATKTKMPITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSCVHGAMAGYTGFTSGLVNGRQTYIPFNRITEKQNMVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            LR +D+ E
Sbjct  454  LRVKDIEE  461



>ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=535

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAISAAHVEAESFENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            AT+ASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE + + 
Sbjct  328  ATIASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSEIMHTM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKI+DHF K++KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  388  DQ-QDASGNKLLQDVGLWISQKIRDHFGKKRKMTINLKYIDPTYMIRAVPSNASDNVYCT  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  447  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITERQNRVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDVIES  748
            L  + V +S
Sbjct  507  LDPKKVKQS  515



>ref|XP_007012967.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY30586.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=583

 Score =   419 bits (1078),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 226/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  308  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGLVKLMGRYSGFIAMY  367

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIE+ LKE+ HMVIV+AEGAGQELLSE++ S 
Sbjct  368  ATLASRDVDCCLIPESPFYLEGPGGLFEYIERRLKENGHMVIVIAEGAGQELLSESMQSM  427

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IKD+FSKQ+KMPINLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  428  TK-EDASGNKLLQDVGLWISQRIKDYFSKQRKMPINLKYIDPTYMIRAIPSNASDNVYCT  486

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTGFT G VNGR  YIP+ RI E QN VV TDRMWARLL STNQPSF
Sbjct  487  LLAQSVVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEKQNKVVTTDRMWARLLSSTNQPSF  546

Query  722  LRTRDVIE  745
            L  +DVIE
Sbjct  547  LSAKDVIE  554



>ref|XP_009337916.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X5 [Pyrus x bretschneideri]
Length=481

 Score =   416 bits (1068),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 223/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  333  ---QDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  390  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  449

Query  722  L  724
            L
Sbjct  450  L  450



>gb|KDO51846.1| hypothetical protein CISIN_1g009394mg [Citrus sinensis]
Length=535

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAISAAHVEAESFENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            AT+ASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE + + 
Sbjct  328  ATIASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSEIMHTM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKI+DHF K++KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  388  DQ-QDASGNKLLQDVGLWISQKIRDHFGKKRKMTINLKYIDPTYMIRAVPSNASDNVYCT  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  447  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITERQNRVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDVIES  748
            L  + V +S
Sbjct  507  LDPKKVKQS  515



>ref|XP_006451355.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64595.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=463

 Score =   415 bits (1066),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S+EN IGLVKLMGRYSGFIAMY
Sbjct  176  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMY  235

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQ+LL+E++ S+
Sbjct  236  ATLASRDVDCCLIPESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAESIRSA  295

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQKIKDHF+K+KKMPINLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  296  TQ-QDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCT  354

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+HVVITDRMWARLL STNQPSF
Sbjct  355  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSF  414

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  415  MNHKDVIE  422



>ref|XP_003630682.1| 6-phosphofructokinase [Medicago truncatula]
Length=356

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 222/241 (92%), Gaps = 0/241 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  95   GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLA+RDVDCCLIPE+PF+LEGPGGLFEY E+ LKE+ HMVIV+AEGAGQEL++E++ S 
Sbjct  155  ATLANRDVDCCLIPETPFFLEGPGGLFEYTERRLKENGHMVIVIAEGAGQELVTESIQSM  214

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S K+KD+F+KQK M I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  215  HKQQDASGNKLLQDVGLWISHKLKDYFAKQKTMGITLKYIDPTYMIRAVPSNASDNVYCT  274

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G V+GR AYIP+NRI EGQN VVITDRMWARLL STNQPSF
Sbjct  275  LLAQSAVHGAMAGYTGFTSGLVHGRQAYIPFNRINEGQNTVVITDRMWARLLSSTNQPSF  334

Query  722  L  724
            L
Sbjct  335  L  335



>gb|KHG01593.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
 gb|KHG02572.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=490

 Score =   416 bits (1068),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 224/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESLSIENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+EYIEK LKE+ HMVIV+AEGA  + L    L S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGSGGLYEYIEKRLKENGHMVIVIAEGA-GQDLVSESLQS  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +Q+DASGNK+L+DVGLW+S +IKDHF+K KKMPINLKYIDPTYMIRAIPS ASDNVYCT
Sbjct  333  MDQQDASGNKLLQDVGLWISHRIKDHFAK-KKMPINLKYIDPTYMIRAIPSIASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRHAYIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  392  LLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEKQNKVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  452  LNPKDIAEA  460



>ref|XP_008375836.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=484

 Score =   415 bits (1066),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/241 (85%), Positives = 224/241 (93%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKT+DNDIPVIDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTVDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAGSIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFY+EGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYMEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSESMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHFSKQ+KM INLKYIDPTYMIRAIPSNASDNVY T
Sbjct  333  ---QDASGNKLLQDVGLWLSQNIRDHFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYST  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSA+HGAMAGYTGFTVG VN RHAYIP++R+T+GQN VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAIHGAMAGYTGFTVGPVNRRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQPSF  449

Query  722  L  724
            L
Sbjct  450  L  450



>ref|XP_006357682.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=504

 Score =   416 bits (1068),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 213/250 (85%), Positives = 230/250 (92%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  236  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  295

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LK++ HMVIV+AEGAGQEL+SE+L S+
Sbjct  296  ATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSESLKST  355

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  356  ----DPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  411

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  412  LLAQSAVHGAMAGYTGFTVGPVNHRHAYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  471

Query  722  LRTR-DVIES  748
            LRTR D+I++
Sbjct  472  LRTRVDIIKA  481



>ref|XP_004302844.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=487

 Score =   415 bits (1066),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/241 (87%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELL+E++L+ 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGAGGLFEYIEKRLKENGHMVIVIAEGAGQELLAESMLAM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L+D GLWLSQKIKDHFSK  KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NH-QDASGNKLLQDSGLWLSQKIKDHFSKLNKMSINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGAMAGYTGFTVGSVNGRHAYIP++R+TE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAHSVVHGAMAGYTGFTVGSVNGRHAYIPFHRVTERQNKVVITDRMWARLLSSTNQPSF  452

Query  722  L  724
            L
Sbjct  453  L  453



>ref|XP_006856644.1| hypothetical protein AMTR_s01089p00001250 [Amborella trichopoda]
 gb|ERN18111.1| hypothetical protein AMTR_s01089p00001250 [Amborella trichopoda]
Length=284

 Score =   407 bits (1045),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 217/245 (89%), Gaps = 3/245 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENG+G+VKLMGRYSGFIAMY
Sbjct  15   GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGVGVVKLMGRYSGFIAMY  74

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LKE+ HMVIVVAEGA  + L    +  
Sbjct  75   ATLASRDVDCCLIPESPFYLEGEGGLFEYIGKRLKENGHMVIVVAEGA-GQELVAESIRE  133

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              ++DASGN++L DVGLWLS+KIKDHF+  +KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  134  MGKQDASGNRLLLDVGLWLSEKIKDHFT--RKMVINLKYIDPTYMIRAIPSNASDNVYCT  191

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  192  LLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFYRVTETQNKVVITDRMWARLLSSTNQPSF  251

Query  722  LRTRD  736
            L ++D
Sbjct  252  LTSKD  256



>ref|XP_006451353.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64593.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=512

 Score =   415 bits (1067),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S+EN IGLVKLMGRYSGFIAMY
Sbjct  225  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMY  284

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQ+LL+E++ S+
Sbjct  285  ATLASRDVDCCLIPESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAESIRSA  344

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQKIKDHF+K+KKMPINLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  345  TQ-QDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCT  403

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+HVVITDRMWARLL STNQPSF
Sbjct  404  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSF  463

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  464  MNHKDVIE  471



>ref|XP_010051556.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW82287.1| hypothetical protein EUGRSUZ_C03703 [Eucalyptus grandis]
Length=486

 Score =   414 bits (1064),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 229/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVK+MGRYSGFIAMY
Sbjct  211  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESGENGIGLVKVMGRYSGFIAMY  270

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGP GLFEYIE+ LKE+ HMVIV+AEGAGQELLSE++ S+
Sbjct  271  ATLASRDVDCCLIPESPFYLEGPCGLFEYIERRLKENGHMVIVIAEGAGQELLSESMQSA  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWLSQKIK+HF+K+ KM INLK+IDPTYMIRA+PSNASDNVYCT
Sbjct  331  DK-KDASGNKLLRDVGLWLSQKIKEHFAKKAKMIINLKHIDPTYMIRAVPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGRH+YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGFTSGLVNGRHSYIPFYRITEKQNNVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  450  MSAKDVIE  457



>ref|XP_004243602.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Solanum 
lycopersicum]
Length=490

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 230/250 (92%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LK++ HMVIV+AEGAGQEL+SE+L S+
Sbjct  277  ATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSESLKST  336

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  337  ----DPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN R+AYIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTR-DVIES  748
            LRTR D+I++
Sbjct  453  LRTRVDIIKA  462



>ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
 gb|ESR40087.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
Length=576

 Score =   417 bits (1071),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/246 (84%), Positives = 225/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAISAAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAISAAHVEAESFENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            AT+ASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE + + 
Sbjct  328  ATIASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELLSEIMHTM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKI+DHF K++KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  388  DQ-QDASGNKLLQDVGLWISQKIRDHFGKKRKMTINLKYIDPTYMIRAVPSNASDNVYCT  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  447  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRITERQNRVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDV  739
            L  + +
Sbjct  507  LDPKKI  512



>ref|XP_007223382.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
 ref|XP_008220132.1| PREDICTED: 6-phosphofructokinase 6 [Prunus mume]
 gb|EMJ24581.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
Length=500

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  223  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  282

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQ+LLSE+L S 
Sbjct  283  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEKRLKENGHMVIVIAEGAGQDLLSESLQSM  342

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IK+HF +Q+K+ INLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  343  NQ-QDASGNKLLKDVGLWISQRIKNHFGRQQKISINLKYIDPTYMIRAIPSNAADNVYCT  401

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH+YIP+N ITE QN VVITDRMWARLL STNQPSF
Sbjct  402  LLAQSAVHGAMAGYTGFICGPVNGRHSYIPFNHITEKQNKVVITDRMWARLLSSTNQPSF  461

Query  722  LRTRDVIE  745
            L  +DVIE
Sbjct  462  LNPKDVIE  469



>ref|XP_009602786.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Nicotiana tomentosiformis]
Length=500

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+++K L+E  HMVIV+AEGAGQELL+E    +
Sbjct  274  ATLASRDVDCCLIPESPFYLEGSGGLFEFVKKRLREDGHMVIVIAEGAGQELLAEENSHA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +++DASGNK+L+DVGLW+SQKI+DHF K+ ++PI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  RSEQDASGNKLLQDVGLWVSQKIRDHFEKKLRIPITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            +LAQS VHGAMAGYTGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  394  ILAQSCVHGAMAGYTGFTSGVVNGRQTYIPFNRITEKQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            L T+D++E
Sbjct  454  LSTKDIVE  461



>ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN18140.1| 6-phosphofructokinase 3 [Glycine soja]
Length=507

 Score =   414 bits (1064),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGAGQ+LL+E++ + 
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQDLLTESMQAM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+S KIKDHF+++ KMPINLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  335  DQ-KDASGNKLLQDVGLWISHKIKDHFARKDKMPINLKYIDPTYMIRAIPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR  YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFIRINERQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  454  LSPKDLEEA  462



>ref|XP_006475360.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=561

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S+EN IGLVKLMGRYSGFIAMY
Sbjct  274  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMY  333

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQ+LL+E++ S+
Sbjct  334  ATLASRDVDCCLIPESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAESIRSA  393

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQKIKDHF+K+KKMPINLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  394  TQ-QDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCT  452

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+HVVITDRMWARLL STNQPSF
Sbjct  453  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSF  512

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  513  MNHKDVIE  520



>ref|XP_006451354.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64594.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=561

 Score =   416 bits (1069),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S+EN IGLVKLMGRYSGFIAMY
Sbjct  274  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMY  333

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LKE+ HMVIV+AEGAGQ+LL+E++ S+
Sbjct  334  ATLASRDVDCCLIPESPFYLEGHGGLFEYIETRLKENGHMVIVIAEGAGQDLLAESIRSA  393

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQKIKDHF+K+KKMPINLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  394  TQ-QDASGNKLLQDVGLWLSQKIKDHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCT  452

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+HVVITDRMWARLL STNQPSF
Sbjct  453  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSF  512

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  513  MNHKDVIE  520



>ref|XP_010526423.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Tarenaya 
hassleriana]
Length=489

 Score =   413 bits (1062),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 223/247 (90%), Gaps = 3/247 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEATSTENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEATSTENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGA-GQELLSESIQS  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM I+LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  333  MTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTISLKYIDPTYMIRAIPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH YIP++RITE QN VVITDRMWARLL ST+QPSF
Sbjct  391  LLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFDRITEKQNKVVITDRMWARLLSSTHQPSF  450

Query  722  LRTRDVI  742
            +  +DV+
Sbjct  451  VSHKDVL  457



>ref|XP_004243600.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Solanum 
lycopersicum]
Length=509

 Score =   414 bits (1063),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 230/250 (92%), Gaps = 5/250 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAISAAHVEATS ENGIGLVKLMGR SGFIAMY
Sbjct  236  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMY  295

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  LK++ HMVIV+AEGAGQEL+SE+L S+
Sbjct  296  ATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRLKDNGHMVIVIAEGAGQELVSESLKST  355

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                D SGNK+L+DVGLW+S++IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  356  ----DPSGNKLLQDVGLWISERIKEHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCT  411

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN R+AYIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  412  LLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  471

Query  722  LRTR-DVIES  748
            LRTR D+I++
Sbjct  472  LRTRVDIIKA  481



>ref|XP_011094240.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=489

 Score =   413 bits (1061),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 203/245 (83%), Positives = 221/245 (90%), Gaps = 5/245 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEKTLKE+ HMVIV+AEGAGQELL+      
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKTLKENGHMVIVIAEGAGQELLAAKNE--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIK+HF+K+ KMPI LKYIDPTYMIRAIPSN SDNVYCT
Sbjct  332  ---EDASGNKLLQDVGLWISQKIKEHFAKKNKMPITLKYIDPTYMIRAIPSNGSDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGFTGFTSGLVNGRQTYIPFNRITEKQNKVVITDRMWARLLASTNQPSF  448

Query  722  LRTRD  736
            L +++
Sbjct  449  LGSKE  453



>ref|XP_009603443.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Nicotiana tomentosiformis]
Length=485

 Score =   412 bits (1060),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+EYIEK LKE+ HMVIV+AEGAGQELL+     +
Sbjct  274  ATLASRDVDCCLIPESPFYLEGDGGLYEYIEKRLKENGHMVIVIAEGAGQELLAAENSLA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N++DASGNK+L+DVGLW+SQKI+DHF+K+ KM I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  KNEQDASGNKLLQDVGLWISQKIRDHFAKKPKMAITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFNRITEKQNMVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  454  LCPKDVEE  461



>ref|XP_009758764.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Nicotiana 
sylvestris]
Length=485

 Score =   412 bits (1060),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+EYIEK LKE+ HMVIV+AEGAGQELL+     +
Sbjct  274  ATLASRDVDCCLIPESPFYLEGDGGLYEYIEKRLKENGHMVIVIAEGAGQELLAAENSLA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N++DASGNK+L+DVGLW+SQKI+DHF+K+ KM I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  KNEQDASGNKLLQDVGLWISQKIRDHFAKKPKMAITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSCVHGAMAGYTGYTSGLVNGRQTYIPFNRITEKQNMVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  454  LCPKDVEE  461



>ref|XP_010267094.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=490

 Score =   412 bits (1060),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEY+EK LKE+ HM+IV+AEGAGQELLSE++ + 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLFEYMEKRLKENGHMIIVMAEGAGQELLSESMHTM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S+ IKDHF+K++KM INLKYIDPTYMIRA+P NASDNVYCT
Sbjct  334  DQ-QDASGNKLLQDVGLWISESIKDHFTKKRKMIINLKYIDPTYMIRAVPGNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGA AGYTGFTVG VNGRHAYIP++R+TE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAHSVVHGAFAGYTGFTVGPVNGRHAYIPFHRVTEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            L+ +D+  S
Sbjct  453  LKPKDITVS  461



>gb|KHM99825.1| 6-phosphofructokinase 3 [Glycine soja]
Length=471

 Score =   412 bits (1058),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+ EK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  274  ATLASRDVDCCLIPESPFHLEGPGGLFEFTEKRLKENGHMVIVIAEGAGQELVSESIQSL  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHF+KQK M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  NK-QDASGNKLLQDVGLWISQKIKDHFTKQKTMTINLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITEGQN V+ITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               + V E
Sbjct  453  TIAKTVSE  460



>ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN10174.1| 6-phosphofructokinase 3 [Glycine soja]
Length=509

 Score =   413 bits (1061),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 227/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LL+E++ + 
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLFEFIQKRLKENGHMVIVIAEGAGQDLLTESMQAM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+S KIKDHF+++ K+PINLKYIDPTYMIRAI SNASDNVYCT
Sbjct  335  DQ-KDASGNKLLQDVGLWISHKIKDHFARKDKIPINLKYIDPTYMIRAIQSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH YIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRINERQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  454  LSPKDLEEA  462



>ref|XP_003524412.1| PREDICTED: 6-phosphofructokinase 7-like [Glycine max]
Length=471

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+ EK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  274  ATLASRDVDCCLIPESPFHLEGPGGLFEFTEKRLKENGHMVIVIAEGAGQELVSESIQSL  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHF+KQK M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  HK-QDASGNKLLQDVGLWISQKIKDHFTKQKTMTINLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITEGQN V+ITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               + V E
Sbjct  453  TIAKTVSE  460



>ref|XP_010086908.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=485

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 226/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVE+ S EN IGLVKLMGRYSGFIAMY
Sbjct  208  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVESESFENCIGLVKLMGRYSGFIAMY  267

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIVVAEGAGQELLSE++ S 
Sbjct  268  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVVAEGAGQELLSESIHSM  327

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IKDHF+K+ KM INLKYIDPTYMIRAIPSNASDNVY T
Sbjct  328  TK-EDASGNKLLKDVGLWISQQIKDHFAKKNKMTINLKYIDPTYMIRAIPSNASDNVYST  386

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR +YIP+ +ITE  N VVITDRMWARLL STNQPSF
Sbjct  387  LLAQSAVHGAMAGYTGFTVGLVNGRQSYIPFYKITEKMNKVVITDRMWARLLSSTNQPSF  446

Query  722  LRTRDVIE  745
            L  +DVIE
Sbjct  447  LSVKDVIE  454



>ref|XP_007152950.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
 gb|ESW24944.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
Length=531

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 223/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  254  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  313

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  314  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  373

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKDHF++QK +PI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  374  ST-QDASGNKLLQDVGLWISQKIKDHFAEQKTLPITLKYIDPTYMIRAVPSNASDNVYCT  432

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  433  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  492

Query  722  LRTR  733
            L  +
Sbjct  493  LDVK  496



>ref|XP_003532467.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=473

 Score =   410 bits (1055),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+ EK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  274  ATLASRDVDCCLIPESPFHLEGPGGLFEFTEKRLKENGHMVIVIAEGAGQELVSESIQSL  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD+F+KQK+M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  NK-QDASGNKLLQDVGLWISQKIKDYFNKQKRMTINLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITEGQN V+ITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               + V E
Sbjct  453  TIAKTVSE  460



>gb|KHN16662.1| 6-phosphofructokinase 3 [Glycine soja]
Length=473

 Score =   410 bits (1055),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+ EK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  274  ATLASRDVDCCLIPESPFHLEGPGGLFEFTEKRLKENGHMVIVIAEGAGQELVSESIQSL  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD+F+KQK+M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  NK-QDASGNKLLQDVGLWISQKIKDYFNKQKRMTINLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITEGQN V+ITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               + V E
Sbjct  453  TIAKTVSE  460



>gb|KCW69691.1| hypothetical protein EUGRSUZ_F03086 [Eucalyptus grandis]
Length=422

 Score =   408 bits (1049),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 223/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAM+
Sbjct  127  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGLVKLMGRYSGFIAMH  186

