BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c50150_g1_i1 len=186 path=[1:0-185]

Length=186
                                                                      Score     E

emb|CDP20953.1|  unnamed protein product                              58.9    3e-08   
ref|XP_002280075.2|  PREDICTED: probable LRR receptor-like serine...  58.9    4e-08   Vitis vinifera
emb|CDP21228.1|  unnamed protein product                              56.6    2e-07   
emb|CDP11291.1|  unnamed protein product                              56.6    3e-07   
emb|CDP15116.1|  unnamed protein product                              55.1    8e-07   
gb|AGT17229.1|  hypothetical protein SHCRBa_019_G01_R_25              53.9    1e-06   
gb|EYU38095.1|  hypothetical protein MIMGU_mgv1a024467mg              52.4    2e-06   
emb|CBI31777.3|  unnamed protein product                              53.9    2e-06   
gb|KEH19795.1|  LRR receptor-like kinase family protein               53.5    2e-06   
gb|EMS52374.1|  Tyrosine-sulfated glycopeptide receptor 1             52.8    5e-06   
emb|CDP02657.1|  unnamed protein product                              50.1    6e-06   
emb|CDP11293.1|  unnamed protein product                              52.8    6e-06   
emb|CDP00845.1|  unnamed protein product                              52.4    7e-06   
ref|XP_010261079.1|  PREDICTED: probable LRR receptor-like serine...  52.4    8e-06   
ref|XP_004509927.1|  PREDICTED: putative receptor-like protein ki...  52.0    9e-06   
ref|XP_004295584.1|  PREDICTED: putative receptor-like protein ki...  52.0    1e-05   
ref|XP_009351430.1|  PREDICTED: leucine-rich repeat receptor-like...  51.2    1e-05   
ref|XP_010657153.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
ref|XP_011002880.1|  PREDICTED: probable LRR receptor-like serine...  51.6    1e-05   
emb|CDP15118.1|  unnamed protein product                              51.2    1e-05   
ref|XP_008226831.1|  PREDICTED: probable LRR receptor-like serine...  51.2    1e-05   
ref|XP_011002881.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-05   
ref|XP_007217616.1|  hypothetical protein PRUPE_ppa016276mg           51.2    2e-05   
ref|XP_008371720.1|  PREDICTED: probable LRR receptor-like serine...  51.2    2e-05   
gb|EYU38094.1|  hypothetical protein MIMGU_mgv1a019689mg              50.8    2e-05   
gb|KEH19873.1|  LRR receptor-like kinase family protein               51.2    2e-05   
gb|KDP44902.1|  hypothetical protein JCGZ_01402                       50.4    2e-05   
ref|XP_007212637.1|  hypothetical protein PRUPE_ppa018076mg           50.8    2e-05   
ref|XP_008355519.1|  PREDICTED: LRR receptor-like serine/threonin...  48.5    2e-05   
ref|XP_008225338.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
ref|XP_008383875.1|  PREDICTED: LRR receptor-like serine/threonin...  50.8    2e-05   
ref|XP_006355253.1|  PREDICTED: probable leucine-rich repeat rece...  50.4    2e-05   
ref|XP_010909229.1|  PREDICTED: probable LRR receptor-like serine...  50.8    2e-05   
gb|EMT29923.1|  LRR receptor-like serine/threonine-protein kinase...  50.8    3e-05   
ref|XP_008225314.1|  PREDICTED: LRR receptor-like serine/threonin...  50.4    3e-05   
ref|XP_009375059.1|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-05   
gb|EMS60862.1|  LRR receptor-like serine/threonine-protein kinase...  50.4    3e-05   
ref|XP_009375060.1|  PREDICTED: probable LRR receptor-like serine...  50.4    3e-05   
ref|XP_002453318.1|  hypothetical protein SORBIDRAFT_04g003800        50.4    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008349051.1|  PREDICTED: probable leucine-rich repeat rece...  47.8    3e-05   
ref|XP_008229366.1|  PREDICTED: receptor-like protein kinase          50.4    3e-05   
emb|CDP11031.1|  unnamed protein product                              49.7    3e-05   
ref|XP_002489144.1|  hypothetical protein SORBIDRAFT_0019s003400      50.1    3e-05   Sorghum bicolor [broomcorn]
ref|XP_008442449.1|  PREDICTED: putative receptor-like protein ki...  50.4    3e-05   
emb|CDP18966.1|  unnamed protein product                              50.4    4e-05   
ref|XP_004951813.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  50.4    4e-05   
ref|XP_008665971.1|  PREDICTED: receptor-like protein 2               47.8    4e-05   
emb|CBJ30535.1|  Hypothetical leucine rich repeat protein             50.1    4e-05   
ref|XP_007213507.1|  hypothetical protein PRUPE_ppa020889mg           50.1    4e-05   
ref|XP_004156664.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  50.1    4e-05   
ref|XP_008442450.1|  PREDICTED: probable LRR receptor-like serine...  50.1    4e-05   
ref|XP_004137908.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  50.1    4e-05   
gb|KGN58773.1|  hypothetical protein Csa_3G731830                     50.1    4e-05   
ref|XP_006367570.1|  PREDICTED: probable LRR receptor-like serine...  50.1    4e-05   
dbj|BAJ92367.1|  predicted protein                                    50.1    5e-05   
ref|XP_007212752.1|  hypothetical protein PRUPE_ppa016624mg           49.7    5e-05   
emb|CDP00850.1|  unnamed protein product                              50.1    5e-05   
ref|XP_004293986.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010657053.1|  PREDICTED: probable LRR receptor-like serine...  49.7    5e-05   
ref|XP_010657052.1|  PREDICTED: putative receptor-like protein ki...  49.7    5e-05   
ref|XP_009383987.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  49.7    6e-05   
gb|EMT32020.1|  Tyrosine-sulfated glycopeptide receptor 1             49.7    6e-05   
ref|XP_002449703.1|  hypothetical protein SORBIDRAFT_05g021860        49.3    6e-05   Sorghum bicolor [broomcorn]
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810        49.7    6e-05   Sorghum bicolor [broomcorn]
gb|KHN34330.1|  LRR receptor-like serine/threonine-protein kinase...  49.7    6e-05   
gb|AFY98537.3|  somatic embryogenesis receptor kinase                 49.3    6e-05   
ref|XP_004980623.1|  PREDICTED: probable LRR receptor-like serine...  49.7    6e-05   
ref|XP_004137906.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_009110420.1|  PREDICTED: receptor-like protein 2               49.3    7e-05   
gb|KGN58770.1|  hypothetical protein Csa_3G731800                     49.3    7e-05   
ref|XP_008372676.1|  PREDICTED: probable LRR receptor-like serine...  49.7    7e-05   
emb|CDX96780.1|  BnaA08g23230D                                        49.3    7e-05   
ref|XP_010316832.1|  PREDICTED: probable LRR receptor-like serine...  48.5    7e-05   
emb|CDP20521.1|  unnamed protein product                              49.3    7e-05   
emb|CDX83918.1|  BnaC08g17270D                                        49.3    7e-05   
ref|XP_003525510.2|  PREDICTED: LRR receptor-like serine/threonin...  49.3    7e-05   
ref|XP_004305138.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_004156666.1|  PREDICTED: probable LRR receptor-like serine...  49.3    7e-05   
ref|XP_006428283.1|  hypothetical protein CICLE_v10010969mg           49.3    7e-05   
emb|CBI35485.3|  unnamed protein product                              49.3    7e-05   
ref|XP_003535237.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    7e-05   
ref|XP_007221162.1|  hypothetical protein PRUPE_ppa020518mg           47.8    7e-05   
ref|XP_002534492.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  49.3    7e-05   Ricinus communis
ref|XP_011038199.1|  PREDICTED: somatic embryogenesis receptor ki...  49.3    7e-05   
ref|XP_006646898.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  49.3    8e-05   