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EY+E+ LKE  HMVIV+AEGAGQELLSE++ + 
Sbjct  187  ATLASRDVDCCLIPESPFYLEGPGGLYEYVERKLKEDGHMVIVIAEGAGQELLSESMRNM  246

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L DVGLW+SQKIKDHF++ +KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  247  QQA-DASGNKLLNDVGLWISQKIKDHFARTQKMLINLKYIDPTYMIRAVPSNASDNVYCT  305

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  306  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFYRINETQHKVVITDRMWARLLSSTNQPSF  365

Query  722  LRTRDV  739
            L  ++V
Sbjct  366  LDLKEV  371



>ref|XP_010925504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Elaeis guineensis]
Length=498

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 205/247 (83%), Positives = 220/247 (89%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIAVIDKSFGFDSAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMV+VVAEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVLVVAEGA-GQELMAENMRS  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
               +DASGNK+L DVGLWLSQKIKDHF S++KKM INLKYIDPTYMIRAIPSNASDNVYC
Sbjct  333  MGHEDASGNKLLLDVGLWLSQKIKDHFASRKKKMAINLKYIDPTYMIRAIPSNASDNVYC  392

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLA SA+HGAMAGYTGFTVG VNGRHAYIP++RITE QN VVITDRMWARLL STNQPS
Sbjct  393  TLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRITEAQNKVVITDRMWARLLSSTNQPS  452

Query  719  FLRTRDV  739
            FL  +DV
Sbjct  453  FLSHKDV  459



>emb|CDP03227.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   410 bits (1055),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/249 (83%), Positives = 230/249 (92%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDIPVIDKSFGFD+ VEEAQRAI+AAHVEATS ENGIG+VKLMGR SGFIAM+
Sbjct  214  GVPKTIDNDIPVIDKSFGFDSTVEEAQRAINAAHVEATSVENGIGVVKLMGRNSGFIAMH  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+GPGGL+EYIEK LKE  HMVIV+AEGAGQELLS++L S+
Sbjct  274  ATLASRDVDCCLIPESPFYLDGPGGLYEYIEKRLKEQGHMVIVIAEGAGQELLSQSLQST  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IK+HF+K++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  DQ-QDASGNKLLQDVGLWISQSIKNHFAKEQKMAINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH YIP++RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNGRHCYIPFHRINERQHKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            L TRD+IE+
Sbjct  453  L-TRDIIEN  460



>ref|XP_009367416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=494

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  217  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQ+LLSE+L S 
Sbjct  277  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVIAEGAGQDLLSESLQSM  336

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S++IK HF +Q+K+ INLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  337  NQ-QDASGNKLLQDVGLWISERIKSHFGRQQKLAINLKYIDPTYMIRAIPSNAADNVYCT  395

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH+YIP+N ITE QN VVITDRMWARLL STNQPSF
Sbjct  396  LLAQSAVHGAMAGYTGFVCGPVNGRHSYIPFNHITEKQNKVVITDRMWARLLSSTNQPSF  455

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  456  LNPKDVTE  463



>gb|AAB88875.1| pyrophosphate-dependent phosphofructo-1-kinase [Prunus armeniaca]
Length=282

 Score =   403 bits (1035),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 222/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  5    GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  64

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQ+LLSE+L S 
Sbjct  65   ATLASRDVDCCLIPESPFYLEGRGGLFEYIEKRLKENGHMVIVIAEGAGQDLLSESLQSM  124

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DV   +SQKIK+HF +Q+K+ INLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  125  NQ-QDASGNKLLKDVAYGISQKIKNHFGRQQKISINLKYIDPTYMIRAIPSNAADNVYCT  183

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG M GYTGF  G VNGRH+YIP+N ITE QN VVITDRMWARLL STNQP+F
Sbjct  184  LLAQSAVHGPMGGYTGFICGPVNGRHSYIPFNHITEKQNKVVITDRMWARLLSSTNQPTF  243

Query  722  LRTRDVIE  745
            L  +DVIE
Sbjct  244  LNPKDVIE  251



>emb|CBI27972.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   410 bits (1055),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S EN IG+VKLMGRYSGFIAM+
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENCIGVVKLMGRYSGFIAMH  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE++  +
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVMAEGAGQELLSESMRYA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKI+DHFS  K+M I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  DK-QDASGNKLLQDVGLWISQKIRDHFSTSKRMGITLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFYRIIERQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
            L   D+IE
Sbjct  453  LSPEDIIE  460



>ref|XP_010924465.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X2 [Elaeis 
guineensis]
Length=363

 Score =   406 bits (1043),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 219/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  95   GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAASIENGIGLVKLMGRYSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIVVAEGA  + L    L S
Sbjct  155  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVVAEGA-GQDLIAESLRS  213

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVG WLSQKIKDHF++++ M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  214  MQHEDASGNKLLDDVGFWLSQKIKDHFTRKQMMVINLKYIDPTYMIRAIPSNASDNVYCT  273

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRH YIP++R+TE  N VVITDRMWAR+L STNQPSF
Sbjct  274  LLAHSAVHGAMAGYTGFTVGLVNGRHTYIPFHRMTE-TNKVVITDRMWARVLSSTNQPSF  332

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  333  LCAKDIEEA  341



>gb|AIE47275.1| phosphofructokinase [Hevea brasiliensis]
Length=551

 Score =   412 bits (1060),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 223/248 (90%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAM+
Sbjct  268  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESMENGIGLVKLMGRYSGFIAMH  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMVIV+AEGAGQELLSE + S+
Sbjct  328  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKEDGHMVIVIAEGAGQELLSETMQSN  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L D+GLW+S +IK+HFSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  388  Q--QDASGNKLLRDIGLWISHRIKEHFSKQKKMTINLKYIDPTYMIRAIPSNASDNVYCT  445

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  446  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  505

Query  722  LRTRDVIE  745
               +DVIE
Sbjct  506  WSAKDVIE  513



>ref|XP_008795494.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=370

 Score =   405 bits (1042),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 224/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  92   GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGLVKLMGRYSGFIAMY  151

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIVVAEGAGQ+L++E+  S 
Sbjct  152  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVVAEGAGQDLIAESPQSF  211

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +  DASGNK+L DVGLWLSQKIKDHF++++KM INLKYIDPTYMIRAIPSNASDNV CT
Sbjct  212  HHA-DASGNKLLHDVGLWLSQKIKDHFTRKQKMAINLKYIDPTYMIRAIPSNASDNVACT  270

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQ AVHGAMAGYTGFTVG VNGRH YIP++R+T+  N VVITDRMWARLL STNQPSF
Sbjct  271  LLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFHRLTK-TNKVVITDRMWARLLSSTNQPSF  329

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  330  LSAKDIEEA  338



>ref|XP_004503509.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=479

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 224/247 (91%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPE+PFYLEGPGGLFE+ EK LKE+ HMVIV+AEGAGQEL+SE++ + 
Sbjct  274  ATLASRDVDCCLIPETPFYLEGPGGLFEFAEKRLKENGHMVIVIAEGAGQELVSESIQAM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQK+KD+F+ QK M I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  QK-QDASGNKLLQDVGLWISQKLKDYFANQKTMGITLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G V+GR  YIP+NRITEGQN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVHGRQTYIPFNRITEGQNTVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVI  742
            L  + VI
Sbjct  453  LMAKTVI  459



>ref|XP_002283274.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Vitis 
vinifera]
Length=539

 Score =   411 bits (1057),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S EN IG+VKLMGRYSGFIAM+
Sbjct  262  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENCIGVVKLMGRYSGFIAMH  321

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIV+AEGAGQELLSE++  +
Sbjct  322  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVMAEGAGQELLSESMRYA  381

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKI+DHFS  K+M I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  382  DK-QDASGNKLLQDVGLWISQKIRDHFSTSKRMGITLKYIDPTYMIRAVPSNASDNVYCT  440

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  441  LLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFYRIIERQNKVVITDRMWARLLSSTNQPSF  500

Query  722  LRTRDVIE  745
            L   D+IE
Sbjct  501  LSPEDIIE  508



>gb|EYU29302.1| hypothetical protein MIMGU_mgv1a005820mg [Erythranthe guttata]
Length=469

 Score =   409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 218/242 (90%), Gaps = 5/242 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAM+
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMH  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEY+EK LKE+ HMVIV+AEGA QELL+      
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEYMEKRLKENGHMVIVIAEGAAQELLTAKNE--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIK+HF+KQ K+PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  332  ---EDASGNKLLQDVGLWISQKIKEHFAKQNKIPITLKYIDPTYMIRAIPSNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGRH  IP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGRHTCIPFNRITEKQNKVVITDRMWARLLSSTNQPSF  448

Query  722  LR  727
            L+
Sbjct  449  LK  450



>ref|XP_008795493.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=373

 Score =   405 bits (1041),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/249 (82%), Positives = 224/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  95   GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGLVKLMGRYSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIVVAEGAGQ+L++E+  S 
Sbjct  155  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVVAEGAGQDLIAESPQSF  214

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +  DASGNK+L DVGLWLSQKIKDHF++++KM INLKYIDPTYMIRAIPSNASDNV CT
Sbjct  215  HHA-DASGNKLLHDVGLWLSQKIKDHFTRKQKMAINLKYIDPTYMIRAIPSNASDNVACT  273

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQ AVHGAMAGYTGFTVG VNGRH YIP++R+T+  N VVITDRMWARLL STNQPSF
Sbjct  274  LLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFHRLTK-TNKVVITDRMWARLLSSTNQPSF  332

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  333  LSAKDIEEA  341



>gb|KDP33769.1| hypothetical protein JCGZ_07340 [Jatropha curcas]
Length=558

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/248 (84%), Positives = 226/248 (91%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAM+
Sbjct  275  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGLVKLMGRYSGFIAMH  334

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELL+E + S+
Sbjct  335  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKCLKENGHMVIVIAEGAGQELLTETMQST  394

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD F+K++KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  395  Q--QDASGNKLLQDVGLWISQKIKDFFAKKRKMTINLKYIDPTYMIRAVPSNASDNVYCT  452

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP++RITE QN VVITDRMWARLL STNQPSF
Sbjct  453  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFHRITEKQNKVVITDRMWARLLSSTNQPSF  512

Query  722  LRTRDVIE  745
               +DVIE
Sbjct  513  WCHKDVIE  520



>ref|XP_004245136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Solanum lycopersicum]
Length=500

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 225/248 (91%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+L+G GGLFE+++K L+E  HMVIV+AEGAGQELL+    ++
Sbjct  274  ATLASRDVDCCLIPESPFFLDGSGGLFEFVKKRLREEGHMVIVIAEGAGQELLAAENSNA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G+Q+DASGNK+L+DVGLW+S KI+DHF K+ KMPI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  GSQQDASGNKLLQDVGLWVSHKIRDHFGKKLKMPITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            +LAQS VHGAMAGYTGFT G VNGR  Y+P+NRITE QN+VVITDRMWARLL STNQPSF
Sbjct  394  ILAQSCVHGAMAGYTGFTSGIVNGRQTYLPFNRITEKQNNVVITDRMWARLLASTNQPSF  453

Query  722  LRTRDVIE  745
            L T D+++
Sbjct  454  LSTNDIVQ  461



>ref|XP_010925503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Elaeis guineensis]
Length=552

 Score =   411 bits (1057),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 205/247 (83%), Positives = 220/247 (89%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIAVIDKSFGFDSAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMV+VVAEGA  + L    + S
Sbjct  328  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVLVVAEGA-GQELMAENMRS  386

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
               +DASGNK+L DVGLWLSQKIKDHF S++KKM INLKYIDPTYMIRAIPSNASDNVYC
Sbjct  387  MGHEDASGNKLLLDVGLWLSQKIKDHFASRKKKMAINLKYIDPTYMIRAIPSNASDNVYC  446

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLA SA+HGAMAGYTGFTVG VNGRHAYIP++RITE QN VVITDRMWARLL STNQPS
Sbjct  447  TLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRITEAQNKVVITDRMWARLLSSTNQPS  506

Query  719  FLRTRDV  739
            FL  +DV
Sbjct  507  FLSHKDV  513



>ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
 gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
Length=489

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 217/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMVIV+AEGA  +      + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGA-GQDQMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF KQKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLKDVGLWLSQSIKDHF-KQKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIES  748
            L  +DV ++
Sbjct  452  LCPKDVADN  460



>ref|XP_003630681.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET05157.1| 6-phosphofructokinase [Medicago truncatula]
Length=475

 Score =   408 bits (1049),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 222/241 (92%), Gaps = 0/241 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLA+RDVDCCLIPE+PF+LEGPGGLFEY E+ LKE+ HMVIV+AEGAGQEL++E++ S 
Sbjct  274  ATLANRDVDCCLIPETPFFLEGPGGLFEYTERRLKENGHMVIVIAEGAGQELVTESIQSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S K+KD+F+KQK M I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  HKQQDASGNKLLQDVGLWISHKLKDYFAKQKTMGITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G V+GR AYIP+NRI EGQN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGYTGFTSGLVHGRQAYIPFNRINEGQNTVVITDRMWARLLSSTNQPSF  453

Query  722  L  724
            L
Sbjct  454  L  454



>gb|AIE47274.1| phosphofructokinase [Hevea brasiliensis]
Length=545

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 227/248 (92%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAM+
Sbjct  270  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESFENGIGVVKLMGRYSGFIAMH  329

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+I K LKEH HMVIV+AEGAGQELLSE++ + 
Sbjct  330  ATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLKEHGHMVIVIAEGAGQELLSESMRAM  389

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD+F+ ++KM I LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  390  DQ-QDASGNKLLQDVGLWISQKIKDNFANREKMNITLKYIDPTYMIRAIPSNASDNVYCT  448

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++R+TE QN VVITDRMWARLL STNQPSF
Sbjct  449  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTERQNKVVITDRMWARLLSSTNQPSF  508

Query  722  LRTRDVIE  745
            +  + VI+
Sbjct  509  VDPKQVIK  516



>ref|XP_010541000.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Tarenaya 
hassleriana]
Length=488

 Score =   409 bits (1050),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 220/246 (89%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEATSTENGIGLVKLMGRYSGFIAM+
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEATSTENGIGLVKLMGRYSGFIAMH  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKENGHMVIVIAEGA-GQELLSESMQS  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L D+GLW+S +IKDHF+  KKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  333  MTLKDASGNKLLHDIGLWISHRIKDHFA--KKMTINLKYIDPTYMIRAIPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFYRITEKQNEVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDV  739
            +  ++V
Sbjct  451  MNHKEV  456



>ref|XP_002514189.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF48143.1| phosphofructokinase, putative [Ricinus communis]
Length=632

 Score =   413 bits (1062),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 222/248 (90%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  273  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGLVKLMGRYSGFIAMY  332

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELLS+     
Sbjct  333  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKENGHMVIVIAEGAGQELLSQQSTL-  391

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGL++SQ+IKD FSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  392  ---QDASGNKLLQDVGLYISQRIKDFFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  448

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  449  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITESQNKVVITDRMWARLLSSTNQPSF  508

Query  722  LRTRDVIE  745
            L   D+ E
Sbjct  509  LCKDDIEE  516



>ref|XP_008348488.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=540

 Score =   410 bits (1054),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/241 (84%), Positives = 219/241 (91%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  266  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGFVKLMGRYSGFIAMY  325

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATL SRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE  H+VIV+AEGAGQELL+E++   
Sbjct  326  ATLGSRDVDCCLIPESPFYLEGPGGLYEYIERRLKEDGHLVIVMAEGAGQELLAESMNQ-  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHFSKQ+ M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  385  ---QDASGNKLLQDVGLWLSQNIRDHFSKQRNMAINLKYIDPTYMIRAIPSNASDNVYCT  441

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  442  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFRRVTERQNKVVITDRMWARLLSSTNQPSF  501

Query  722  L  724
            L
Sbjct  502  L  502



>gb|AIE47270.1| phosphofructokinase [Hevea brasiliensis]
Length=475

 Score =   408 bits (1048),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 225/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LLS++L S 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEFIKKRLKENGHMVIVIAEGAGQDLLSKSLQSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S +IKDHF+K+ KM I LKYIDPTYMIRAIP+NASDNVYCT
Sbjct  334  DQ-QDASGNKLLQDVGLWISHRIKDHFAKENKMNITLKYIDPTYMIRAIPANASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+NR+TE QN VVITDRMWARLL ST+QPSF
Sbjct  393  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFNRVTEKQNKVVITDRMWARLLSSTDQPSF  452

Query  722  LRTRDV  739
            +  + V
Sbjct  453  MSPKVV  458



>ref|XP_006583562.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
Length=434

 Score =   406 bits (1044),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  152  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  211

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+EYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  212  ATLASRDVDCCLIPESPFYLEGTGGLYEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  271

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQKI+DHF+ QK +PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  272  SK-QDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCT  330

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  331  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  390

Query  722  LRTR  733
            L ++
Sbjct  391  LDSK  394



>ref|XP_008794086.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008794087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   409 bits (1050),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 209/250 (84%), Positives = 225/250 (90%), Gaps = 2/250 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMV+VVAEGAGQE ++EN+ S 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVLVVAEGAGQEFIAENMRSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
             +  DASGNK L DVG WLSQKIKDHF S++KKM INLKYIDPTYMIRAIPSNASDNVYC
Sbjct  334  DHA-DASGNKQLLDVGFWLSQKIKDHFASRKKKMVINLKYIDPTYMIRAIPSNASDNVYC  392

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLA SA+HGAMAGYTGFT+G VNGRHAYIP++RITE QN VVITDRMWARLL STNQPS
Sbjct  393  TLLAHSAIHGAMAGYTGFTIGPVNGRHAYIPFHRITETQNKVVITDRMWARLLSSTNQPS  452

Query  719  FLRTRDVIES  748
            FL  +DV +S
Sbjct  453  FLSHKDVEDS  462



>ref|XP_010526087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Tarenaya hassleriana]
Length=459

 Score =   407 bits (1045),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 222/244 (91%), Gaps = 4/244 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK L+E++HMVIV+AEGAGQEL++E++   
Sbjct  277  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLRENEHMVIVIAEGAGQELVAESMEQ-  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIK+HF+K  KM I LKYIDPTYMIRA+P+NASDNVYCT
Sbjct  336  ---QDASGNKLLKDVGLWMSDKIKEHFAKLNKMAITLKYIDPTYMIRAVPANASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR  YIP NRITE QN+VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGLVNGRQTYIPLNRITERQNNVVITDRMWARLLSSTNQPSF  452

Query  722  LRTR  733
            +  +
Sbjct  453  MNPK  456



>ref|XP_004513074.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=488

 Score =   408 bits (1048),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 223/248 (90%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  211  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  270

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE+ HMVIV+AEGAGQELLSE+    
Sbjct  271  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVIAEGAGQELLSESSDK-  329

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKDHF+++K + I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  330  ---QDASGNKLLQDVGLWISQSIKDHFAREKTLAITLKYIDPTYMIRAVPSNASDNVYCT  386

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  387  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNNVVITDRMWARLLSSTNQPSF  446

Query  722  LRTRDVIE  745
            + T+D  E
Sbjct  447  MNTKDANE  454



>ref|XP_002275308.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 ref|XP_010648295.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 emb|CBI20597.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   407 bits (1047),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 205/248 (83%), Positives = 227/248 (92%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGMVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ HMVIV+AEGAGQELLSE+LLS 
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLFEFIERRLKENGHMVIVMAEGAGQELLSESLLSM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +DASGN +L+DVGLW+S +IKDHF++Q+K+ INLKYIDPTYMIRAIP NASDNVYCT
Sbjct  335  G--QDASGNNLLQDVGLWMSHRIKDHFARQRKIAINLKYIDPTYMIRAIPGNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT+G VNGRHAYIP++RI E +N VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINESRNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               +DV E
Sbjct  453  QNPKDVAE  460



>ref|XP_004135681.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 ref|XP_004158426.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 gb|KGN66195.1| hypothetical protein Csa_1G575110 [Cucumis sativus]
Length=492

 Score =   408 bits (1048),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 221/248 (89%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRY GFIAMY
Sbjct  218  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESMENGIGLVKLMGRYCGFIAMY  277

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYI + LK++ HMVIV+AEGAGQELLS +  S 
Sbjct  278  ATLASRDVDCCLIPESPFYLEGPGGLYEYIARCLKDNGHMVIVIAEGAGQELLSGSCGSD  337