gb|KHN20812.1|  Putative leucine-rich repeat receptor-like protei...  49.3    8e-05   
ref|XP_010316831.1|  PREDICTED: probable LRR receptor-like serine...  48.5    8e-05   
ref|XP_002533428.1|  serine-threonine protein kinase, plant-type,...  49.3    8e-05   Ricinus communis
ref|XP_010316830.1|  PREDICTED: probable LRR receptor-like serine...  48.5    8e-05   
gb|EMT02814.1|  Tyrosine-sulfated glycopeptide receptor 1             49.3    8e-05   
ref|XP_008665972.1|  PREDICTED: receptor-like protein 2               47.8    8e-05   
ref|XP_002459536.1|  hypothetical protein SORBIDRAFT_02g006250        49.3    9e-05   Sorghum bicolor [broomcorn]
emb|CAN79365.1|  hypothetical protein VITISV_033877                   48.9    9e-05   Vitis vinifera
ref|XP_008665969.1|  PREDICTED: receptor-like protein 2               47.8    9e-05   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  48.9    9e-05   
ref|XP_003524106.1|  PREDICTED: probable LRR receptor-like serine...  49.3    9e-05   
gb|KHN25863.1|  LRR receptor-like serine/threonine-protein kinase...  48.9    9e-05   
emb|CDP21317.1|  unnamed protein product                              47.8    9e-05   
ref|XP_008352360.1|  PREDICTED: LRR receptor-like serine/threonin...  47.4    9e-05   
gb|KHN17066.1|  Somatic embryogenesis receptor kinase 1               48.9    1e-04   
ref|XP_003556185.1|  PREDICTED: somatic embryogenesis receptor ki...  48.9    1e-04   
ref|XP_002969053.1|  hypothetical protein SELMODRAFT_18890            46.2    1e-04   
gb|ABS32233.1|  somatic embryogenesis receptor kinase                 48.9    1e-04   Carica papaya [mamon]
ref|XP_011002514.1|  PREDICTED: somatic embryogenesis receptor ki...  48.9    1e-04   
gb|ABS32228.1|  somatic embryogenesis receptor kinase                 48.9    1e-04   Carica papaya [mamon]
emb|CDY15361.1|  BnaC04g42620D                                        48.9    1e-04   
ref|XP_006358151.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    1e-04   
tpg|DAA40884.1|  TPA: putative leucine-rich repeat receptor-like ...  48.9    1e-04   
emb|CDO96776.1|  unnamed protein product                              48.9    1e-04   
gb|EMT02815.1|  Tyrosine-sulfated glycopeptide receptor 1             48.5    1e-04   
ref|NP_001238274.1|  somatic embryogenesis receptor kinase precursor  48.5    1e-04   
ref|XP_004963189.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    1e-04   
ref|XP_004963190.1|  PREDICTED: LRR receptor-like serine/threonin...  48.9    1e-04   
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...  48.9    1e-04   
emb|CDP00840.1|  unnamed protein product                              48.9    1e-04   
ref|XP_008364201.1|  PREDICTED: LRR receptor-like serine/threonin...  48.5    1e-04   
ref|XP_002969046.1|  hypothetical protein SELMODRAFT_18440            45.8    1e-04   
ref|XP_009631801.1|  PREDICTED: probable LRR receptor-like serine...  48.9    1e-04   
ref|XP_003590907.1|  Pentatricopeptide repeat-containing protein      48.9    1e-04   
ref|XP_008229445.1|  PREDICTED: receptor-like protein kinase          47.0    1e-04   
ref|XP_004972644.1|  PREDICTED: putative receptor-like protein ki...  48.9    1e-04   
emb|CAN72496.1|  hypothetical protein VITISV_010511                   48.9    1e-04   Vitis vinifera
ref|XP_008357586.1|  PREDICTED: probably inactive leucine-rich re...  48.1    1e-04   
ref|XP_009799275.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_002971926.1|  hypothetical protein SELMODRAFT_96692            48.5    1e-04   
emb|CDP11286.1|  unnamed protein product                              48.5    1e-04   
ref|XP_002993050.1|  hypothetical protein SELMODRAFT_136413           48.5    1e-04   
ref|XP_010529507.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_003574032.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_008679939.1|  PREDICTED: receptor-like protein 2               48.5    1e-04   
gb|KHN18441.1|  LRR receptor-like serine/threonine-protein kinase...  48.5    1e-04   
gb|EPS65472.1|  hypothetical protein M569_09303                       48.5    1e-04   
ref|XP_003525760.1|  PREDICTED: probable leucine-rich repeat rece...  48.5    1e-04   
ref|XP_009362012.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_004502737.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_009589465.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
emb|CDO96775.1|  unnamed protein product                              48.5    1e-04   
ref|XP_009382007.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_009589466.1|  PREDICTED: probable LRR receptor-like serine...  48.5    1e-04   
ref|XP_006436344.1|  hypothetical protein CICLE_v100305551mg          47.8    1e-04   
ref|XP_009799274.1|  PREDICTED: LRR receptor-like serine/threonin...  48.5    1e-04   
ref|XP_004957750.1|  PREDICTED: LRR receptor-like serine/threonin...  48.5    1e-04   
ref|XP_003550728.2|  PREDICTED: LRR receptor-like serine/threonin...  48.5    1e-04   
ref|XP_002280395.1|  PREDICTED: receptor-like protein kinase 5        48.5    1e-04   Vitis vinifera
ref|XP_009799273.1|  PREDICTED: probable LRR receptor-like serine...  48.5    2e-04   
ref|XP_006436346.1|  hypothetical protein CICLE_v100305551mg          47.8    2e-04   
ref|XP_007143618.1|  hypothetical protein PHAVU_007G086800g           48.1    2e-04   
emb|CBI31006.3|  unnamed protein product                              48.1    2e-04   
ref|XP_009362010.1|  PREDICTED: receptor-like protein kinase 2        48.1    2e-04   
ref|XP_003570944.2|  PREDICTED: uncharacterized protein LOC100830520  48.5    2e-04   
emb|CDP17451.1|  unnamed protein product                              46.6    2e-04   
ref|XP_002529598.1|  receptor-kinase, putative                        48.5    2e-04   Ricinus communis
ref|XP_007214468.1|  hypothetical protein PRUPE_ppa023770mg           47.4    2e-04   
emb|CDP11283.1|  unnamed protein product                              48.5    2e-04   
ref|XP_004138361.1|  PREDICTED: somatic embryogenesis receptor ki...  48.1    2e-04   
ref|XP_002311065.2|  hypothetical protein POPTR_0008s03370g           48.1    2e-04   Populus trichocarpa [western balsam poplar]
gb|ABO14173.1|  somatic embryogenesis receptor-like kinase 1          48.1    2e-04   Solanum tuberosum [potatoes]
ref|XP_002310619.1|  brassinosteroid insensitive 1 precursor fami...  48.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008225251.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
emb|CDP20522.1|  unnamed protein product                              47.4    2e-04   
ref|XP_008358702.1|  PREDICTED: probable LRR receptor-like serine...  46.6    2e-04   
ref|XP_010655821.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    2e-04   
ref|XP_008346278.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    2e-04   
ref|XP_008804489.1|  PREDICTED: somatic embryogenesis receptor ki...  48.1    2e-04   
ref|XP_009333988.1|  PREDICTED: receptor-like protein kinase          48.1    2e-04   
ref|NP_001275293.1|  somatic embryogenesis receptor-like kinase 1     48.1    2e-04   
emb|CAN81714.1|  hypothetical protein VITISV_005816                   48.1    2e-04   Vitis vinifera
ref|XP_010657057.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_010657056.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    2e-04   
ref|XP_009376752.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_008380264.1|  PREDICTED: receptor-like protein kinase          48.1    2e-04   
gb|EMT20015.1|  Tyrosine-sulfated glycopeptide receptor 1             48.1    2e-04   