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+D+GLWLSQ+IKDHFSK+ KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  338  K--QDASGNKLLQDIGLWLSQRIKDHFSKEHKMTINLKYIDPTYMIRAIPSNASDNVYCT  395

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RI + QN VVITDRMWARLL STNQPSF
Sbjct  396  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRIVDKQNKVVITDRMWARLLSSTNQPSF  455

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  456  LTVKDVSE  463



>ref|XP_006285234.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
 gb|EOA18132.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
Length=473

 Score =   407 bits (1046),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 221/242 (91%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I+K LKE  HMVIV+AEGAGQ+LLSE++  S
Sbjct  276  ATLASRDVDCCLIPESPFFLEGPGGLFEFIDKRLKESGHMVIVIAEGAGQDLLSESIEES  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  336  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LR  727
            +R
Sbjct  454  MR  455



>ref|XP_007012201.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
 gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
Length=479

 Score =   407 bits (1046),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 220/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFI MY
Sbjct  203  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAGSIENGIGLVKLMGRYSGFITMY  262

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+IEK LKE+ HMVIV+AEGA  + L    L S
Sbjct  263  ATLASRDVDCCLIPESPFYLEGRGGLYEFIEKRLKENGHMVIVIAEGA-GQDLLSESLQS  321

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S +IK+HFSK K+MPINLKYIDPTYMIRAIPS ASDNVYCT
Sbjct  322  MGQQDASGNKLLQDVGLWISHRIKEHFSK-KRMPINLKYIDPTYMIRAIPSIASDNVYCT  380

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGF VG VNGRHAYIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  381  LLAHSAVHGAMAGYTGFIVGPVNGRHAYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  440

Query  722  LRTRDVIES  748
            L  RD+ E+
Sbjct  441  LNPRDISEA  449



>ref|XP_010447879.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
 ref|XP_010447880.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
Length=472

 Score =   407 bits (1046),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 222/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGPGGLFEFIAKRLKESGHMVIVIAEGAGQDLLAESIEES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDV  739
            ++  D+
Sbjct  453  MKHEDI  458



>ref|NP_567742.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
 sp|Q94AA4.1|PFKA3_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 3; Short=ATP-PFK 
3; Short=Phosphofructokinase 3; AltName: Full=Phosphohexokinase 
3 [Arabidopsis thaliana]
 gb|AAK83587.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AAL90928.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AEE85178.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
Length=489

 Score =   407 bits (1047),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 218/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLKDVGLWLSQSIKDHFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIES  748
            L  +DV ++
Sbjct  452  LGPKDVFDN  460



>gb|KHN03217.1| 6-phosphofructokinase 3 [Glycine soja]
Length=525

 Score =   409 bits (1050),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  243  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  302

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  303  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  362

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQKI+DHF+ QK +PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  363  SK-QDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCT  421

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  422  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  481

Query  722  LRTR  733
            L  +
Sbjct  482  LDAK  485



>ref|XP_007160266.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
 gb|ESW32260.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
Length=471

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+ E+ LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  274  ATLASRDVDCCLIPESPFHLEGPGGLFEFAERRLKENGHMVIVIAEGAGQELVSESIQSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIK+HFS+QK M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  HK-QDASGNKLLQDVGLWISQKIKEHFSRQKTMNINLKYIDPTYMIRAVPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RI EGQN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEGQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               + + E
Sbjct  453  TIAKTISE  460



>gb|KFK27231.1| hypothetical protein AALP_AA8G354500 [Arabis alpina]
Length=489

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 217/248 (88%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKEH HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKEHGHMVIVLAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+K  KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLKDVGLWLSQSIKDHFNKI-KMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  452  LGPKDITE  459



>ref|XP_002309230.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
 gb|EEE92753.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
Length=552

 Score =   409 bits (1052),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 207/248 (83%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGLFEYIEK LKE+ HMVIV+AEGAGQELLSE++ S 
Sbjct  328  ATLASRDVDCCLIPESPFYLDGKGGLFEYIEKQLKENGHMVIVIAEGAGQELLSESMQSR  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKD+FS+QK M INLKYIDPTYMIRA+PSNASDNVY T
Sbjct  388  NQ-QDASGNKLLQDVGLWISQGIKDYFSRQKTMAINLKYIDPTYMIRAVPSNASDNVYST  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  447  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEKQNKVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDVIE  745
            +  +DVIE
Sbjct  507  MSDKDVIE  514



>ref|XP_007012199.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
 gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
Length=490

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 220/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFI MY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAGSIENGIGLVKLMGRYSGFITMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+IEK LKE+ HMVIV+AEGA  + L    L S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGRGGLYEFIEKRLKENGHMVIVIAEGA-GQDLLSESLQS  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S +IK+HFSK K+MPINLKYIDPTYMIRAIPS ASDNVYCT
Sbjct  333  MGQQDASGNKLLQDVGLWISHRIKEHFSK-KRMPINLKYIDPTYMIRAIPSIASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGF VG VNGRHAYIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  392  LLAHSAVHGAMAGYTGFIVGPVNGRHAYIPFNRIIEKQNKVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIES  748
            L  RD+ E+
Sbjct  452  LNPRDISEA  460



>emb|CAB38956.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
 emb|CAB79482.1| pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis thaliana]
Length=500

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 218/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  225  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  284

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  285  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  343

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  344  MTLKDASGNKLLKDVGLWLSQSIKDHFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  402

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  403  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  462

Query  722  LRTRDVIES  748
            L  +DV ++
Sbjct  463  LGPKDVFDN  471



>ref|XP_011081730.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=496

 Score =   407 bits (1046),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 221/248 (89%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LKE+ HMVIV+AEGAGQELL+E     
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYINKRLKENGHMVIVIAEGAGQELLAEKNE--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IK+HF+K+ K PI LKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  332  ---QDASGNKLLQDVGLWISQQIKEHFAKRTKSPITLKYIDPTYMIRAIPSNAADNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFNRITESQNKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDVIE  745
            L  +++ E
Sbjct  449  LGPKEIDE  456



>ref|XP_003516323.2| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=526

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  244  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  303

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  304  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  363

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQKI+DHF+ QK +PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  364  SK-QDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCT  422

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  423  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  482

Query  722  LRTR  733
            L  +
Sbjct  483  LDAK  486



>ref|XP_008794084.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=559

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/250 (84%), Positives = 225/250 (90%), Gaps = 2/250 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMV+VVAEGAGQE ++EN+ S 
Sbjct  328  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVLVVAEGAGQEFIAENMRSM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
             +  DASGNK L DVG WLSQKIKDHF S++KKM INLKYIDPTYMIRAIPSNASDNVYC
Sbjct  388  DHA-DASGNKQLLDVGFWLSQKIKDHFASRKKKMVINLKYIDPTYMIRAIPSNASDNVYC  446

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLA SA+HGAMAGYTGFT+G VNGRHAYIP++RITE QN VVITDRMWARLL STNQPS
Sbjct  447  TLLAHSAIHGAMAGYTGFTIGPVNGRHAYIPFHRITETQNKVVITDRMWARLLSSTNQPS  506

Query  719  FLRTRDVIES  748
            FL  +DV +S
Sbjct  507  FLSHKDVEDS  516



>ref|XP_008450803.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis melo]
Length=495

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 220/246 (89%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRY GFIAMY
Sbjct  218  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESMENGIGLVKLMGRYCGFIAMY  277

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYI + LK++ HMVIV+AEGAGQELLS +  S 
Sbjct  278  ATLASRDVDCCLIPESPFYLEGPGGLYEYIARCLKDNGHMVIVIAEGAGQELLSGSFGSD  337

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+D+GLWLSQ+IKDHFSK+ KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  338  K--QDASGNKLLQDIGLWLSQRIKDHFSKEHKMTINLKYIDPTYMIRAIPSNASDNVYCT  395

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RI + QN VVITDRMWARLL STNQPSF
Sbjct  396  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRIIDKQNKVVITDRMWARLLSSTNQPSF  455

Query  722  LRTRDV  739
            L  +DV
Sbjct  456  LTVKDV  461



>ref|XP_010540999.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 220/246 (89%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEATSTENGIGLVKLMGRYSGFIAM+
Sbjct  281  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEATSTENGIGLVKLMGRYSGFIAMH  340

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGA  + L    + S
Sbjct  341  ATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKENGHMVIVIAEGA-GQELLSESMQS  399

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L D+GLW+S +IKDHF+  KKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  400  MTLKDASGNKLLHDIGLWISHRIKDHFA--KKMTINLKYIDPTYMIRAIPSNASDNVYCT  457

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGRH+YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  458  LLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFYRITEKQNEVVITDRMWARLLSSTNQPSF  517

Query  722  LRTRDV  739
            +  ++V
Sbjct  518  MNHKEV  523



>ref|XP_010438324.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010438325.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 222/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGPGGLFEFIAKRLKESGHMVIVIAEGAGQDLLAESIEES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDV  739
            ++  D+
Sbjct  453  MKHDDI  458



>ref|XP_007215486.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
 gb|EMJ16685.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
Length=560

 Score =   409 bits (1051),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/246 (83%), Positives = 221/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  274  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  333

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE  H+VIV+AEGAG  LLSE+L   
Sbjct  334  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKEDGHIVIVIAEGAGDVLLSESLPKD  393

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKDHFSK++KM I LKYIDPTYMIRAIP NASDNVYCT
Sbjct  394  E--QDASGNKLLQDVGLWLSQNIKDHFSKRRKMNITLKYIDPTYMIRAIPGNASDNVYCT  451

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  452  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFCRVTERQNKVVITDRMWARLLSSTNQPSF  511

Query  722  LRTRDV  739
            L  ++V
Sbjct  512  LDPKEV  517



>ref|XP_002515946.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF46366.1| phosphofructokinase, putative [Ricinus communis]
Length=543

 Score =   408 bits (1049),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/248 (82%), Positives = 225/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAM+
Sbjct  273  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESFENGIGVVKLMGRYSGFIAMF  332

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYI K LKEH HMVIV+AEGAGQELLSE++ + 
Sbjct  333  ATLASRDVDCCLIPESPFYLEGPGGLFEYIRKRLKEHAHMVIVIAEGAGQELLSESMRTM  392

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L+DVGLW+SQKIKDHFS+ +KM I LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  393  DK-QDASGNRLLQDVGLWISQKIKDHFSQDQKMNITLKYIDPTYMIRAVPSNASDNVYCT  451

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRH++IP++R+ E +N VVITDRMWARLL STNQPSF
Sbjct  452  LLAHSAIHGAMAGYTGFTVGPVNGRHSHIPFHRVNERRNKVVITDRMWARLLSSTNQPSF  511

Query  722  LRTRDVIE  745
            L    VIE
Sbjct  512  LDPMHVIE  519



>gb|KCW79599.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=487

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMY
Sbjct  209  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRNSGFIAMY  268

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQEL+S++  S 
Sbjct  269  ATLASRDVDCCLIPESPFYLEGAGGLFEYIEKRLKENGHMVIVIAEGAGQELMSQSNQSL  328

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N KDASGNK+ +DVGLW+SQKIKDHFS++ KM I LKYIDPTYMIRAIPS ASDNVYCT
Sbjct  329  DNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITLKYIDPTYMIRAIPSIASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHG MAGYTGFT G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEKQNNVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDVIE  745
               +DVIE
Sbjct  449  WSPKDVIE  456



>ref|XP_004287498.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVE+ S ENGIG+VK+MGRYSGFIAMY
Sbjct  253  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVESESIENGIGVVKVMGRYSGFIAMY  312

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYI K LKE+ HMVIV+AEGAGQ+LLSE++ S 
Sbjct  313  ATLASRDVDCCLIPESPFYLEGPGGLFEYIAKRLKENGHMVIVIAEGAGQDLLSESINSM  372

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLW+SQKIKDHFS++ KM INLKYIDPTYMIRAIPSN SDNVYCT
Sbjct  373  DKL-DASGNKLLQDVGLWISQKIKDHFSQKSKMAINLKYIDPTYMIRAIPSNGSDNVYCT  431

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  432  LLAQSAVHGAMAGYTGYVAGPVNGRECYIPFYRINEKQHQVVITDRMWARLLSSTNQPSF  491

Query  722  LRTRDVIE  745
            L T+DVIE
Sbjct  492  LSTKDVIE  499



>gb|AIU64848.1| 6-phosphofructokinase [Prunus sibirica]
Length=532

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/241 (85%), Positives = 220/241 (91%), Gaps = 2/241 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  270  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  329

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE  H+VIVVAEGAG+ LLSE+LL  
Sbjct  330  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKEDGHIVIVVAEGAGEVLLSESLLKD  389

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKD+FSKQ+KM I LKYIDPTYMIRAIP NASDNVYCT
Sbjct  390  E--QDASGNKLLQDVGLWLSQNIKDYFSKQRKMNITLKYIDPTYMIRAIPGNASDNVYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  448  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFCRVTERQNKVVITDRMWARLLSSTNQPSF  507

Query  722  L  724
            L
Sbjct  508  L  508



>emb|CDX94352.1| BnaC01g18320D [Brassica napus]
 emb|CDX89351.1| BnaA01g15420D [Brassica napus]
Length=489

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 215/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR+SGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRFSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWLSQ IKDHF+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLNDVGLWLSQSIKDHFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDV  739
            L  +DV
Sbjct  452  LSPKDV  457



>ref|XP_010451175.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Camelina sativa]
Length=456

 Score =   405 bits (1040),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 212/246 (86%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMVIV+AEGA          S 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGA---GQDLMSKSM  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  331  ETLKDASGNKLLKDVGLWLSQSIKDHFN--KKMVMNLKYIDPTYMIRAVPSNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDV  739
            L  +DV
Sbjct  449  LGPKDV  454



>ref|XP_009337910.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Pyrus 
x bretschneideri]
Length=474

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP TIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPNTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELL E++   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERILKENGHMVIVIAEGAGQELLPESMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLWLSQ I+DHFSK++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  333  ---RDASGNKLPQDVGLWLSQNIRDHFSKRRKMTINLKYIDPTYMIRAIPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGF VG VNGRHAYIP++R+TE  N VVITDRMWARLL STNQPSF
Sbjct  390  LLAHSAIHGAMAGYTGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSSTNQPSF  449

Query  722  L  724
            L
Sbjct  450  L  450



>ref|XP_002867420.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43679.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 203/249 (82%), Positives = 224/249 (90%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I+K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGPGGLFEFIDKRLKESGHMVIVIAEGAGQDLLAESMEES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM + LKYIDPTYMIRAIPSNASDNV CT
Sbjct  335  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLTLKYIDPTYMIRAIPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            ++ +D I S
Sbjct  453  MK-QDKIHS  460



>ref|XP_002516495.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF45836.1| phosphofructokinase, putative [Ricinus communis]
Length=485

 Score =   405 bits (1042),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 224/244 (92%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEA STENGIG+VKLMGRYSGFIAMY
Sbjct  218  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEAESTENGIGVVKLMGRYSGFIAMY  277

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+I K LKE+ HMVIV+AEGAGQ+L+S++L S 
Sbjct  278  ATLASRDVDCCLIPESPFYLEGQGGLLEFIGKRLKENGHMVIVIAEGAGQDLVSKSLQSM  337

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IKDHF+++ +M I LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  338  NQ-QDASGNKLLQDVGLWISQRIKDHFAREHRMNITLKYIDPTYMIRAIPSNASDNVYCT  396

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRHAYIP+NRITE QN+VVITDRMWARLL ST+QPSF
Sbjct  397  LLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFNRITEKQNNVVITDRMWARLLSSTDQPSF  456

Query  722  LRTR  733
            +  +
Sbjct  457  MSPK  460



>ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
 gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
Length=489

 Score =   405 bits (1042),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 216/246 (88%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESMENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKD+F+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLKDVGLWLSQSIKDYFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDV  739
            L  +DV
Sbjct  452  LSPKDV  457



>emb|CAN74837.1| hypothetical protein VITISV_023326 [Vitis vinifera]
Length=488

 Score =   405 bits (1041),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 227/248 (92%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESIENGIGMVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ HMVIV+AEGAGQELLSE+LLS 
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLFEFIERRLKENGHMVIVMAEGAGQELLSESLLSM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  +DASGN +L+DVGLW+S +IKD+F++Q+K+ INLKYIDPTYMIRAIP NASDNVYCT
Sbjct  335  G--QDASGNNLLQDVGLWMSHRIKDYFARQRKIAINLKYIDPTYMIRAIPGNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT+G VNGRHAYIP++RI E +N VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINESRNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
               +DV E
Sbjct  453  QNPKDVAE  460



>ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
 gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
Length=487

 Score =   405 bits (1041),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 213/248 (86%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE  HMVIV+AEGA       +    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKESGHMVIVLAEGA--GQDLMSKSME  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+K  KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  332  STLKDASGNKLLKDVGLWLSQSIKDHFNKN-KMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  451  LGPKDVSE  458



>gb|KDO79934.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=472

 Score =   405 bits (1040),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 222/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRY GFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYCGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATL SRDVDCCLIPESPFYLEG GGL+E+IEK LKE+ HMVIV+AEGAGQ+LL+E+L S 
Sbjct  274  ATLGSRDVDCCLIPESPFYLEGEGGLYEFIEKRLKENGHMVIVIAEGAGQDLLAESLQSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIKDHF++  KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NQ-QDASGNKLLQDVGLWISHKIKDHFARLHKMAINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGA+AGYTGFTVG VNGRHAYIP+NRI E QN VVITDRMWAR+L STNQPSF
Sbjct  393  LLAQSAVHGAVAGYTGFTVGPVNGRHAYIPFNRINERQNQVVITDRMWARVLSSTNQPSF  452

Query  722  LRTRDV  739
            L   ++
Sbjct  453  LSANEL  458



>gb|AIE47276.1| phosphofructokinase [Hevea brasiliensis]
Length=563

 Score =   408 bits (1048),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 222/248 (90%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMY
Sbjct  280  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGLVKLMGRNSGFIAMY  339

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF+YIEK LKE+ HMVIV+AEGAGQELLS+ + S+
Sbjct  340  ATLASRDVDCCLIPESPFYLEGEGGLFDYIEKRLKENGHMVIVIAEGAGQELLSQTIQST  399

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ+IKD+FSKQKKM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  400  Q--QDASGNKLLQDVGLWISQRIKDYFSKQKKMTINLKYIDPTYMIRAIPSNASDNVYCT  457

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS +HGAMAGYTGFT G VNGR  YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  458  LLAQSVLHGAMAGYTGFTSGLVNGRQTYIPFYRIIEKQNKVVITDRMWARLLSSTNQPSF  517

Query  722  LRTRDVIE  745
               +D IE
Sbjct  518  WSAKDCIE  525



>ref|XP_010047648.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW79597.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=544

 Score =   407 bits (1046),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 206/248 (83%), Positives = 220/248 (89%), Gaps = 0/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMY
Sbjct  266  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRNSGFIAMY  325

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIV+AEGAGQEL+S++  S 
Sbjct  326  ATLASRDVDCCLIPESPFYLEGAGGLFEYIEKRLKENGHMVIVIAEGAGQELMSQSNQSL  385

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N KDASGNK+ +DVGLW+SQKIKDHFS++ KM I LKYIDPTYMIRAIPS ASDNVYCT
Sbjct  386  DNGKDASGNKLFQDVGLWISQKIKDHFSQRGKMGITLKYIDPTYMIRAIPSIASDNVYCT  445

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHG MAGYTGFT G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  446  LLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRITEKQNNVVITDRMWARLLSSTNQPSF  505

Query  722  LRTRDVIE  745
               +DVIE
Sbjct  506  WSPKDVIE  513



>ref|XP_011007273.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=566

 Score =   407 bits (1047),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 209/264 (79%), Positives = 229/264 (87%), Gaps = 1/264 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G PKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAM+
Sbjct  282  GSPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMH  341

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGLFEY+EK LKE+ HMVIV+AEGAGQELLSE++ S 
Sbjct  342  ATLASRDVDCCLIPESPFYLDGKGGLFEYVEKQLKENGHMVIVIAEGAGQELLSESMQSR  401

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKD+FS+QK M INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  402  NQ-QDASGNKLLQDVGLWISQGIKDYFSRQKTMAINLKYIDPTYMIRAVPSNASDNVYCT  460

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  461  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEKQNKVVITDRMWARLLSSTNQPSF  520

Query  722  LRTRDVIESkeeeeppkllddAPA  793
            +  +DVIE K E    +   + PA
Sbjct  521  MSDKDVIEDKTECISGEKKVEGPA  544



>ref|XP_010438323.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X1 [Camelina sativa]
Length=547

 Score =   407 bits (1045),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 222/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  290  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  349

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  350  ATLASRDVDCCLIPESPFFLEGPGGLFEFIAKRLKESGHMVIVIAEGAGQDLLAESIEES  409

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  410  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  467

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  468  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  527

Query  722  LRTRDV  739
            ++  D+
Sbjct  528  MKHDDI  533



>ref|XP_010433122.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433123.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
Length=472

 Score =   404 bits (1039),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 221/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGPGGLFEFISKRLKESGHMVIVIAEGAGQDLLAESIEES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VV TDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVTTDRMWARLLSSTNQPSF  452

Query  722  LRTRDV  739
            ++  D+
Sbjct  453  MKHDDI  458



>ref|NP_194651.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
 sp|Q9M0F9.1|PFKA1_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 1; Short=ATP-PFK 
1; Short=Phosphofructokinase 1; AltName: Full=Phosphohexokinase 
1 [Arabidopsis thaliana]
 emb|CAB79680.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
 gb|AAU90083.1| At4g29220 [Arabidopsis thaliana]
 gb|AEE85604.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
Length=473

 Score =   404 bits (1038),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 223/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAM+
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMH  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I+K LKE  HMVIV+AEGAGQ+LLSE++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGSGGLFEFIDKRLKESGHMVIVIAEGAGQDLLSESMKES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM + LKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLTLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFNRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            ++  D I S
Sbjct  453  MKQADKIHS  461



>ref|XP_008228400.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=532

 Score =   406 bits (1044),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 204/241 (85%), Positives = 219/241 (91%), Gaps = 2/241 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  270  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  329

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE  H+VIVVAEGAG+ LLSE+LL  
Sbjct  330  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKEDGHIVIVVAEGAGEVLLSESLLKD  389

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKDHFSK++ M I LKYIDPTYMIRAIP NASDNVYCT
Sbjct  390  E--QDASGNKLLQDVGLWLSQNIKDHFSKRRNMNITLKYIDPTYMIRAIPGNASDNVYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  448  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFCRVTERQNKVVITDRMWARLLSSTNQPSF  507

Query  722  L  724
            L
Sbjct  508  L  508



>ref|XP_008375840.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Malus domestica]
Length=463

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 217/240 (90%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP TIDNDIPVID+SFGFDTAVEEAQRAI+AAH+EA S ENGIG VKLMGRYSGFIAMY
Sbjct  189  GIPNTIDNDIPVIDRSFGFDTAVEEAQRAINAAHIEAESFENGIGFVKLMGRYSGFIAMY  248

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE +   
Sbjct  249  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSERMNQ-  307

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKD+FSKQ+KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  308  ---QDASGNKLLQDVGLWLSQNIKDYFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYCT  364

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGY GF VG VNGRHAYIP++R+TE  N VVITDRMWARLL STNQPSF
Sbjct  365  LLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSSTNQPSF  424



>emb|CDP08198.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/249 (81%), Positives = 224/249 (90%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRY GFIA Y
Sbjct  206  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYCGFIAQY  265

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++EK LKE+ HMVIV+AEGAGQELL+E+  ++
Sbjct  266  ATLASRDVDCCLIPESPFYLEGKGGLFEFVEKCLKENGHMVIVIAEGAGQELLAESGHAN  325

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIKD+F+KQ+KM I LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  326  DE-QDASGNKLLQDVGLWISQKIKDYFAKQRKMAITLKYIDPTYMIRAIPSNASDNVYCT  384

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G V+GRH YIP+NRI E QN VVITDRMWARLL STNQPSF
Sbjct  385  LLAQSAVHGAMAGYTGFTSGLVHGRHTYIPFNRIIETQNKVVITDRMWARLLSSTNQPSF  444

Query  722  LRTRDVIES  748
            L    ++E+
Sbjct  445  LGPNAIVEA  453



>ref|XP_009142127.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Brassica rapa]
Length=490

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 214/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF YIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFAYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWLSQ IKDHF+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLNDVGLWLSQSIKDHFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDV  739
            L  +DV
Sbjct  452  LSPKDV  457



>ref|XP_010438777.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Camelina 
sativa]
Length=486

 Score =   404 bits (1039),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 212/246 (86%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE  HMVIV+AEGA          S 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVIVIAEGA---GQDLMSKSM  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  331  ETLKDASGNKLLKDVGLWLSQSIKDHFN--KKMVMNLKYIDPTYMIRAVPSNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDV  739
            L  +DV
Sbjct  449  LCPKDV  454



>ref|XP_006371963.1| phosphofructokinase family protein [Populus trichocarpa]
 gb|ERP49760.1| phosphofructokinase family protein [Populus trichocarpa]
Length=492

 Score =   404 bits (1039),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/248 (81%), Positives = 222/248 (90%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGL+EYIEK LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYLDGKGGLYEYIEKQLKENGHMVIVIAEGAGQELLSESMQ--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKD+FSKQKKM INLKYIDPTYMIRA+P NA+DNVYCT
Sbjct  332  ---QDASGNKLLQDVGLWISQGIKDYFSKQKKMTINLKYIDPTYMIRAVPGNAADNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTGFT G VNGR  YIP+ RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSVVHGAMAGYTGFTSGLVNGRQTYIPFYRINEKQHKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDVIE  745
            +  ++VIE
Sbjct  449  ISNKEVIE  456



>ref|XP_006412866.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54319.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=437

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 220/242 (91%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  183  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  242

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LL+E+   S
Sbjct  243  ATLASRDVDCCLIPESPFFLEGQGGLFEFIDKRLKENGHMVIVIAEGAGQDLLAESEEQS  302

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  303  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  360

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  361  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQNQVVITDRMWARLLSSTNQPSF  420

Query  722  LR  727
            ++
Sbjct  421  MK  422



>gb|KEH36099.1| 6-phosphofructokinase [Medicago truncatula]
Length=519

 Score =   405 bits (1041),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 222/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAM+
Sbjct  215  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMH  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K LKE  HMVIV+AEGAGQ+LL+E++   
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFITKRLKESGHMVIVIAEGAGQDLLTESMQDM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+S KIKDHF+K+ KM I LKYIDPTYMIRAIPSNASD+VYCT
Sbjct  335  DQ-KDASGNKLLQDVGLWISHKIKDHFAKENKMAIVLKYIDPTYMIRAIPSNASDSVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGRH YIP+NRITE  N+VVITDRMWAR+L STNQPSF
Sbjct  394  LLAQSAVHGAMAGYTGFTAGLVNGRHTYIPFNRITEKMNNVVITDRMWARMLSSTNQPSF  453

Query  722  LRTRDV  739
            L+ +DV
Sbjct  454  LKPKDV  459



>gb|EPS62819.1| hypothetical protein M569_11969, partial [Genlisea aurea]
Length=419

 Score =   402 bits (1032),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 215/248 (87%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  151  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMY  210

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESP YLEG GGLFEYIEK LKE+ HMVIV+AEGAGQELL E     
Sbjct  211  ATLASRDVDCCLIPESPIYLEGEGGLFEYIEKKLKENRHMVIVIAEGAGQELLDEKNE--  268

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVG+WLS KIK+HF+K  K PI LKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  269  ---KDASGNKLLQDVGMWLSHKIKEHFTKLNKFPITLKYIDPTYMIRAIPSNAADNVYCT  325

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAG+TGF  G VNGRHAYIP+NRI E Q +VVITDRMWARLL STNQPSF
Sbjct  326  LLAQSAVHGTMAGFTGFVSGLVNGRHAYIPFNRIIEKQKNVVITDRMWARLLSSTNQPSF  385

Query  722  LRTRDVIE  745
            L   +  E
Sbjct  386  LEPNECEE  393



>emb|CDY69051.1| BnaAnng29210D, partial [Brassica napus]
Length=477

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 214/246 (87%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  199  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  258

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF YIEK LKE  HMV+V+AEGA  + L    + S
Sbjct  259  ATLASRDVDCCLIPESPFYLEGEGGLFAYIEKRLKESGHMVLVIAEGA-GQDLMSKSMES  317

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWLSQ IKDHF+ QKKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  318  MTLKDASGNKLLNDVGLWLSQSIKDHFN-QKKMVMNLKYIDPTYMIRAVPSNASDNVYCT  376

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  377  LLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSF  436

Query  722  LRTRDV  739
            L  +DV
Sbjct  437  LSPKDV  442



>gb|KDP34145.1| hypothetical protein JCGZ_07716 [Jatropha curcas]
Length=478

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 226/246 (92%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGRY GFI+MY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESTENGIGVVKLMGRYCGFISMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+I++ LKE+ HMVIV+AEGAGQ+L+SE+L S 
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLFEFIKRRLKENGHMVIVIAEGAGQDLVSESLQSL  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L+DVGLW+SQ+IK HF+K+ KM I LKYIDPTYMIRAIPSNASDNV+CT
Sbjct  334  DQ-QDASGNRLLQDVGLWISQRIKAHFAKENKMNITLKYIDPTYMIRAIPSNASDNVFCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAG+TGFTVGSVNGRH+YIP+NRITE QN VVITDRMWARLL ST+QPSF
Sbjct  393  LLAHSAVHGAMAGFTGFTVGSVNGRHSYIPFNRITEKQNKVVITDRMWARLLSSTDQPSF  452

Query  722  LRTRDV  739
            LR + V
Sbjct  453  LRPKVV  458



>ref|XP_006355296.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=493

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/244 (80%), Positives = 222/244 (91%), Gaps = 0/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+L+G GG+FE+++K L+E  HMVIV+AEGAGQELL+    ++
Sbjct  274  ATLASRDVDCCLIPESPFFLDGSGGIFEFVKKRLREEGHMVIVIAEGAGQELLAAENSNA  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G+++DASGNK+L+DVGLW+S KI+DHF K+ KMPI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  GSEQDASGNKLLQDVGLWISHKIRDHFEKKLKMPITLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            +LAQS VHGAMAGYTGFT G VNGR  Y+P+NRITE QN+VVITDRMWARLL STNQPSF
Sbjct  394  ILAQSCVHGAMAGYTGFTSGIVNGRQTYLPFNRITEKQNNVVITDRMWARLLASTNQPSF  453

Query  722  LRTR  733
            L T+
Sbjct  454  LSTK  457



>ref|XP_009128951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 [Brassica rapa]
 emb|CDY48604.1| BnaA01g07610D [Brassica napus]
Length=473

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 222/248 (90%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I K LKE+ HMVIV+AEGAGQ+LL+E+   S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGKGGLFEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQS  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  TTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIE  745
            ++  D+ E
Sbjct  453  MKHDDIHE  460



>ref|XP_006450746.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
 gb|ESR63986.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
Length=472

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 220/246 (89%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRY GFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYCGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATL SRDVDCCLIPESPFYLEG GGL+E+IEK LKE+ HMVIV+AEGAGQ+LL+E+L S 
Sbjct  274  ATLGSRDVDCCLIPESPFYLEGEGGLYEFIEKRLKENGHMVIVIAEGAGQDLLAESLQSM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+D GLW+S KIKDHF++  KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NQ-QDASGNKLLQDFGLWISHKIKDHFARLHKMAINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGRHAYIP+NRI E QN VVITDRMWAR+L STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTAGPVNGRHAYIPFNRINERQNQVVITDRMWARVLSSTNQPSF  452

Query  722  LRTRDV  739
            L   ++
Sbjct  453  LSANEL  458



>ref|XP_006853746.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
 gb|ERN15213.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
Length=480

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 217/245 (89%), Gaps = 3/245 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENG+G+VKLMGRYSGFIAMY
Sbjct  211  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGVGVVKLMGRYSGFIAMY  270

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LKE+ HMVIVVAEGA  + L    +  
Sbjct  271  ATLASRDVDCCLIPESPFYLEGEGGLFEYIGKRLKENGHMVIVVAEGA-GQELVAESIRE  329

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              ++DASGN++L DVGLWLS+KIKDHF+  +KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  330  MGKQDASGNRLLLDVGLWLSEKIKDHFT--RKMVINLKYIDPTYMIRAIPSNASDNVYCT  387

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRHAYIP+ R+TE QN VVITDRMWARLL STNQPSF
Sbjct  388  LLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFYRVTETQNKVVITDRMWARLLSSTNQPSF  447

Query  722  LRTRD  736
            L ++D
Sbjct  448  LTSKD  452



>ref|XP_010539385.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=487

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/246 (83%), Positives = 216/246 (88%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDILVIDKSFGFDTAVEEAQRAINAAHVEADSIENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ HMVIV+AEGA      E +L S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKENGHMVIVIAEGA----GQELMLES  329

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHFSK KK  INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  330  MTLKDASGNKLLKDVGLWLSQSIKDHFSK-KKTVINLKYIDPTYMIRAVPSNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGRH YIP+ RITE QN VVITDR WARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGRHTYIPFYRITEKQNKVVITDRTWARLLSSTNQPSF  448

Query  722  LRTRDV  739
            L ++DV
Sbjct  449  LSSKDV  454



>ref|XP_010914787.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=538

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  269  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  328

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE++HMVIVVAEGAGQ+L++E++ S 
Sbjct  329  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENEHMVIVVAEGAGQDLIAESVRSM  388

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N +D SGN +L D+GLWLSQKIKDHF++++ M +NLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  389  HN-EDPSGNMLLLDIGLWLSQKIKDHFARKQNMVMNLKYIDPTYMIRAIPSNASDNVYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRH YIP++R+TE +N VVITDRMWARLL STNQPSF
Sbjct  448  LLAHSAIHGAMAGYTGFTVGLVNGRHTYIPFHRVTEKRNRVVITDRMWARLLSSTNQPSF  507

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  508  LSAKDIEEA  516



>ref|XP_010924464.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 219/249 (88%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAASIENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIVVAEGA  + L    L S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVVAEGA-GQDLIAESLRS  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVG WLSQKIKDHF++++ M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  MQHEDASGNKLLDDVGFWLSQKIKDHFTRKQMMVINLKYIDPTYMIRAIPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VNGRH YIP++R+TE  N VVITDRMWAR+L STNQPSF
Sbjct  394  LLAHSAVHGAMAGYTGFTVGLVNGRHTYIPFHRMTE-TNKVVITDRMWARVLSSTNQPSF  452

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  453  LCAKDIEEA  461



>ref|XP_003529065.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
Length=536

 Score =   405 bits (1041),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  254  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  313

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+EYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  314  ATLASRDVDCCLIPESPFYLEGTGGLYEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  373

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQKI+DHF+ QK +PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  374  SK-QDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCT  432

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  433  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  492

Query  722  LRTR  733
            L ++
Sbjct  493  LDSK  496



>ref|XP_010536840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Tarenaya hassleriana]
Length=474

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 214/246 (87%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ HMVIV+AEGA      E +L S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFVERRLKENGHMVIVIAEGA----GQELMLES  329

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWL Q IKDHFS  KK  INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  330  TTLKDASGNKLLKDVGLWLFQSIKDHFSA-KKATINLKYIDPTYMIRAVPSNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDV  739
            L  +DV
Sbjct  449  LSPKDV  454



>ref|XP_009387228.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   405 bits (1041),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 228/249 (92%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGF+AMY
Sbjct  269  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAGSVENGIGVVKLMGRYSGFLAMY  328

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEY+EK LKE+ HMVIVVAEGAGQ+L++E++ S 
Sbjct  329  ATLASRDVDCCLIPESPFYLEGKGGLFEYMEKQLKENGHMVIVVAEGAGQDLIAESMRSM  388

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLSQ+IK++F+ ++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  389  NH-EDASGNKLLLDVGLWLSQRIKNYFTSRQKMVINLKYIDPTYMIRAIPSNASDNVYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQ AVHGAMAGYTGFTVG VNGRH YIP++R+TE +N VVITDRMWARLL STNQPSF
Sbjct  448  LLAQCAVHGAMAGYTGFTVGLVNGRHTYIPFDRVTETRNTVVITDRMWARLLSSTNQPSF  507

Query  722  LRTRDVIES  748
            L ++DV E+
Sbjct  508  LSSKDVEEA  516



>ref|XP_010433524.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Camelina sativa]
Length=488

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/246 (82%), Positives = 215/246 (87%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF+YIEK LKE  HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFDYIEKRLKESGHMVIVIAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  MTLKDASGNKLLKDVGLWLSQSIKDHFN--KKMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+  G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITETQNHVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDV  739
            L  +DV
Sbjct  451  LCPKDV  456



>gb|KHN40360.1| 6-phosphofructokinase 3 [Glycine soja]
Length=561

 Score =   405 bits (1042),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/244 (83%), Positives = 221/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  279  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  338

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIEK LKE+ HMVIV+AEGAGQEL+SE++ S 
Sbjct  339  ATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVIAEGAGQELVSESVQSM  398

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQKI+DHF+ QK +PI LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  399  SK-QDASGNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCT  457

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGA AGYTG+T G VNGR  YIP+ RITE QNHVVITDRMWARLL STNQPSF
Sbjct  458  LLAQSAVHGATAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSF  517

Query  722  LRTR  733
            L ++
Sbjct  518  LDSK  521



>ref|XP_009757482.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3, partial [Nicotiana 
sylvestris]
Length=295

 Score =   396 bits (1017),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = +2

Query  35   VIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMYATLASRDVDCC  214
            VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMYATLASRDVDCC
Sbjct  20   VIDKSFGFDTAVEEAQRAINAAHVEAQSAENGIGVVKLMGRYSGFIAMYATLASRDVDCC  79

Query  215  LIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllssgnqKDASGNKV  394
            LIPESPFYLEG GGLFE+++K L+E  HMVIV+AEGAGQELL+E    + +++DASGNK+
Sbjct  80   LIPESPFYLEGSGGLFEFVKKRLREDGHMVIVIAEGAGQELLAEENSHARSEQDASGNKL  139

Query  395  LEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAM  574
            L+DVGLW+SQKI+DHF K+ KMPI LKYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAM
Sbjct  140  LQDVGLWVSQKIRDHFEKKLKMPITLKYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAM  199

Query  575  AGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSFLRTRDVIE  745
            AGYTGFT G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSFL T+D++E
Sbjct  200  AGYTGFTSGVVNGRQTYIPFNRITEKQNKVVITDRMWARLLSSTNQPSFLSTKDIVE  256



>ref|XP_008799762.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=538

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 204/249 (82%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  269  GIPKTIDNDIAVIDKSFGFDSAVEEAQRAINAAHVESESVENGIGLVKLMGRYSGFIAMY  328

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKE+ HMVIVVAEGAGQ+L++E+L S 
Sbjct  329  ATLASRDVDCCLIPESPFYLEGKGGLFEYIEKRLKENGHMVIVVAEGAGQDLIAESLRSM  388

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N +D SGNK+L DVGLWLSQKIKDHF++ +KM +NLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  389  HN-EDPSGNKLLLDVGLWLSQKIKDHFARIQKMVMNLKYIDPTYMIRAIPSNASDNVYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRH YIP++R+TE +N VVITDRMWARLL STNQPSF
Sbjct  448  LLAHSAIHGAMAGYTGFTVGLVNGRHTYIPFHRVTEKRNRVVITDRMWARLLSSTNQPSF  507

Query  722  LRTRDVIES  748
            L  +D+ E+
Sbjct  508  LSAKDIEEA  516



>ref|XP_010915352.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=548

 Score =   405 bits (1041),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 224/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEA+RAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  268  GVPKTIDNDIAVIDKSFGFDTAVEEAERAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMV+VVAEGAGQEL++E++ S 
Sbjct  328  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVLVVAEGAGQELIAESMRSM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLSQKIKDHF++ KK+ INLKYIDPTYMIRAIP NASDNVYCT
Sbjct  388  DH-EDASGNKLLLDVGLWLSQKIKDHFARSKKVAINLKYIDPTYMIRAIPGNASDNVYCT  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S +HGAMAGYTGFTVG VNGRHAYIP++RITE +N VVITDRMWARLL STNQPSF
Sbjct  447  LLAHSVIHGAMAGYTGFTVGPVNGRHAYIPFHRITETRNKVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDV  739
            L  +DV
Sbjct  507  LSHKDV  512