ref|XP_009376753.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_009376751.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_004971665.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_007217286.1|  hypothetical protein PRUPE_ppa017871mg           48.1    2e-04   
ref|XP_011078428.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_008236450.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_011091710.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_009799747.1|  PREDICTED: probable LRR receptor-like serine...  48.1    2e-04   
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...  48.1    2e-04   
ref|XP_007158089.1|  hypothetical protein PHAVU_002G123200g           48.1    2e-04   
ref|XP_006436350.1|  hypothetical protein CICLE_v10033735mg           47.8    2e-04   
emb|CDP18612.1|  unnamed protein product                              47.8    2e-04   
ref|XP_008346977.1|  PREDICTED: probable LRR receptor-like serine...  47.0    2e-04   
ref|XP_004296173.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  47.4    2e-04   
gb|EYU38400.1|  hypothetical protein MIMGU_mgv1a023263mg              47.8    2e-04   
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...  48.1    2e-04   
ref|XP_008385922.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    2e-04   
ref|XP_006494760.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_006436339.1|  hypothetical protein CICLE_v10030526mg           48.1    2e-04   
gb|EYU40635.1|  hypothetical protein MIMGU_mgv1a026366mg              47.8    2e-04   
ref|XP_011078429.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_006436327.1|  hypothetical protein CICLE_v10030536mg           47.8    2e-04   
sp|Q8LPB4.1|PSKR1_DAUCA  RecName: Full=Phytosulfokine receptor 1;...  47.8    2e-04   Daucus carota [carrots]
ref|XP_006367143.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    2e-04   
gb|EYU38097.1|  hypothetical protein MIMGU_mgv1a019608mg              47.8    2e-04   
gb|KCW63152.1|  hypothetical protein EUGRSUZ_G00765                   47.8    2e-04   
ref|XP_011078427.1|  PREDICTED: LRR receptor-like serine/threonin...  47.8    2e-04   
ref|XP_006436338.1|  hypothetical protein CICLE_v10030526mg           47.8    2e-04   
emb|CAC20842.1|  receptor protein kinase                              47.8    2e-04   Pinus sylvestris [Scotch pine]
ref|XP_010068229.1|  PREDICTED: probable LRR receptor-like serine...  47.8    2e-04   
ref|XP_008804490.1|  PREDICTED: somatic embryogenesis receptor ki...  47.8    2e-04   
ref|XP_006436337.1|  hypothetical protein CICLE_v10030526mg           47.8    2e-04   
ref|XP_009376795.1|  PREDICTED: putative receptor-like protein ki...  47.8    2e-04   
ref|XP_006436336.1|  hypothetical protein CICLE_v10030526mg           47.8    2e-04   
ref|XP_006436335.1|  hypothetical protein CICLE_v10030526mg           47.8    2e-04   
ref|XP_002270847.1|  PREDICTED: somatic embryogenesis receptor ki...  47.8    3e-04   Vitis vinifera
gb|KEH19907.1|  LRR receptor-like kinase family protein               47.8    3e-04   
ref|XP_010227389.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  47.8    3e-04   
ref|XP_007052241.1|  Leucine-rich repeat receptor-like protein ki...  47.8    3e-04   
ref|XP_011099195.1|  PREDICTED: probable LRR receptor-like serine...  47.8    3e-04   
ref|XP_008464349.1|  PREDICTED: somatic embryogenesis receptor ki...  47.4    3e-04   
ref|XP_006398111.1|  hypothetical protein EUTSA_v10001203mg           47.8    3e-04   
ref|XP_010261130.1|  PREDICTED: somatic embryogenesis receptor ki...  47.4    3e-04   
emb|CDP10897.1|  unnamed protein product                              47.8    3e-04   
gb|KDO40017.1|  hypothetical protein CISIN_1g0405402mg                47.0    3e-04   
ref|XP_002464503.1|  hypothetical protein SORBIDRAFT_01g019670        47.4    3e-04   Sorghum bicolor [broomcorn]