>ref|XP_009344489.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=540

 Score =   405 bits (1040),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 219/241 (91%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  266  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGFVKLMGRYSGFIAMY  325

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ H+VIV+AEGAGQELL+E++   
Sbjct  326  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHLVIVMAEGAGQELLAESMNQ-  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ I+DHF KQ+ + INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  385  ---QDASGNKLLQDVGLWLSQNIRDHFLKQRNITINLKYIDPTYMIRAIPSNASDNVYCT  441

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP+  +TE QN VVITDRMWARLL STNQPSF
Sbjct  442  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFRWVTEKQNKVVITDRMWARLLSSTNQPSF  501

Query  722  L  724
            L
Sbjct  502  L  502



>ref|XP_003620763.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES76981.1| 6-phosphofructokinase [Medicago truncatula]
Length=505

 Score =   403 bits (1036),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 223/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  211  GIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVEAESFENGIGVVKLMGRYSGFIAMY  270

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYI++ LKE+ HMVIV+AEGAGQELL+E+L S 
Sbjct  271  ATLASRDVDCCLIPESPFYLEGPGGLYEYIDRRLKENGHMVIVIAEGAGQELLTESLQSG  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKDHF+++K +PI LKYIDPTYMIRA+PSNASDNVYCT
Sbjct  331  KK-QDASGNKLLQDVGLWISQSIKDHFAREKTLPITLKYIDPTYMIRAVPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITERQNNVVITDRMWARLLSSTNQPSF  449

Query  722  LRTR  733
            +  +
Sbjct  450  MEVK  453



>gb|AAM91591.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=473

 Score =   402 bits (1033),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 223/249 (90%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAM+
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMH  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I+K LKE  HMVIV+AEGAGQ+LLSE++  S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGSGGLFEFIDKRLKESGHMVIVIAEGAGQDLLSESMKES  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM + LKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLTLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG +AGY GFTVG VNGRH YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVVAGYNGFTVGLVNGRHTYIPFNRITEKQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            ++  D I S
Sbjct  453  MKQADKIHS  461



>ref|XP_010049142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW81626.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=492

 Score =   403 bits (1035),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/245 (81%), Positives = 224/245 (91%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGL+E+IEK LKE+ HMVIV+AEGAGQ+L++E+L S+
Sbjct  276  ATLASRDVDCCLIPESPFFLEGKGGLYEFIEKRLKENGHMVIVIAEGAGQDLVAESLQSN  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L+DVGLW+S KI+DHF++Q+KM I LKYIDPTYMIRA+PSNASDNV CT
Sbjct  336  Q--QDASGNRLLQDVGLWISHKIRDHFARQQKMGITLKYIDPTYMIRAVPSNASDNVNCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TGFTVG VN RH YIP+NR+TE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTERQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRD  736
            L  +D
Sbjct  454  LVLKD  458



>ref|XP_008375838.1| PREDICTED: 6-phosphofructokinase 6-like isoform X1 [Malus domestica]
Length=491

 Score =   403 bits (1035),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 217/240 (90%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP TIDNDIPVID+SFGFDTAVEEAQRAI+AAH+EA S ENGIG VKLMGRYSGFIAMY
Sbjct  217  GIPNTIDNDIPVIDRSFGFDTAVEEAQRAINAAHIEAESFENGIGFVKLMGRYSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE +   
Sbjct  277  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSERMNQ-  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKD+FSKQ+KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  336  ---QDASGNKLLQDVGLWLSQNIKDYFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGY GF VG VNGRHAYIP++R+TE  N VVITDRMWARLL STNQPSF
Sbjct  393  LLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSSTNQPSF  452



>ref|XP_010433121.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Camelina 
sativa]
Length=549

 Score =   405 bits (1040),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 221/246 (90%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  292  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  351

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEGPGGLFE+I K LKE  HMVIV+AEGAGQ+LL+E++  S
Sbjct  352  ATLASRDVDCCLIPESPFFLEGPGGLFEFISKRLKESGHMVIVIAEGAGQDLLAESIEES  411

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  412  KTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  469

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VV TDRMWARLL STNQPSF
Sbjct  470  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVTTDRMWARLLSSTNQPSF  529

Query  722  LRTRDV  739
            ++  D+
Sbjct  530  MKHDDI  535



>gb|ACU20351.1| unknown [Glycine max]
Length=284

 Score =   395 bits (1014),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKS GFDTAVEEAQRA+++AHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  17   GIPKTIDNDIPVIDKSIGFDTAVEEAQRAVNSAHVEAESAENGIGVVKLMGRYSGFIAMY  76

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL E+IEK LKE  HMVIV+AEGAGQELLS N    
Sbjct  77   ATLASRDVDCCLIPESPFYLEGPGGLLEFIEKRLKEQGHMVIVIAEGAGQELLSGNPSIV  136

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DAS +K+  DVGLWLSQKIKDHF K++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  137  NK-PDASADKLFPDVGLWLSQKIKDHFEKRQKMAINLKYIDPTYMIRAIPSNASDNVYCT  195

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR+ YIP++ I EG+  VVITDRMWARLL ST+QP F
Sbjct  196  LLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINEGEKGVVITDRMWARLLSSTHQPCF  255

Query  722  LRTRDV  739
            L  +++
Sbjct  256  LNPKEI  261



>ref|XP_006412865.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54318.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=469

 Score =   402 bits (1032),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 220/242 (91%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LL+E+   S
Sbjct  275  ATLASRDVDCCLIPESPFFLEGQGGLFEFIDKRLKENGHMVIVIAEGAGQDLLAESEEQS  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  335  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQNQVVITDRMWARLLSSTNQPSF  452

Query  722  LR  727
            ++
Sbjct  453  MK  454



>emb|CDY06829.1| BnaC01g09280D [Brassica napus]
Length=479

 Score =   402 bits (1033),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 200/245 (82%), Positives = 220/245 (90%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  221  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  280

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I K LKE+ HMVIV+AEGAGQ+LL+E+   S
Sbjct  281  ATLASRDVDCCLIPESPFFLEGKGGLFEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQS  340

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  341  TTLKDASGNKLLQDVGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  398

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  399  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  458

Query  722  LRTRD  736
            ++  D
Sbjct  459  MKHDD  463



>ref|XP_011006431.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=486

 Score =   402 bits (1033),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGL+EYIEK LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYLDGKGGLYEYIEKQLKENGHMVIVIAEGAGQELLSESMQ--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKD+FSKQKKM INLKYIDPTYMIRA+P NASDNVYCT
Sbjct  332  ---QDASGNKLLQDVGLWISQGIKDYFSKQKKMTINLKYIDPTYMIRAVPGNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSVVHGAMAGYTGYTSGLVNGRQTYIPFYRINEKQHKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDVIE  745
            +  ++V E
Sbjct  449  ISNKEVFE  456



>ref|XP_008375839.1| PREDICTED: 6-phosphofructokinase 6-like isoform X2 [Malus domestica]
Length=488

 Score =   402 bits (1033),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 217/240 (90%), Gaps = 4/240 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP TIDNDIPVID+SFGFDTAVEEAQRAI+AAH+EA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPNTIDNDIPVIDRSFGFDTAVEEAQRAINAAHIEAESFENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL+EYIE+ LKE+ HMVIV+AEGAGQELLSE +   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVIAEGAGQELLSERMNQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKD+FSKQ+KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  333  ---QDASGNKLLQDVGLWLSQNIKDYFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGY GF VG VNGRHAYIP++R+TE  N VVITDRMWARLL STNQPSF
Sbjct  390  LLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSSTNQPSF  449



>ref|XP_011016327.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=484

 Score =   402 bits (1032),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 5/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESVENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGL+EYIEK LKE+ HMVIV+AEGAGQELLSE++   
Sbjct  274  ATLASRDVDCCLIPESPFYLDGKGGLYEYIEKQLKENGHMVIVIAEGAGQELLSESMQ--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQ IKD+FSKQKKM INLKYIDPTYMIRA+P NASDNVYCT
Sbjct  332  ---QDASGNKLLQDVGLWISQGIKDYFSKQKKMTINLKYIDPTYMIRAVPGNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQS VHGAMAGYTG+T G VNGR  YIP+ RI E Q+ VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSVVHGAMAGYTGYTSGLVNGRQTYIPFYRINEKQHKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDVIE  745
            +  ++V E
Sbjct  449  ISNKEVFE  456



>emb|CDX68896.1| BnaC01g05570D [Brassica napus]
Length=463

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 219/241 (91%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGAGQ+L++E++   
Sbjct  276  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQ-  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIK+HF+KQ+KM I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  335  ---QDASGNKLLKDVGLWMSLKIKEHFAKQRKMDITLKYIDPTYMIRAIPANASDNVYST  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  451

Query  722  L  724
            +
Sbjct  452  M  452



>ref|XP_004517277.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=517

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPES FYLEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LL+E++ + 
Sbjct  275  ATLASRDVDCCLIPESSFYLEGKGGLFEFIKKRLKENGHMVIVIAEGAGQDLLTESMQAM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLW+S KIKDHF+K+ KM I LKYIDPTYMIRAIPSNASDNVYCT
Sbjct  335  DQ-KDASGNKLLLDVGLWISHKIKDHFAKENKMAIVLKYIDPTYMIRAIPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSA+HGAMAGYTGFT G VNGRH YIP+NRITE  N VV+TDRM+AR+L STNQPSF
Sbjct  394  LLAQSAIHGAMAGYTGFTAGLVNGRHTYIPFNRITEKMNQVVVTDRMFARMLSSTNQPSF  453

Query  722  LRTRDVIE  745
            L+ +D+ E
Sbjct  454  LKPKDIHE  461



>emb|CDX75291.1| BnaA01g04110D [Brassica napus]
Length=463

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 219/241 (91%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGAGQ+L++E++   
Sbjct  276  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQ-  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIK+HF+KQ+KM I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  335  ---QDASGNKLLKDVGLWMSLKIKEHFAKQRKMDITLKYIDPTYMIRAIPANASDNVYST  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  451

Query  722  L  724
            +
Sbjct  452  M  452



>ref|XP_010049141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW81625.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=510

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/245 (81%), Positives = 224/245 (91%), Gaps = 2/245 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGL+E+IEK LKE+ HMVIV+AEGAGQ+L++E+L S+
Sbjct  276  ATLASRDVDCCLIPESPFFLEGKGGLYEFIEKRLKENGHMVIVIAEGAGQDLVAESLQSN  335

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L+DVGLW+S KI+DHF++Q+KM I LKYIDPTYMIRA+PSNASDNV CT
Sbjct  336  Q--QDASGNRLLQDVGLWISHKIRDHFARQQKMGITLKYIDPTYMIRAVPSNASDNVNCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TGFTVG VN RH YIP+NR+TE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRVTERQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRD  736
            L  +D
Sbjct  454  LVLKD  458



>ref|XP_009125389.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brassica rapa]
Length=463

 Score =   401 bits (1030),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 198/241 (82%), Positives = 219/241 (91%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  216  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGAGQ+L++E++   
Sbjct  276  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGAGQDLVAESIEQ-  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIK+HF+KQ+KM I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  335  ---QDASGNKLLKDVGLWMSLKIKEHFAKQRKMDITLKYIDPTYMIRAIPANASDNVYST  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  451

Query  722  L  724
            +
Sbjct  452  M  452



>ref|XP_010443317.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Camelina 
sativa]
Length=485

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 213/248 (86%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LKEH HMVIV+AEGA       +    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRLKEHGHMVIVLAEGA--GQDLMSKSME  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWL+Q IKD+F K+ KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  332  STLKDASGNKLLKDVGLWLAQSIKDYF-KKIKMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  451  LGPKDISE  458



>ref|XP_007024343.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY26965.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=534

 Score =   403 bits (1036),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/256 (77%), Positives = 219/256 (86%), Gaps = 9/256 (4%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGR+SGFIAMY
Sbjct  266  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAIAAAHVESESVENGIGLVKLMGRHSGFIAMY  325

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL EYIEK LKE+ HMVIVVAEGA  +      + +
Sbjct  326  ATLASRDVDCCLIPESPFYLEGAGGLLEYIEKRLKENGHMVIVVAEGA-GQEFLSENIRT  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYI--------DPTYMIRAIPSN  517
             +++DASGNK L+D+G W+SQKIKDHFSKQKKM +NLKYI        DPTYMIRAIPSN
Sbjct  385  IDKQDASGNKQLQDIGFWISQKIKDHFSKQKKMAMNLKYIGQLLKTLHDPTYMIRAIPSN  444

Query  518  ASDNVYCTLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLL  697
            ASDNVYCTLLA SA+HGAMAGYTGFTVG VNGRHAYIP++RIT+ QN VVITDRMWAR L
Sbjct  445  ASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRITQKQNKVVITDRMWARCL  504

Query  698  CSTNQPSFLRTRDVIE  745
             STNQPSF   + ++E
Sbjct  505  SSTNQPSFFSPQQLLE  520



>ref|XP_008798601.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=552

 Score =   404 bits (1037),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 223/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEA+RAI+AAHVEA S ENGIG+VKLMGRYSGFI MY
Sbjct  268  GIPKTIDNDIAVIDKSFGFDTAVEEAERAINAAHVEAESVENGIGVVKLMGRYSGFITMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMV+VVAEGAGQEL++E++ S 
Sbjct  328  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVLVVAEGAGQELIAESMRSM  387

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLSQKIKDHF+  KK+ INLKYIDPTYMIRAIP NASDNVYCT
Sbjct  388  NH-EDASGNKLLLDVGLWLSQKIKDHFASSKKLAINLKYIDPTYMIRAIPGNASDNVYCT  446

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGY+GFTVG VNGRHAYIP++RITE +N VVITDRMWARLL STNQPSF
Sbjct  447  LLAHSAIHGAMAGYSGFTVGPVNGRHAYIPFHRITETRNKVVITDRMWARLLSSTNQPSF  506

Query  722  LRTRDV  739
            L  +DV
Sbjct  507  LSHKDV  512



>ref|XP_009395051.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  273  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  332

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPES FYLEG GGL+EYIEK LKE+ HMVIVVAEGAGQ+L++E++ S 
Sbjct  333  ATLASRDVDCCLIPESRFYLEGKGGLYEYIEKRLKENGHMVIVVAEGAGQDLIAESMKSM  392

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLSQ IK++F+ ++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  393  DH-EDASGNKLLLDVGLWLSQGIKNYFTSRQKMTINLKYIDPTYMIRAIPSNASDNVYCT  451

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR  YIP++R+TE +N VVITDRMWARLL STNQPSF
Sbjct  452  LLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEKRNKVVITDRMWARLLSSTNQPSF  511

Query  722  LRTRDVIES  748
            L ++DV E+
Sbjct  512  LSSKDVEEA  520



>ref|XP_010483140.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
 ref|XP_010483141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
Length=485

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 213/248 (86%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LKEH HMVIV+AEGA       +    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRLKEHGHMVIVLAEGA--GQDLMSKSME  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWL+Q IKD+F K+ KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  332  STLKDASGNKLLKDVGLWLAQSIKDYF-KKIKMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  451  LGPKDISE  458



>ref|XP_009395050.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 226/249 (91%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  273  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRYSGFIAMY  332

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPES FYLEG GGL+EYIEK LKE+ HMVIVVAEGAGQ+L++E++ S 
Sbjct  333  ATLASRDVDCCLIPESRFYLEGKGGLYEYIEKRLKENGHMVIVVAEGAGQDLIAESMKSM  392

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLSQ IK++F+ ++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  393  DH-EDASGNKLLLDVGLWLSQGIKNYFTSRQKMTINLKYIDPTYMIRAIPSNASDNVYCT  451

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR  YIP++R+TE +N VVITDRMWARLL STNQPSF
Sbjct  452  LLAQSAVHGAMAGYTGFTVGLVNGRQTYIPFDRVTEKRNKVVITDRMWARLLSSTNQPSF  511

Query  722  LRTRDVIES  748
            L ++DV E+
Sbjct  512  LSSKDVEEA  520



>emb|CDY32769.1| BnaA10g10800D [Brassica napus]
Length=369

 Score =   397 bits (1019),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  95   GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK +KE+ HMVIV+AEGAGQEL+S+++ S+
Sbjct  155  ATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKSMESN  214

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLWLSQ IKD+F K+  M +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  215  T---DASGNKLLKDVGLWLSQSIKDYF-KKINMVMNLKYIDPTYMIRAVPSNASDNVYCT  270

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  271  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  330

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  331  LGPKDIPE  338



>gb|KFK29896.1| hypothetical protein AALP_AA7G192500 [Arabis alpina]
Length=460

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 214/241 (89%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  213  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  272

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+IEK L+E+ HMVIV+AEGA      + +  S
Sbjct  273  ATLASRDVDCCLIPESPFYLEGKGGLYEFIEKHLRENGHMVIVIAEGA----GQDLVAES  328

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KI++HF+KQ+KM I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  329  IEQQDASGNKLLKDVGLWMSLKIREHFAKQRKMEITLKYIDPTYMIRAIPANASDNVYST  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITEKQNKVVITDRMWARMLSSTNQPSF  448

Query  722  L  724
            +
Sbjct  449  M  449



>ref|XP_006412864.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54317.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=555

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 220/242 (91%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIP+ID+SFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  301  GIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAMY  360

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFE+I+K LKE+ HMVIV+AEGAGQ+LL+E+   S
Sbjct  361  ATLASRDVDCCLIPESPFFLEGQGGLFEFIDKRLKENGHMVIVIAEGAGQDLLAESEEQS  420

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+D+GLW+SQ+IKDHF+  KKM +NLKYIDPTYMIRA+PSNASDNV CT
Sbjct  421  TTLKDASGNKLLQDIGLWISQRIKDHFA--KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  478

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHG MAGY GFTVG VNGRH YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  479  LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQNQVVITDRMWARLLSSTNQPSF  538

Query  722  LR  727
            ++
Sbjct  539  MK  540



>ref|XP_004158491.1| PREDICTED: 6-phosphofructokinase 3-like [Cucumis sativus]
Length=511

 Score =   402 bits (1032),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVE+ S ENGIGLVKLMGR SGFIAMY
Sbjct  235  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESNENGIGLVKLMGRNSGFIAMY  294

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  +KEH HMVIV+AEGAGQEL+SE++   
Sbjct  295  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSESIHKL  354

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQ+IKD+F +++KM INLKYIDPTYMIRA+PS ASDN++CT
Sbjct  355  DQ-QDASGNKLHQDVGLWISQQIKDYFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCT  413

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  414  LLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  473

Query  722  LRTRDV  739
            L  + V
Sbjct  474  LHPKHV  479



>emb|CDY20715.1| BnaA02g08550D [Brassica napus]
Length=490

 Score =   400 bits (1029),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IE+ LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKENGHMVIVLAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRA+PSNASDNVYC+
Sbjct  333  NTLEDASGNKLLKDVGLWLSQSIKDHF-KKNKMEMNLKYIDPTYMIRAVPSNASDNVYCS  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  452  LGPKDIPE  459



>ref|XP_010098164.1| 6-phosphofructokinase 4 [Morus notabilis]
 gb|EXB74601.1| 6-phosphofructokinase 4 [Morus notabilis]
Length=403

 Score =   397 bits (1021),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 218/248 (88%), Gaps = 7/248 (3%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR++G+IAMY
Sbjct  143  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRHNGYIAMY  202

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIEK LKE+ HMVIVVAEG   + +    + +
Sbjct  203  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKENGHMVIVVAEGV-GQEILSESMRT  261

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +Q+DASGNK L+DVGLWL+QKIK+HFSK++KM INLKYIDPTYMIRA+P NASDNVYCT
Sbjct  262  AHQQDASGNKFLQDVGLWLAQKIKEHFSKKQKMTINLKYIDPTYMIRAVPGNASDNVYCT  321

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VNGRHAYIP++      N VVITDRMWARLL STNQPSF
Sbjct  322  LLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFH------NKVVITDRMWARLLSSTNQPSF  375

Query  722  LRTRDVIE  745
            L  +D++ 
Sbjct  376  LNPKDILR  383



>gb|KGN58020.1| hypothetical protein Csa_3G435010 [Cucumis sativus]
Length=529

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVE+ S ENGIGLVKLMGR SGFIAMY
Sbjct  253  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESNENGIGLVKLMGRNSGFIAMY  312

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  +KEH HMVIV+AEGAGQEL+SE++   
Sbjct  313  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSESIHKL  372

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQ+IKD+F +++KM INLKYIDPTYMIRA+PS ASDN++CT
Sbjct  373  DQ-QDASGNKLHQDVGLWISQQIKDYFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCT  431

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  432  LLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  491

Query  722  LRTRDV  739
            L  + V
Sbjct  492  LHPKHV  497



>ref|XP_010545328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=490

 Score =   400 bits (1028),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 216/246 (88%), Gaps = 5/246 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVESESFENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ HMVIV+AEGA      E ++ S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKENGHMVIVIAEGA----GQELMMES  329

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N +DASGNK+L+DVGLW+SQ IKDHFS+ KK  INLKYIDPTYMIRA+P NASDNVYCT
Sbjct  330  SNLEDASGNKLLKDVGLWISQSIKDHFSR-KKTTINLKYIDPTYMIRAVPGNASDNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNGR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITEKQNKVVITDRMWARLLSSTNQPSF  448

Query  722  LRTRDV  739
            L  +DV
Sbjct  449  LSPKDV  454



>emb|CDY41800.1| BnaC02g12110D [Brassica napus]
Length=485

 Score =   400 bits (1027),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IE+ LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKENGHMVIVLAEGA-GQDLMSKRMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRA+PSNASDNVYC+
Sbjct  333  NTLEDASGNKLLKDVGLWLSQSIKDHF-KKNKMVMNLKYIDPTYMIRAVPSNASDNVYCS  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  452  LGPKDIPE  459



>ref|XP_011091507.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Sesamum 
indicum]
Length=464

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 199/241 (83%), Positives = 215/241 (89%), Gaps = 5/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LK++ HMVIV+AEGAGQELL+E     
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEYINKRLKQNGHMVIVIAEGAGQELLAEKNE--  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+SQKIK+HF+K+ K PI LKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  332  ---QDASGNKLLQDVGLWISQKIKEHFAKRAKPPITLKYIDPTYMIRAIPSNAADNVYCT  388

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFT G VNG   YIP+NRITE QN VV TDRMWARLL STNQPSF
Sbjct  389  LLAQSAVHGAMAGYTGFTSGLVNGSQTYIPFNRITESQNKVVTTDRMWARLLSSTNQPSF  448

Query  722  L  724
            L
Sbjct  449  L  449



>ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
 gb|ESQ42754.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
Length=490

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IE+ LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKENGHMVIVLAEGA-GQDLMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IKD+F K+ KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  333  NTLKDASGNKLLKDVGLWLSQSIKDYF-KKIKMVMNLKYIDPTYMIRAVPSNASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIE  745
            L  +DV E
Sbjct  452  LGPKDVSE  459



>ref|XP_006283577.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
 gb|EOA16475.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
Length=502

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/243 (80%), Positives = 213/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  263  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  322

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+I K L+E+ HMVIV+AEGA      + +  S
Sbjct  323  ATLASRDVDCCLIPESPFYLEGKGGLFEFIAKRLRENGHMVIVIAEGA----GQDLVAES  378

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK+HF+KQ  M I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  379  IEQQDASGNKLLKDVGLWMSLKIKEHFAKQSVMDITLKYIDPTYMIRAIPANASDNVYST  438

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  439  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSF  498

Query  722  LRT  730
            + +
Sbjct  499  MNS  501



>ref|XP_003543617.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
 ref|XP_006595112.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
 ref|XP_006595113.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Glycine max]
 gb|KHN30018.1| 6-phosphofructokinase 3 [Glycine soja]
Length=481

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 199/246 (81%), Positives = 217/246 (88%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKS GFDTAVEEAQRAI++AHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSIGFDTAVEEAQRAINSAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL E++EK LKE  HMVIV+AEGAGQELLS N    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLLEFVEKRLKEQGHMVIVIAEGAGQELLSGNPSIV  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DAS +K+  DVGLWLSQKIKDHF K++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NK-QDASADKLFPDVGLWLSQKIKDHFEKRQKMAINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR+ YIP++ I EG+  VVITDRMWARLL ST+QPSF
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINEGEKRVVITDRMWARLLSSTHQPSF  452

Query  722  LRTRDV  739
            L  +D+
Sbjct  453  LNPKDI  458



>ref|XP_007150587.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150588.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150589.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22581.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22582.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22583.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
Length=474

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 218/248 (88%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKS GFDTAVEEAQRAIS+AHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  207  GIPKTIDNDIPVIDKSIGFDTAVEEAQRAISSAHVEAESAENGIGVVKLMGRYSGFIAMY  266

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFY++GPGGL E+IE+ LKE  HMVIV+AEGAGQE LS N    
Sbjct  267  ATLASRDVDCCLIPESPFYMDGPGGLLEFIERRLKEQGHMVIVIAEGAGQEFLSGNPSVV  326

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               ++ S +K+L DVGLWLSQKIKDHF+K +KMPINLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  327  NK-QETSADKLLPDVGLWLSQKIKDHFAKCRKMPINLKYIDPTYMIRAIPSNASDNVYCT  385

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR+ YIP++ I EG+  VVITDRMWARLL ST+QPSF
Sbjct  386  LLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINEGEKRVVITDRMWARLLSSTHQPSF  445

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  446  LDPKDITE  453



>gb|AFW80261.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
 gb|AFW80262.1| hypothetical protein ZEAMMB73_064922 [Zea mays]
Length=375

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 214/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  95   GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E++E+ LK++ HMVIVVAEGAGQ+L++ ++   
Sbjct  155  ATLASRDVDCCLIPESPFYLEGKGGLLEFVERRLKDNGHMVIVVAEGAGQDLIARSMNFV  214

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  215  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCT  273

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  274  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  333

Query  722  LRTRDV  739
            L   DV
Sbjct  334  LSHEDV  339



>ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 212/248 (85%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ HMVIV+AEGA            
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFVERRLKENGHMVIVLAEGA--GQDLMCKSME  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQ IK HF+K  KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  332  STLKDASGNKLLKDVGLWLSQSIKVHFNKN-KMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITETQNNVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  451  LGPKDIPE  458



>ref|XP_009132191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=485

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 216/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGR+SGFIAMY
Sbjct  209  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRHSGFIAMY  268

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKEH HMVIV+AEGA  + +    + +
Sbjct  269  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKEHGHMVIVLAEGA-GQEMMTKSMET  327

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNKVL+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  328  NTLEDASGNKVLKDVGLWLSQSIKDHF-KKIKMVMNLKYIDPTYMIRAIPSNAADNVYCT  386

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G V+GR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  387  LLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQNSVVITDRMWARLLSSTNQPSF  446

Query  722  LRTRDVIES  748
            L  +++ E 
Sbjct  447  LGPKNISEQ  455



>ref|XP_009126929.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=490

 Score =   399 bits (1024),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 216/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTID+DIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDDDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IE+ LKE+ HMVIV+AEGA  + L    + S
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKENGHMVIVLAEGA-GQELMSKSMES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRA+PSNASDNVYC+
Sbjct  333  NALEDASGNKLLKDVGLWLSQSIKDHF-KKNKMEMNLKYIDPTYMIRAVPSNASDNVYCS  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QNHVVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNHVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  452  LGPQDIPE  459



>ref|XP_011072633.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Sesamum indicum]
Length=457

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/245 (80%), Positives = 219/245 (89%), Gaps = 1/245 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDT+VEEAQRAI+AAHVEA S ENG+G+VKL GRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTSVEEAQRAINAAHVEANSIENGVGVVKLTGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYI K LKE+ HMVIV+AEGAGQELL++N+   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLFEYIRKRLKENGHMVIVIAEGAGQELLAKNMHDM  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                D S  K+L+DVGLW+++KIKDHF+K++KM IN+KYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  DQL-DPSETKLLQDVGLWITEKIKDHFTKERKMIINVKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGF VG VNGRHAYIP++RI E +N VVITDRMWARLL STNQPSF
Sbjct  393  LLAHSAIHGAMAGYTGFVVGPVNGRHAYIPFHRINERRNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRD  736
            L  +D
Sbjct  453  LNPKD  457



>gb|KCW90883.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=435

 Score =   397 bits (1019),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 222/247 (90%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  170  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGVVKLMGRYSGFIAMF  229

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ H+VIV+AEGAGQE +++++ + 
Sbjct  230  ATLASRDVDCCLIPESPFYLEGKGGLFEFVEQRLKENGHVVIVLAEGAGQEYVAQSMHTV  289

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWLSQ+IKDHF+K +KM IN+KYIDPTYMIRAIPSNASDN+YCT
Sbjct  290  DG-RDASGNRLLLDVGLWLSQQIKDHFTKVQKMAINMKYIDPTYMIRAIPSNASDNIYCT  348

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP +R+TE QN V +TDRMWARLL STNQPSF
Sbjct  349  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPISRVTETQNIVKLTDRMWARLLASTNQPSF  408

Query  722  LRTRDVI  742
            L + +V+
Sbjct  409  LNSDEVM  415



>ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
 sp|Q9C5J7.1|PFKA7_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 7; Short=ATP-PFK 
7; Short=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 
7 [Arabidopsis thaliana]
 gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
Length=485

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSG+IAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGYIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LK+H HMVIV+AEGAGQ+L+ +++ S+
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKDHGHMVIVLAEGAGQDLMCKSMEST  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  PM--DASGNKLLKDVGLWLSQSIKDHF-KKNKMVMNLKYIDPTYMIRAVPSNASDNVYCT  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQNNVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIE  745
            L  +D  E
Sbjct  451  LGPKDTSE  458



>dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=488

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 221/248 (89%), Gaps = 3/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSG+IAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGYIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LK+H HMVIV+AEGAGQ+L+ +++ S+
Sbjct  277  ATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKDHGHMVIVLAEGAGQDLMCKSMEST  336

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  337  PM--DASGNKLLKDVGLWLSQSIKDHF-KKNKMVMNLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+ RITE QN+VVITDRMWARLL STNQPSF
Sbjct  394  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITETQNNVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDVIE  745
            L  +D  E
Sbjct  454  LGPKDTSE  461



>emb|CDY11911.1| BnaC03g13370D [Brassica napus]
Length=478

 Score =   398 bits (1022),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/248 (80%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGR+SGFIAMY
Sbjct  209  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRHSGFIAMY  268

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKEH HMVIV+AEGA  + +    + +
Sbjct  269  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKEHGHMVIVLAEGA-GQEMMTKSMET  327

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNKVL+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  328  NTLEDASGNKVLKDVGLWLSQSIKDHF-KKIKMVMNLKYIDPTYMIRAIPSNAADNVYCT  386

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G V+GR  YIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  387  LLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQNSVVITDRMWARLLSSTNQPSF  446

Query  722  LRTRDVIE  745
            L  + V E
Sbjct  447  LGPKHVSE  454



>ref|NP_001054859.1| Os05g0194900 [Oryza sativa Japonica Group]
 dbj|BAF16773.1| Os05g0194900, partial [Oryza sativa Japonica Group]
Length=288

 Score =   390 bits (1003),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/246 (78%), Positives = 212/246 (86%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VID+SFGFDTAVEEAQRAI+AAHVEA S ENG+G+VKLMGR SGFIAMY
Sbjct  2    GVPKTIDNDIAVIDRSFGFDTAVEEAQRAINAAHVEAESAENGVGVVKLMGRNSGFIAMY  61

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVD CLIPESPFYLEG GGL E+ EK L+E+ HMVIVVAEGAGQ++++ ++  +
Sbjct  62   ATLASRDVDLCLIPESPFYLEGKGGLLEFAEKRLRENGHMVIVVAEGAGQDVIARSMRLA  121

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNKVL DVGLWL  KIKDHF K+   PI LKYIDPTYMIRA+PSNASDNVYC+
Sbjct  122  DA-HDASGNKVLLDVGLWLCAKIKDHFKKKANFPITLKYIDPTYMIRAVPSNASDNVYCS  180

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  181  LLAHSAIHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  240

Query  722  LRTRDV  739
            L T DV
Sbjct  241  LSTEDV  246



>ref|XP_010095449.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=495

 Score =   398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 206/257 (80%), Positives = 223/257 (87%), Gaps = 10/257 (4%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGR--------  157
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR        
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRIRALHGVL  273

Query  158  YSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqel  337
             +GFIAMYATLASRDVDCCLIPESPFYLEG GGLFE+IEK LKE+ HMVIV+AEGAGQEL
Sbjct  274  LAGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFIEKRLKENGHMVIVIAEGAGQEL  333

Query  338  lsenllssgnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSN  517
            LSE+L S    +DASGNK+L DVGLWLSQ+IKDHFSKQ+   INLKYIDPTYMIRAIPSN
Sbjct  334  LSESLESMK--QDASGNKLLPDVGLWLSQRIKDHFSKQRNFAINLKYIDPTYMIRAIPSN  391

Query  518  ASDNVYCTLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLL  697
            ASDNVYCTLLAQSAVHGAMAGYTGFT G VNGR  YIP++RITE QN VVITDRMWARLL
Sbjct  392  ASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFHRITERQNKVVITDRMWARLL  451

Query  698  CSTNQPSFLRTRDVIES  748
             STNQPSF   +++ E+
Sbjct  452  SSTNQPSFPNPKELAEA  468



>ref|XP_004149188.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 7-like 
[Cucumis sativus]
Length=512

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 217/247 (88%), Gaps = 2/247 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVE+ S ENGIGLVKLMGR SGFIAMY
Sbjct  235  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESNENGIGLVKLMGRNSGFIAMY  294

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  +KEH HMVIV+AEGA  + L    +  
Sbjct  295  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGA-GQELMSESIHK  353

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
             +Q+DASGNK+ +DVGLW+SQ+IKD+F  K++KM INLKYIDPTYMIRA+PS ASDN++C
Sbjct  354  LDQQDASGNKLHQDVGLWISQQIKDYFKEKKEKMVINLKYIDPTYMIRAVPSIASDNIFC  413

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLAQSA+HGAMAGYTGFTVG VNGRHAYIP+ RITE QN VVITDRMWARLL STNQPS
Sbjct  414  TLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPS  473

Query  719  FLRTRDV  739
            FL  + V
Sbjct  474  FLHPKHV  480



>ref|XP_008447566.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=530

 Score =   399 bits (1024),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 199/246 (81%), Positives = 220/246 (89%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVE+ S ENGIGLVKLMGR SGFIAMY
Sbjct  254  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESNENGIGLVKLMGRNSGFIAMY  313

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIE  +KEH HMVIV+AEGAGQEL+SE++   
Sbjct  314  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHMVIVIAEGAGQELMSESIHKL  373

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+ +DVGLW+SQ+IKD F +++KM INLKYIDPTYMIRA+PS ASDN++CT
Sbjct  374  DQ-QDASGNKLHQDVGLWISQQIKDFFKEKRKMVINLKYIDPTYMIRAVPSIASDNIFCT  432

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSA+HGAMAGYTGFTVG VNGRHAYIP++RI E QN VVITDRMWARLL STNQPSF
Sbjct  433  LLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFHRIIERQNKVVITDRMWARLLSSTNQPSF  492

Query  722  LRTRDV  739
            L  + V
Sbjct  493  LHPKHV  498



>gb|KCW90878.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=474

 Score =   396 bits (1018),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 222/247 (90%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  209  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGVVKLMGRYSGFIAMF  268

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ H+VIV+AEGAGQE +++++ + 
Sbjct  269  ATLASRDVDCCLIPESPFYLEGKGGLFEFVEQRLKENGHVVIVLAEGAGQEYVAQSMHTV  328

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWLSQ+IKDHF+K +KM IN+KYIDPTYMIRAIPSNASDN+YCT
Sbjct  329  DG-RDASGNRLLLDVGLWLSQQIKDHFTKVQKMAINMKYIDPTYMIRAIPSNASDNIYCT  387

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP +R+TE QN V +TDRMWARLL STNQPSF
Sbjct  388  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPISRVTETQNIVKLTDRMWARLLASTNQPSF  447

Query  722  LRTRDVI  742
            L + +V+
Sbjct  448  LNSDEVM  454



>ref|XP_011022362.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Populus euphratica]
Length=504

 Score =   397 bits (1020),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 223/247 (90%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  257  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMF  316

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+IE+ +KE+ HMVIV+AEGAGQE +++++ ++
Sbjct  317  ATLASRDVDCCLIPESPFYLEGPGGLFEFIEQRIKENGHMVIVIAEGAGQEYVAQDMQAA  376

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWL+Q++KDHF+K KKM IN+KYIDPTYMIRAIPSNASDN+YC+
Sbjct  377  DE-RDASGNRLLLDVGLWLTQEVKDHFTKVKKMEINMKYIDPTYMIRAIPSNASDNIYCS  435

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP  R+TE QN V +TDRMWARLL STNQPSF
Sbjct  436  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEAQNTVKVTDRMWARLLASTNQPSF  495

Query  722  LRTRDVI  742
            L + +++
Sbjct  496  LNSNEML  502



>gb|EYU20177.1| hypothetical protein MIMGU_mgv1a004503mg [Erythranthe guttata]
Length=523

 Score =   397 bits (1021),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/249 (78%), Positives = 222/249 (89%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  275  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMH  334

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ H+VIV+AEGAGQE ++++L ++
Sbjct  335  ATLASRDVDCCLIPESPFYLEGQGGLFEFIEERLKENSHIVIVLAEGAGQEYVAQSLHAA  394

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWL+QK KDHF+K +KM IN+KYIDPTYMIRA+PSNASDN+YCT
Sbjct  395  DE-KDASGNKLLLDVGLWLTQKFKDHFTKVRKMGINMKYIDPTYMIRAVPSNASDNIYCT  453

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TGFTVG VN RHAYIP +R+TE QN V +TDRMWARLL STNQPSF
Sbjct  454  LLAQSAVHGAMAGFTGFTVGPVNSRHAYIPISRVTEAQNTVKLTDRMWARLLASTNQPSF  513

Query  722  LRTRDVIES  748
            L +  V E+
Sbjct  514  LNSEVVQEN  522



>ref|XP_006385829.1| hypothetical protein POPTR_0003s15090g [Populus trichocarpa]
 gb|ERP63626.1| hypothetical protein POPTR_0003s15090g [Populus trichocarpa]
Length=504

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 221/247 (89%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  257  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMF  316

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+IE+ +KE+ HMVIV+AEGAGQE +++ + ++
Sbjct  317  ATLASRDVDCCLIPESPFYLEGPGGLFEFIEQRIKENGHMVIVIAEGAGQEYVAQAMQAA  376

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWL+QK+KDHF+K KKM IN+KYIDPTYMIRAIPSNASDN+YC+
Sbjct  377  DE-RDASGNRLLLDVGLWLTQKVKDHFTKVKKMEINMKYIDPTYMIRAIPSNASDNIYCS  435

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP  R+TE QN V +T RMWARLL STNQPSF
Sbjct  436  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEAQNTVKVTGRMWARLLASTNQPSF  495

Query  722  LRTRDVI  742
            L + +++
Sbjct  496  LNSNEML  502



>gb|KHN39263.1| 6-phosphofructokinase 3 [Glycine soja]
Length=464

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 223/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP+++DNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGR+SGFI+MY
Sbjct  213  GIPESVDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGVVKLMGRHSGFISMY  272

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+I K L E+ HMVIV++EGAG EL+SE+L ++
Sbjct  273  ATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLAENGHMVIVISEGAGHELISESLSAT  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               ++ASGNK+L+DVGLWLSQKIKDHF+K +KM I LKYIDPTYMIRA+PS ASDNV+CT
Sbjct  333  NK-QEASGNKLLQDVGLWLSQKIKDHFTKSQKMDITLKYIDPTYMIRAVPSIASDNVHCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF VG+VNG+HAYIP+ RI E +  VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFAVGTVNGKHAYIPFYRINEIEKKVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDV  739
            L  +D+
Sbjct  452  LNPKDI  457



>ref|XP_010447333.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Camelina sativa]
Length=464