ref|XP_010039500.1|  PREDICTED: putative receptor-like protein ki...  47.4    3e-04   
ref|XP_004295582.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
gb|KCW45912.1|  hypothetical protein EUGRSUZ_L00172                   47.4    3e-04   
emb|CDP18731.1|  unnamed protein product                              47.0    3e-04   
ref|XP_009339531.1|  PREDICTED: receptor-like protein kinase          47.4    3e-04   
gb|KDO65860.1|  hypothetical protein CISIN_1g0394191mg                46.6    3e-04   
ref|XP_009113892.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
emb|CDO96774.1|  unnamed protein product                              47.4    3e-04   
gb|KEH33634.1|  LRR receptor-like kinase family protein               47.4    3e-04   
ref|XP_009415698.1|  PREDICTED: probable LRR receptor-like serine...  47.4    3e-04   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...  47.4    3e-04   
emb|CDP21744.1|  unnamed protein product                              46.6    4e-04   
ref|XP_010039622.1|  PREDICTED: probable LRR receptor-like serine...  47.4    4e-04   
ref|XP_008677920.1|  PREDICTED: probable LRR receptor-like serine...  47.4    4e-04   
emb|CDP17630.1|  unnamed protein product                              47.4    4e-04   
gb|AES95343.2|  LRR receptor-like kinase family protein               47.4    4e-04   
ref|XP_009373071.1|  PREDICTED: probable LRR receptor-like serine...  47.4    4e-04   
emb|CDY67983.1|  BnaA09g53520D                                        47.0    4e-04   
ref|XP_010243324.1|  PREDICTED: probable LRR receptor-like serine...  47.4    4e-04   
gb|EEE56325.1|  hypothetical protein OsJ_05424                        47.0    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003612385.1|  Receptor kinase-like protein                     47.0    4e-04   
ref|XP_002532618.1|  serine-threonine protein kinase, plant-type,...  46.6    4e-04   Ricinus communis
ref|XP_009115860.1|  PREDICTED: probable LRR receptor-like serine...  47.0    4e-04   
ref|XP_007213717.1|  hypothetical protein PRUPE_ppa000550mg           47.0    4e-04   
gb|EAY84530.1|  hypothetical protein OsI_05903                        47.0    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_011091709.1|  PREDICTED: probable LRR receptor-like serine...  47.4    4e-04   
ref|XP_009363421.1|  PREDICTED: LRR receptor-like serine/threonin...  47.0    4e-04   
emb|CDP16388.1|  unnamed protein product                              46.6    4e-04   
emb|CDX78030.1|  BnaA09g32250D                                        47.0    4e-04   
ref|XP_002867439.1|  hypothetical protein ARALYDRAFT_328832           47.0    4e-04   
ref|XP_010050145.1|  PREDICTED: putative receptor-like protein ki...  47.0    4e-04   
ref|NP_001045681.1|  Os02g0116700                                     47.0    4e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDO96823.1|  unnamed protein product                              47.0    4e-04   
ref|XP_010666493.1|  PREDICTED: probable LRR receptor-like serine...  47.0    4e-04   
ref|XP_006646901.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  47.0    4e-04   
ref|XP_008339463.1|  PREDICTED: probable leucine-rich repeat rece...  46.6    4e-04   
gb|EMT32317.1|  Putative LRR receptor-like serine/threonine-prote...  47.0    4e-04   
emb|CDO96830.1|  unnamed protein product                              46.6    5e-04   
ref|XP_010264019.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  47.0    5e-04   
ref|XP_003517433.1|  PREDICTED: somatic embryogenesis receptor ki...  47.0    5e-04   
emb|CDP18217.1|  unnamed protein product                              47.0    5e-04   
ref|XP_004513505.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    5e-04   
ref|XP_007200787.1|  hypothetical protein PRUPE_ppa024132mg           47.0    5e-04   