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 212/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  217  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  276

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGA      + +  S
Sbjct  277  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGA----GQDLVAES  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK+HF+KQ  + I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  333  VEQQDASGNKLLKDVGLWMSLKIKEHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYST  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  452

Query  722  L  724
            +
Sbjct  453  M  453



>ref|XP_006583042.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=464

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 223/246 (91%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP+++DNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGR+SGFI+MY
Sbjct  213  GIPESVDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGVVKLMGRHSGFISMY  272

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+I K L E+ HMVIV++EGAG EL+SE+L ++
Sbjct  273  ATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLAENGHMVIVISEGAGHELISESLSAT  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               ++ASGNK+L+DVGLWLSQKIKDHF+K +KM I LKYIDPTYMIRA+PS ASDNV+CT
Sbjct  333  NK-QEASGNKLLQDVGLWLSQKIKDHFTKSQKMDITLKYIDPTYMIRAVPSIASDNVHCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF VG+VNG+HAYIP+ RI E +  VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFAVGTVNGKHAYIPFYRINEIEKKVVITDRMWARLLSSTNQPSF  451

Query  722  LRTRDV  739
            L  +D+
Sbjct  452  LNPKDI  457



>ref|XP_010690141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   395 bits (1015),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 218/246 (89%), Gaps = 2/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S E+G+G+VKLMGR SGFIA+Y
Sbjct  219  GVPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESGEHGVGVVKLMGRDSGFIALY  278

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEY+EK LKE+ HMVIV+AEGA  + L    +  
Sbjct  279  ATLASRDVDCCLIPESPFYLEGPGGLFEYMEKRLKENGHMVIVIAEGA-GQNLLSECMRK  337

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             ++KDASGNK+L+DVGLW+SQKIKD+F KQ++  INLKYIDPTYMIRAIP+NASDNVYCT
Sbjct  338  VHEKDASGNKLLQDVGLWISQKIKDYF-KQQEWVINLKYIDPTYMIRAIPANASDNVYCT  396

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTVG VN RHAYIP+ RITE QN VVITDRMWARLL STNQPSF
Sbjct  397  LLAHSAIHGAMAGYTGFTVGPVNSRHAYIPFQRITERQNKVVITDRMWARLLSSTNQPSF  456

Query  722  LRTRDV  739
            L  + +
Sbjct  457  LDPKTI  462



>ref|XP_011076434.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Sesamum indicum]
Length=536

 Score =   397 bits (1021),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 219/248 (88%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  272  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMH  331

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ HMVIV+AEGAGQE ++++  ++
Sbjct  332  ATLASRDVDCCLIPESPFYLEGQGGLFEFVEERLKENGHMVIVLAEGAGQEYVAQSWHAA  391

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN++L DVGLWL+QKIKDHF+  +KM IN+KYIDPTYMIRAIPSNASDN+YCT
Sbjct  392  AE-KDASGNRLLLDVGLWLTQKIKDHFTNVRKMAINMKYIDPTYMIRAIPSNASDNIYCT  450

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQ+AVHGAMAGYTGFTVG VN RHAYIP NR+TE QN V +TDRMWARLL STNQPSF
Sbjct  451  LLAQNAVHGAMAGYTGFTVGPVNSRHAYIPINRVTETQNTVKLTDRMWARLLTSTNQPSF  510

Query  722  LRTRDVIE  745
            L    V E
Sbjct  511  LSCEVVQE  518



>ref|XP_010447334.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Camelina sativa]
Length=462

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 212/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGA      + +  S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGA----GQDLVAES  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK+HF+KQ  + I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  331  VEQQDASGNKLLKDVGLWMSLKIKEHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYST  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  450

Query  722  L  724
            +
Sbjct  451  M  451



>ref|XP_002867225.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43484.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 215/241 (89%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEANSVENGIGLVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIV+AEGAGQ+L++E+    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVIAEGAGQDLVAESTDQ-  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L+DVGLW+S KIK+HF+KQ  M I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  333  ---QDASGNKLLKDVGLWMSLKIKEHFAKQSVMDITLKYIDPTYMIRAIPANASDNVYST  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSF  449

Query  722  L  724
            +
Sbjct  450  M  450



>ref|XP_002511010.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF51612.1| phosphofructokinase, putative [Ricinus communis]
Length=522

 Score =   397 bits (1020),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 221/248 (89%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  256  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMF  315

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFEYIE+ LKE+ H+VIV+AEGAGQE ++++  +S
Sbjct  316  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEQRLKENGHLVIVIAEGAGQEYVAQSTQAS  375

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWLSQ IK+HF+  +KM +N+KYIDPTYMIRA+PSNASDN+YCT
Sbjct  376  EE-RDASGNRLLLDVGLWLSQNIKEHFTNIQKMAVNMKYIDPTYMIRAVPSNASDNIYCT  434

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP  R+TE  N V +TDRMWARLL STNQPSF
Sbjct  435  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTEATNTVKVTDRMWARLLASTNQPSF  494

Query  722  LRTRDVIE  745
            L +++V++
Sbjct  495  LISKEVLQ  502



>ref|XP_010432655.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Camelina sativa]
Length=462

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 212/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGA      + +  S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGA----GQDLVAES  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK+HF+KQ  + I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  331  VEQQDASGNKLLKDVGLWMSLKIKEHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYST  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  450

Query  722  L  724
            +
Sbjct  451  M  451



>ref|XP_010437846.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Camelina 
sativa]
Length=462

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 212/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIVVAEGA      + +  S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVVAEGA----GQDLVAES  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK+HF+KQ  + I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  331  VEQQDASGNKLLKDVGLWMSLKIKEHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYST  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSF  450

Query  722  L  724
            +
Sbjct  451  M  451



>gb|AHB32113.1| 6-phosphofructokinase 3-like protein [Camellia sinensis]
 gb|AHE93342.1| phosphofructokinase [Camellia sinensis]
Length=495

 Score =   395 bits (1016),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 221/249 (89%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA STENG+G+VKLMGR SGFIAMY
Sbjct  214  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESTENGVGVVKLMGRDSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF+LEG GGLFEY+EKTLKE+ HMVIV+AEGAGQE LS +L   
Sbjct  274  ATLASRDVDCCLIPESPFFLEGKGGLFEYVEKTLKENGHMVIVIAEGAGQEFLSGSLQPG  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +D SGN+ L+DVGLW+S +IK+HF+K+ KM + LKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  334  EE-RDPSGNRQLQDVGLWISNRIKEHFAKRNKMVLTLKYIDPTYMIRAIPSNAADNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIP+NRITE QN VVITDRMWARLL STNQPSF
Sbjct  393  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFNRITERQNKVVITDRMWARLLSSTNQPSF  452

Query  722  LRTRDVIES  748
            L  +++ E+
Sbjct  453  LGPKEMAEA  461



>ref|XP_010668815.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 217/249 (87%), Gaps = 5/249 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VID+SFGFD+AVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  223  GIPKTIDNDISVIDRSFGFDSAVEEAQRAINAAHVEADSMENGIGLVKLMGRYSGFIAMY  282

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LKE+ HMVIV+AEGA      E L  +
Sbjct  283  ATLASRDVDCCLIPESPFYLEGKGGLFEYIGKRLKENGHMVIVMAEGA----GQELLSEN  338

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N+KDASGNK+L+DVGLW+S KIK+HF++ K M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  339  RNEKDASGNKLLKDVGLWMSHKIKEHFAR-KSMIINLKYIDPTYMIRAIPSNASDNVYCT  397

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TG TVG VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  398  LLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQNQVCITDRMWARLLSSTNQPSF  457

Query  722  LRTRDVIES  748
            L  ++V ++
Sbjct  458  LGDKEVAKA  466



>ref|XP_006412426.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
 gb|ESQ53879.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
Length=462

 Score =   394 bits (1013),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 212/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIGLVKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIV+AEGA      + L  S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVIAEGA----GQDLLAES  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK++F+KQ KM I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  331  IEQQDASGNKLLKDVGLWMSIKIKEYFAKQSKMDITLKYIDPTYMIRAIPANASDNVYST  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRITERQNKVVITDRMWARMLSSTNQPSF  450

Query  722  L  724
            +
Sbjct  451  M  451



>emb|CDX88580.1| BnaA03g10690D [Brassica napus]
Length=485

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 215/248 (87%), Gaps = 2/248 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGR+SGFIAMY
Sbjct  209  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRHSGFIAMY  268

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LKEH HMVIV+AEGA  + +    + S
Sbjct  269  ATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKEHGHMVIVLAEGA-GQEMMTKSMES  327

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNKVL+DVGLWLSQ IKDHF K+ KM +NLKYIDPTYMIRAIPSNA+DNVYCT
Sbjct  328  TTLEDASGNKVLKDVGLWLSQSIKDHF-KKIKMVMNLKYIDPTYMIRAIPSNAADNVYCT  386

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G V+GR  YIP+ RITE QN VVITDRMWARLL STNQ SF
Sbjct  387  LLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEKQNSVVITDRMWARLLSSTNQLSF  446

Query  722  LRTRDVIE  745
            L  +++ E
Sbjct  447  LGPKNISE  454



>ref|XP_009395732.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Musa acuminata subsp. malaccensis]
Length=522

 Score =   396 bits (1017),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 223/241 (93%), Gaps = 1/241 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE+ S ENGIG+VKLMGR+SGFIAMY
Sbjct  267  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVESESVENGIGVVKLMGRFSGFIAMY  326

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYIEK LK++ HMVIVVAEGAGQEL+++++ S 
Sbjct  327  ATLASRDVDCCLIPESPFYLEGRGGLFEYIEKRLKDNGHMVIVVAEGAGQELIADSVRSM  386

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G+ +DASGNK+L DVGLWLSQKIK++F+ +++M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  387  GH-EDASGNKLLLDVGLWLSQKIKNYFTSRQRMTINLKYIDPTYMIRAIPSNASDNVYCT  445

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQ+AVHGAMAGYTGFT+G VNGRH YIP+ R+TE +N V+ITDRMWARLL STNQPSF
Sbjct  446  LLAQNAVHGAMAGYTGFTIGVVNGRHTYIPFYRVTEKRNKVIITDRMWARLLSSTNQPSF  505

Query  722  L  724
            L
Sbjct  506  L  506



>ref|XP_003546601.1| PREDICTED: 6-phosphofructokinase 3 isoform X1 [Glycine max]
 ref|XP_006597174.1| PREDICTED: 6-phosphofructokinase 3 isoform X2 [Glycine max]
 ref|XP_006597175.1| PREDICTED: 6-phosphofructokinase 3 isoform X3 [Glycine max]
 ref|XP_006597176.1| PREDICTED: 6-phosphofructokinase 3 isoform X4 [Glycine max]
 ref|XP_006597177.1| PREDICTED: 6-phosphofructokinase 3 isoform X5 [Glycine max]
 gb|KHN32659.1| 6-phosphofructokinase 3 [Glycine soja]
Length=481

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKS GFDTAVEEAQRAI++AHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSIGFDTAVEEAQRAINSAHVEAESAENGIGVVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGL E+IEK LKE  HMVIV+AEGAGQELLS N    
Sbjct  274  ATLASRDVDCCLIPESPFYLEGPGGLLEFIEKRLKEQGHMVIVIAEGAGQELLSGNPSIV  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DAS +K+  DVGLWLSQKIKDHF K++KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  NK-PDASADKLFPDVGLWLSQKIKDHFEKRQKMAINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNGR+ YIP++ I EG+  VVITDRMWARLL ST+QP F
Sbjct  393  LLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINEGEKRVVITDRMWARLLSSTHQPCF  452

Query  722  LRTRDV  739
            L  +++
Sbjct  453  LNPKEI  458



>ref|XP_009409366.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   397 bits (1019),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 213/242 (88%), Gaps = 2/242 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIAMY
Sbjct  268  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEADSVENGIGVVKLMGRYSGFIAMY  327

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LKE+ HMVIVVAEGA  + L    + S
Sbjct  328  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKENGHMVIVVAEGA-GQDLLVKSMQS  386

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHF-SKQKKMPINLKYIDPTYMIRAIPSNASDNVYC  538
             + +DASGNK+L DVGLWLSQKIKDHF S +KKM INLKYIDPTYMIRA+PSNASDNVYC
Sbjct  387  MDHEDASGNKLLLDVGLWLSQKIKDHFSSNKKKMSINLKYIDPTYMIRAVPSNASDNVYC  446

Query  539  TLLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPS  718
            TLLA SA+HGAMAGYTGFT+G VNGRHAYIP+ R+TE    VVITDRMWARLL STNQPS
Sbjct  447  TLLAHSAIHGAMAGYTGFTIGPVNGRHAYIPFCRVTETCKKVVITDRMWARLLSSTNQPS  506

Query  719  FL  724
            FL
Sbjct  507  FL  508



>ref|XP_009388585.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  215  GIPKTIDNDIVVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF++EG GGL  +IE+ LKE+ HMVIVVAEGAGQEL++E++ S 
Sbjct  275  ATLASRDVDCCLIPESPFHMEGKGGLLAFIERRLKENGHMVIVVAEGAGQELITESMRSM  334

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLS KIKDHF++ +KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  335  EH-QDASGNKLLLDVGLWLSHKIKDHFARNQKMAINLKYIDPTYMIRAVPSNASDNVYCT  393

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HG MAGYTGFTVG VNGRHAYIP++RITE QN VVITDRMWARLL STNQPSF
Sbjct  394  LLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITEKQNKVVITDRMWARLLSSTNQPSF  453

Query  722  LRTRDV  739
            +  +D+
Sbjct  454  ISQKDI  459



>gb|EAZ10866.1| hypothetical protein OsJ_00706 [Oryza sativa Japonica Group]
Length=503

 Score =   395 bits (1015),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 216/246 (88%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  214  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LK++ HMVIVVAEGAGQ+L+++++   
Sbjct  274  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDLIAKSMNFV  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K++  PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  334  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  393  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  452

Query  722  LRTRDV  739
            L   DV
Sbjct  453  LSHEDV  458



>ref|XP_006421534.1| hypothetical protein CICLE_v10004702mg [Citrus clementina]
 gb|ESR34774.1| hypothetical protein CICLE_v10004702mg [Citrus clementina]
Length=534

 Score =   396 bits (1018),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 218/247 (88%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFI+MY
Sbjct  267  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFISMY  326

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+IE+ LKE+ HMVIVVAEGAGQE +++++ + 
Sbjct  327  ATLASRDVDCCLIPESPFYLEGPGGLFEFIERQLKENGHMVIVVAEGAGQEFVAQSMPAV  386

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN++L D+GLWL+QKIKDHF+K +KM IN+KYIDPTYMIRAIPSN SDN+YCT
Sbjct  387  DE-KDASGNRLLLDIGLWLTQKIKDHFTKVQKMTINMKYIDPTYMIRAIPSNGSDNIYCT  445

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAG+TGFTVG VN RHAYIP  R+TE Q  V +TDRMWARLL STNQPSF
Sbjct  446  LLAHSAVHGAMAGFTGFTVGPVNSRHAYIPIARVTETQKTVKLTDRMWARLLASTNQPSF  505

Query  722  LRTRDVI  742
            L   +V+
Sbjct  506  LNCSEVL  512



>emb|CDY32873.1| BnaC09g33200D [Brassica napus]
Length=488

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK +KE+ HMVIV+AEGAGQEL+S+++ S+
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKSMESN  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLWLSQ IKD+F K+  M +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  T---DASGNKLLKDVGLWLSQSIKDYF-KKINMVMNLKYIDPTYMIRAVPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  450  LGPKDIPE  457



>ref|XP_010668810.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=514

 Score =   395 bits (1015),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/249 (80%), Positives = 217/249 (87%), Gaps = 5/249 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VID+SFGFD+AVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIAMY
Sbjct  250  GIPKTIDNDISVIDRSFGFDSAVEEAQRAINAAHVEADSMENGIGLVKLMGRYSGFIAMY  309

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI K LKE+ HMVIV+AEGA      E L  +
Sbjct  310  ATLASRDVDCCLIPESPFYLEGKGGLFEYIGKRLKENGHMVIVMAEGA----GQELLSEN  365

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             N+KDASGNK+L+DVGLW+S KIK+HF++ K M INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  366  RNEKDASGNKLLKDVGLWMSHKIKEHFAR-KSMIINLKYIDPTYMIRAIPSNASDNVYCT  424

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG+TG TVG VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  425  LLAQSAVHGAMAGFTGSTVGLVNGRHTYIPFERITEQQNQVCITDRMWARLLSSTNQPSF  484

Query  722  LRTRDVIES  748
            L  ++V ++
Sbjct  485  LGDKEVAKA  493



>ref|NP_001042273.1| Os01g0191700 [Oryza sativa Japonica Group]
 dbj|BAD72228.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAD72231.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAF04187.1| Os01g0191700 [Oryza sativa Japonica Group]
 gb|EAY72859.1| hypothetical protein OsI_00730 [Oryza sativa Indica Group]
Length=531

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 216/246 (88%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  249  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  308

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LK++ HMVIVVAEGAGQ+L+++++   
Sbjct  309  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDLIAKSMNFV  368

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K++  PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  369  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNASDNVYCT  427

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  428  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  487

Query  722  LRTRDV  739
            L   DV
Sbjct  488  LSHEDV  493



>ref|XP_009120176.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Brassica rapa]
Length=488

 Score =   394 bits (1012),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/248 (81%), Positives = 221/248 (89%), Gaps = 4/248 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG VKLMGRYSGFIAMY
Sbjct  214  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGFIAMY  273

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK +KE+ HMVIV+AEGAGQEL+S+++ S+
Sbjct  274  ATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRIKENGHMVIVLAEGAGQELMSKSMESN  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
                DASGNK+L+DVGLWLSQ IKD+F K+  M +NLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  334  T---DASGNKLLKDVGLWLSQSIKDYF-KKINMVMNLKYIDPTYMIRAVPSNASDNVYCT  389

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTG+T G VNGR  YIPY RITE QN+VVITDRMWARLL STNQPSF
Sbjct  390  LLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEKQNNVVITDRMWARLLSSTNQPSF  449

Query  722  LRTRDVIE  745
            L  +D+ E
Sbjct  450  LGPKDIPE  457



>ref|XP_006490011.1| PREDICTED: 6-phosphofructokinase 4, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006490012.1| PREDICTED: 6-phosphofructokinase 4, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=534

 Score =   395 bits (1016),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 218/247 (88%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFI+MY
Sbjct  267  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFISMY  326

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+IE+ LKE+ HMVIVVAEGAGQE +++++ + 
Sbjct  327  ATLASRDVDCCLIPESPFYLEGPGGLFEFIERQLKENGHMVIVVAEGAGQEFVAQSMPAV  386

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN++L D+GLWL+QKIKDHF+K +KM IN+KYIDPTYMIRAIPSN SDN+YCT
Sbjct  387  DE-KDASGNRLLLDIGLWLTQKIKDHFTKVQKMMINMKYIDPTYMIRAIPSNGSDNIYCT  445

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAG+TGFTVG VN RHAYIP  R+TE Q  V +TDRMWARLL STNQPSF
Sbjct  446  LLAHSAVHGAMAGFTGFTVGPVNSRHAYIPIARVTETQKTVKLTDRMWARLLASTNQPSF  505

Query  722  LRTRDVI  742
            L   +V+
Sbjct  506  LNCSEVL  512



>ref|XP_010062614.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Eucalyptus grandis]
 gb|KCW90877.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=520

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/247 (78%), Positives = 222/247 (90%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  255  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGVVKLMGRYSGFIAMF  314

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE++E+ LKE+ H+VIV+AEGAGQE +++++ + 
Sbjct  315  ATLASRDVDCCLIPESPFYLEGKGGLFEFVEQRLKENGHVVIVLAEGAGQEYVAQSMHTV  374

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN++L DVGLWLSQ+IKDHF+K +KM IN+KYIDPTYMIRAIPSNASDN+YCT
Sbjct  375  DG-RDASGNRLLLDVGLWLSQQIKDHFTKVQKMAINMKYIDPTYMIRAIPSNASDNIYCT  433

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP +R+TE QN V +TDRMWARLL STNQPSF
Sbjct  434  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPISRVTETQNIVKLTDRMWARLLASTNQPSF  493

Query  722  LRTRDVI  742
            L + +V+
Sbjct  494  LNSDEVM  500



>ref|XP_010275416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 218/248 (88%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  269  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMF  328

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG  GLFE+IEK LKE+ H+VIV+AEGAGQE ++  + + 
Sbjct  329  ATLASRDVDCCLIPESPFYLEGQDGLFEFIEKRLKENGHIVIVLAEGAGQEHVARIMHAV  388

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  KDASGN++L DVGLWLSQ+IKDHF+K++KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  389  GE-KDASGNRLLLDVGLWLSQEIKDHFTKERKMAINLKYIDPTYMIRAIPSNASDNIYCT  447

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VN RHAYIP  R+TE QN V +TDRMWARLL STNQPSF
Sbjct  448  LLAHSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTETQNTVKLTDRMWARLLASTNQPSF  507

Query  722  LRTRDVIE  745
            L    V++
Sbjct  508  LNYNKVMQ  515



>ref|XP_004969889.1| PREDICTED: 6-phosphofructokinase 3-like [Setaria italica]
Length=369

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/246 (78%), Positives = 216/246 (88%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA+S ENGIGLVKLMGRYSGFIAMY
Sbjct  95   GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEASSAENGIGLVKLMGRYSGFIAMY  154

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFEYI++ LKE++HMVIVVAEGA  + L    + +
Sbjct  155  ATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLKENNHMVIVVAEGA-GQDLIAQSIPA  213

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             +Q+DASGNK+L DVGLWL+ KIKD + K KKM + +KYIDPTYMIRAIPSNASDNVYCT
Sbjct  214  ADQQDASGNKLLLDVGLWLTHKIKD-YCKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCT  272

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGY+ FTVG VNGRHAYIP++R+T  +N V ITDRMWARLL STNQPSF
Sbjct  273  LLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTSTRNKVRITDRMWARLLSSTNQPSF  331

Query  722  LRTRDV  739
            L  +D+
Sbjct  332  LSQKDI  337



>ref|XP_010275417.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Nelumbo 
nucifera]
Length=529

 Score =   394 bits (1013),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 218/248 (88%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIAM+
Sbjct  265  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIAMF  324

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG  GLFE+IEK LKE+ H+VIV+AEGAGQE ++  + + 
Sbjct  325  ATLASRDVDCCLIPESPFYLEGQDGLFEFIEKRLKENGHIVIVLAEGAGQEHVARIMHAV  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
            G  KDASGN++L DVGLWLSQ+IKDHF+K++KM INLKYIDPTYMIRAIPSNASDN+YCT
Sbjct  385  GE-KDASGNRLLLDVGLWLSQEIKDHFTKERKMAINLKYIDPTYMIRAIPSNASDNIYCT  443

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SAVHGAMAGYTGFTVG VN RHAYIP  R+TE QN V +TDRMWARLL STNQPSF
Sbjct  444  LLAHSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTETQNTVKLTDRMWARLLASTNQPSF  503

Query  722  LRTRDVIE  745
            L    V++
Sbjct  504  LNYNKVMQ  511



>ref|XP_009388583.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  265  GIPKTIDNDIVVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMY  324

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPF++EG GGL  +IE+ LKE+ HMVIVVAEGAGQEL++E++ S 
Sbjct  325  ATLASRDVDCCLIPESPFHMEGKGGLLAFIERRLKENGHMVIVVAEGAGQELITESMRSM  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
             + +DASGNK+L DVGLWLS KIKDHF++ +KM INLKYIDPTYMIRA+PSNASDNVYCT
Sbjct  385  EH-QDASGNKLLLDVGLWLSHKIKDHFARNQKMAINLKYIDPTYMIRAVPSNASDNVYCT  443

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HG MAGYTGFTVG VNGRHAYIP++RITE QN VVITDRMWARLL STNQPSF
Sbjct  444  LLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITEKQNKVVITDRMWARLLSSTNQPSF  503

Query  722  LRTRDV  739
            +  +D+
Sbjct  504  ISQKDI  509



>ref|XP_002457198.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
 gb|EES02318.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
Length=530

 Score =   394 bits (1012),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  251  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  310

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LK++ HMVIVVAEGAGQ+L+++++   
Sbjct  311  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDLIAKSMNFV  370

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  371  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCT  429

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  430  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  489

Query  722  LRTRDV  739
            L   DV
Sbjct  490  LSHEDV  495



>ref|XP_011019558.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Populus 
euphratica]
Length=480

 Score =   392 bits (1008),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 196/249 (79%), Positives = 220/249 (88%), Gaps = 1/249 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR+SGFIAM+
Sbjct  212  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAGSFENGIGIVKLMGRHSGFIAMH  271

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+I++ LKE+ HMVIVVAEGAGQ+LL++ L S 
Sbjct  272  ATLASRDVDCCLIPESPFYLEGKGGLFEFIKRRLKENGHMVIVVAEGAGQDLLAKYLQSM  331

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN +L+DVGLW+S KI DHF++ +KM I LKYIDPTYMIRA+P NASDNVYC 
Sbjct  332  NQ-QDASGNHLLQDVGLWISHKINDHFARVQKMTITLKYIDPTYMIRAVPGNASDNVYCY  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VNG+H+YIP+ RI E QN VVITDRMWARLL STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFTVGPVNGQHSYIPFERINERQNQVVITDRMWARLLSSTNQPSF  450

Query  722  LRTRDVIES  748
            +  R V ES
Sbjct  451  ISPRVVAES  459



>ref|XP_007038279.1| Phosphofructokinase 4 [Theobroma cacao]
 gb|EOY22780.1| Phosphofructokinase 4 [Theobroma cacao]
Length=530

 Score =   394 bits (1012),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 194/247 (79%), Positives = 217/247 (88%), Gaps = 1/247 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI AAHVE  S ENGIG+VKLMGRYSGFIAM+
Sbjct  265  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAIDAAHVEVESVENGIGIVKLMGRYSGFIAMF  324

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLFE+IE+ LKE+ H+VIVVAEGAGQE +++++   
Sbjct  325  ATLASRDVDCCLIPESPFYLEGKGGLFEFIEERLKENRHIVIVVAEGAGQEYVAQSMHGI  384

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN++L DVGLWL+Q IKDHF+K++KM IN+KYIDPTYMIRAIPSNASDN+YCT
Sbjct  385  DE-KDASGNRLLLDVGLWLTQNIKDHFTKERKMEINMKYIDPTYMIRAIPSNASDNIYCT  443

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGFTVG VN RHAYIP + +TE QN V +TDRMWARLL STNQPSF
Sbjct  444  LLAQSAVHGAMAGYTGFTVGPVNSRHAYIPISHVTETQNTVKLTDRMWARLLASTNQPSF  503

Query  722  LRTRDVI  742
            L   + I
Sbjct  504  LNCDEAI  510



>ref|XP_007135617.1| hypothetical protein PHAVU_010G143900g, partial [Phaseolus vulgaris]
 gb|ESW07611.1| hypothetical protein PHAVU_010G143900g, partial [Phaseolus vulgaris]
Length=555

 Score =   395 bits (1014),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP+++DNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGR SGFI+MY
Sbjct  291  GIPESVDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGVVKLMGRNSGFISMY  350

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEGPGGLFE+I K L E+ HMVIV+AEGAGQEL+SE L ++
Sbjct  351  ATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLTENGHMVIVIAEGAGQELISETLSAT  410

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L+DVGLWLSQKIKDHF++ +KM I LKYIDPTYMIRA+PS ASDNVYCT
Sbjct  411  NM-KDASGNKLLQDVGLWLSQKIKDHFTESQKMAITLKYIDPTYMIRAVPSIASDNVYCT  469

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF VG++NG+HAYIP++ I E +  VVITDRMWARLL STNQPSF
Sbjct  470  LLAQSAVHGAMAGYTGFAVGAINGKHAYIPFHLINEDEKKVVITDRMWARLLSSTNQPSF  529

Query  722  LRTRDV  739
            L   D+
Sbjct  530  LNPIDI  535



>gb|KHN05322.1| 6-phosphofructokinase 3 [Glycine soja]
Length=458

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP+++DNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGR+SGFI+MY
Sbjct  213  GIPESVDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGIVKLMGRHSGFISMY  272

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+GPGGLFE+I K L E+ HMVIV+AEGAG EL+SE+L ++
Sbjct  273  ATLASRDVDCCLIPESPFYLDGPGGLFEFIRKRLAENGHMVIVIAEGAGHELISESLSAT  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+  DVGLWLSQKIKDHF+K +KM I LKYIDPTYMIRA+PS ASDNVYCT
Sbjct  333  NK-QDASGNKLFLDVGLWLSQKIKDHFTKSRKMDITLKYIDPTYMIRAVPSIASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G+VNG+HAYIP+ RI E +  VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFAAGAVNGKHAYIPFYRINEIEKKVVITDRMWARLLSSTNQPSF  451

Query  722  LR  727
            L+
Sbjct  452  LK  453



>ref|XP_003533035.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=458

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 218/242 (90%), Gaps = 1/242 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIP+++DNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA STENGIG+VKLMGR+SGFI+MY
Sbjct  213  GIPESVDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESTENGIGIVKLMGRHSGFISMY  272

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+GPGGLFE+I K L E+ HMVIV+AEGAG EL+SE+L ++
Sbjct  273  ATLASRDVDCCLIPESPFYLDGPGGLFEFIRKRLAENGHMVIVIAEGAGHELISESLSAT  332

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+  DVGLWLSQKIKDHF+K +KM I LKYIDPTYMIRA+PS ASDNVYCT
Sbjct  333  NK-QDASGNKLFLDVGLWLSQKIKDHFTKSRKMDITLKYIDPTYMIRAVPSIASDNVYCT  391

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G+VNG+HAYIP+ RI E +  VVITDRMWARLL STNQPSF
Sbjct  392  LLAQSAVHGAMAGYTGFAAGAVNGKHAYIPFYRINEIEKKVVITDRMWARLLSSTNQPSF  451

Query  722  LR  727
            L+
Sbjct  452  LK  453



>dbj|BAK01448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   392 bits (1008),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 207/246 (84%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAHVEA S ENGIGLVKLMGRYSGFIA Y
Sbjct  216  GIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAHVEAGSAENGIGLVKLMGRYSGFIAHY  275

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYL+G GGLF+YIEK LKE+ HMVIVVAEGA            
Sbjct  276  ATLASRDVDCCLIPESPFYLDGEGGLFKYIEKRLKENGHMVIVVAEGA--GQKLIVENMK  333

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGN +L DVGLWLSQKI +HF K+ K  INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  334  EMGQDASGNALLLDVGLWLSQKINEHF-KKNKTTINLKYIDPTYMIRAIPSNASDNVYCT  392

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGAMAGYTGFTVG VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  393  LLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRITEKQNKVSITDRMWARLLSSTNQPSF  452

Query  722  LRTRDV  739
            L  +DV
Sbjct  453  LSKQDV  458



>ref|XP_008654297.1| PREDICTED: uncharacterized protein LOC100192478 isoform X1 [Zea 
mays]
 gb|AFW80265.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   394 bits (1011),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 214/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  251  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  310

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E++E+ LK++ HMVIVVAEGAGQ+L++ ++   
Sbjct  311  ATLASRDVDCCLIPESPFYLEGKGGLLEFVERRLKDNGHMVIVVAEGAGQDLIARSMNFV  370

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  371  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCT  429

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  430  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  489

Query  722  LRTRDV  739
            L   DV
Sbjct  490  LSHEDV  495



>dbj|BAD69330.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
 dbj|BAD69066.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
Length=541

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 208/246 (85%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR+SGFIA Y
Sbjct  264  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAGSAENGIGLVKLMGRHSGFIAHY  323

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF Y+EK LKE+ HMVIVVAEGA       N    
Sbjct  324  ATLASRDVDCCLIPESPFYLEGEGGLFRYLEKRLKENGHMVIVVAEGA--GQKLINETKE  381

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN +L DVGLWLSQKIK+HF K+ K  INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  382  SMGKDASGNSILLDVGLWLSQKIKEHF-KKIKTTINLKYIDPTYMIRAIPSNASDNVYCT  440

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGAMAGYTGFTVG VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  441  LLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRITEKQNKVSITDRMWARLLSSTNQPSF  500

Query  722  LRTRDV  739
            L  +DV
Sbjct  501  LSKKDV  506



>gb|EAY99719.1| hypothetical protein OsI_21704 [Oryza sativa Indica Group]
Length=542

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 198/246 (80%), Positives = 208/246 (85%), Gaps = 3/246 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVID+SFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR+SGFIA Y
Sbjct  265  GIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVEAGSAENGIGLVKLMGRHSGFIAHY  324

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF Y+EK LKE+ HMVIVVAEGA       N    
Sbjct  325  ATLASRDVDCCLIPESPFYLEGEGGLFRYLEKRLKENGHMVIVVAEGA--GQKLINETKE  382

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN +L DVGLWLSQKIK+HF K+ K  INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  383  SMGKDASGNSILLDVGLWLSQKIKEHF-KKIKTTINLKYIDPTYMIRAIPSNASDNVYCT  441

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGAMAGYTGFTVG VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  442  LLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRITEKQNKVSITDRMWARLLSSTNQPSF  501

Query  722  LRTRDV  739
            L  +DV
Sbjct  502  LSKKDV  507



>ref|XP_006643863.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=534

 Score =   393 bits (1010),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMY
Sbjct  250  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESGENGIGLVKLMGRNSGFIAMY  309

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LK++ HMVIVVAEGAGQ+L+++++   
Sbjct  310  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDLIAKSMNLV  369

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K++  PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  370  DT-RDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNASDNVYCT  428

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+L STNQP F
Sbjct  429  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLSSTNQPCF  488

Query  722  LRTRDV  739
            L   DV
Sbjct  489  LSHEDV  494



>ref|NP_195010.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
 sp|Q9M076.1|PFKA6_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 6; Short=ATP-PFK 
6; Short=Phosphofructokinase 6; AltName: Full=Phosphohexokinase 
6 [Arabidopsis thaliana]
 emb|CAB80001.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAO64936.1| At4g32840 [Arabidopsis thaliana]
 dbj|BAE99473.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEE86125.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
Length=462

 Score =   391 bits (1004),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/241 (79%), Positives = 211/241 (88%), Gaps = 4/241 (2%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEATS ENGIG+VKLMGRYSGFIAMY
Sbjct  215  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEATSVENGIGIVKLMGRYSGFIAMY  274

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL+E+I K L+E+ HMVIV+AEGA      + +  S
Sbjct  275  ATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRLRENGHMVIVIAEGA----GQDLVAES  330

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
              Q+DASGNK+L+DVGLW+S KIK++F+K   M I LKYIDPTYMIRAIP+NASDNVY T
Sbjct  331  IEQQDASGNKLLKDVGLWMSLKIKEYFAKHNVMDITLKYIDPTYMIRAIPANASDNVYST  390

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAGYTGF  G VNGRH YIP+NRITE QN VVITDRMWAR+L STNQPSF
Sbjct  391  LLAQSAVHGAMAGYTGFVSGLVNGRHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSF  450

Query  722  L  724
            +
Sbjct  451  M  451



>ref|XP_003564709.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brachypodium 
distachyon]
Length=542

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/246 (80%), Positives = 214/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  261  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  320

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IEK LK+  HMVIVVAEGAGQ+L+++++   
Sbjct  321  ATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDSGHMVIVVAEGAGQDLIAQSMNFV  380

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  381  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKTNFPITLKYIDPTYMIRAVRSNASDNVYCT  439

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  440  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  499

Query  722  LRTRDV  739
            L   DV
Sbjct  500  LSHEDV  505



>ref|XP_004968501.1| PREDICTED: 6-phosphofructokinase 3-like [Setaria italica]
Length=539

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/246 (79%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  255  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  314

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E+IE+ LK++ HMVIVVAEGAGQ+L+++++   
Sbjct  315  ATLASRDVDCCLIPESPFYLEGKGGLLEFIERRLKDNGHMVIVVAEGAGQDLIAKSMNFV  374

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  375  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKPNFPITLKYIDPTYMIRAVKSNASDNVYCT  433

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  434  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  493

Query  722  LRTRDV  739
            L   DV
Sbjct  494  LSHEDV  499



>ref|NP_001266546.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG35405.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 214/246 (87%), Gaps = 1/246 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            G+PKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGR SGFIAMY
Sbjct  251  GVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMY  310

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGL E++E+ LK++ HMVIVVAEGAGQ+L++ ++   
Sbjct  311  ATLASRDVDCCLIPESPFYLEGKGGLLEFVERRLKDNGHMVIVVAEGAGQDLIARSMNFV  370

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               +DASGNK+L DVGLWLSQKIKDHF K+   PI LKYIDPTYMIRA+ SNASDNVYCT
Sbjct  371  DT-QDASGNKLLLDVGLWLSQKIKDHFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCT  429

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA SA+HGAMAGYTGFTV  VNGRHAYIP+ RITE QN VVITDRMWAR+LCSTNQP F
Sbjct  430  LLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCF  489

Query  722  LRTRDV  739
            L   DV
Sbjct  490  LSHEDV  495



>gb|ACL53548.1| unknown [Zea mays]
 gb|ACN28560.1| unknown [Zea mays]
 gb|AFW85827.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/249 (79%), Positives = 209/249 (84%), Gaps = 3/249 (1%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIGLVKLMGR+SGFIA Y
Sbjct  273  GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAVSAENGIGLVKLMGRHSGFIAHY  332

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCLIPESPFYLEG GGLF YIEK LK++ HMVIVVAEGA            
Sbjct  333  ATLASRDVDCCLIPESPFYLEGEGGLFRYIEKRLKDNGHMVIVVAEGA--GQKLIAETMQ  390

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGN++L DVGLWLSQKI +HF K+ KM INLKYIDPTYMIRAIPSNASDNVYCT
Sbjct  391  SIGKDASGNELLLDVGLWLSQKINEHF-KKNKMTINLKYIDPTYMIRAIPSNASDNVYCT  449

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLA S VHGAMAGYTGFT+G VNGRH YIP+ RITE QN V ITDRMWARLL STNQPSF
Sbjct  450  LLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEKQNRVSITDRMWARLLSSTNQPSF  509

Query  722  LRTRDVIES  748
            L  + V E+
Sbjct  510  LCNKVVEEA  518



>ref|XP_007219544.1| hypothetical protein PRUPE_ppa003986mg [Prunus persica]
 gb|EMJ20743.1| hypothetical protein PRUPE_ppa003986mg [Prunus persica]
Length=536

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 219/248 (88%), Gaps = 1/248 (0%)
 Frame = +2

Query  2    GIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEATSTENGIGLVKLMGRYSGFIAMY  181
            GIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE  S ENG+G+VKLMGRYSGFIA+Y
Sbjct  271  GIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVENGVGIVKLMGRYSGFIALY  330

Query  182  ATLASRDVDCCLIPESPFYLEGPGGLFEYIEKTLKEHDHMVIVVAEGAgqellsenllss  361
            ATLASRDVDCCL+PESPFYLEG GGLFE++E+ LKE+ H+VIV+AEGAGQE +++ +   
Sbjct  331  ATLASRDVDCCLVPESPFYLEGRGGLFEFVEERLKENGHVVIVLAEGAGQEYVAQEMQVV  390

Query  362  gnqKDASGNKVLEDVGLWLSQKIKDHFSKQKKMPINLKYIDPTYMIRAIPSNASDNVYCT  541
               KDASGNK+L DVGLWL++KIKDHF+K +KM IN KYIDPTYMIRAIPSNASDN+YCT
Sbjct  391  DG-KDASGNKLLLDVGLWLTEKIKDHFTKVQKMAINTKYIDPTYMIRAIPSNASDNIYCT  449

Query  542  LLAQSAVHGAMAGYTGFTVGSVNGRHAYIPYNRITEGQNHVVITDRMWARLLCSTNQPSF  721
            LLAQSAVHGAMAG++GFTVG VN RHAYIP +R+TE QN V +TDRMWARLL STNQPSF
Sbjct  450  LLAQSAVHGAMAGFSGFTVGPVNSRHAYIPISRVTETQNTVNLTDRMWARLLASTNQPSF  509

Query  722  LRTRDVIE  745
              + +++E
Sbjct  510  FESNELLE  517



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2363439201630