ref|XP_006428343.1|  hypothetical protein CICLE_v100136772mg          44.3    5e-04   
ref|XP_007021885.1|  Leucine-rich repeat protein kinase family pr...  47.0    5e-04   
ref|XP_004491002.1|  PREDICTED: probably inactive leucine-rich re...  47.0    5e-04   
emb|CBI22006.3|  unnamed protein product                              47.0    5e-04   
emb|CAN78527.1|  hypothetical protein VITISV_039533                   47.0    5e-04   Vitis vinifera
ref|XP_006442393.1|  hypothetical protein CICLE_v10018832mg           47.0    5e-04   
ref|XP_008225334.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
gb|KCW45936.1|  hypothetical protein EUGRSUZ_L00207                   47.0    5e-04   
ref|XP_007010863.1|  Leucine-rich repeat receptor-like protein ki...  47.0    5e-04   
gb|KEH43547.1|  LRR receptor-like kinase family protein               47.0    5e-04   
gb|EMT08541.1|  Tyrosine-sulfated glycopeptide receptor 1             47.0    5e-04   
ref|XP_006663535.1|  PREDICTED: probable LRR receptor-like serine...  47.0    5e-04   
gb|KEH19860.1|  LRR receptor-like kinase family protein               45.4    5e-04   
gb|EEE56175.1|  hypothetical protein OsJ_05122                        47.0    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11813.1|  Tyrosine-sulfated glycopeptide receptor 1             46.6    5e-04   
gb|EAY84204.1|  hypothetical protein OsI_05584                        47.0    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002304404.2|  putative leucine-rich repeat transmembrane p...  47.0    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011010837.1|  PREDICTED: probable leucine-rich repeat rece...  47.0    5e-04   
gb|ACH87659.3|  somatic embryogenesis receptor kinase                 46.6    5e-04   
ref|XP_010039510.1|  PREDICTED: putative receptor-like protein ki...  47.0    5e-04   
ref|XP_008347286.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    5e-04   
gb|KEH19913.1|  LRR receptor-like kinase family protein               46.6    5e-04   
gb|EMT32016.1|  Tyrosine-sulfated glycopeptide receptor 1             46.6    5e-04   
ref|XP_004148166.1|  PREDICTED: probable LRR receptor-like serine...  46.6    5e-04   
ref|XP_006573733.1|  PREDICTED: somatic embryogenesis receptor ki...  46.6    5e-04   
ref|XP_002453324.1|  hypothetical protein SORBIDRAFT_04g003870        46.6    5e-04   
ref|XP_002457332.1|  hypothetical protein SORBIDRAFT_03g005740        46.6    6e-04   
ref|XP_008386359.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
ref|XP_010245869.1|  PREDICTED: somatic embryogenesis receptor ki...  46.6    6e-04   
ref|XP_009766212.1|  PREDICTED: protein TOO MANY MOUTHS               46.2    6e-04   
ref|XP_010039502.1|  PREDICTED: putative receptor-like protein ki...  46.6    6e-04   
gb|KCW63146.1|  hypothetical protein EUGRSUZ_G00758                   46.6    6e-04   
emb|CDP21476.1|  unnamed protein product                              46.6    6e-04   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...  46.6    6e-04   
ref|XP_009519441.1|  hypothetical protein PHYSODRAFT_311245           46.2    6e-04   
gb|KFK41748.1|  hypothetical protein AALP_AA2G167100                  46.6    6e-04   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg           46.6    6e-04   
gb|KEH19889.1|  LRR receptor-like kinase family protein               46.6    6e-04   
ref|XP_006648232.1|  PREDICTED: phytosulfokine receptor 1-like        46.2    6e-04   
ref|XP_004243061.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    6e-04   
gb|KCW45917.1|  hypothetical protein EUGRSUZ_L00178                   46.6    6e-04   
ref|XP_008371721.1|  PREDICTED: putative receptor-like protein ki...  46.6    6e-04   
gb|KCW82341.1|  hypothetical protein EUGRSUZ_C03742                   46.6    6e-04   
emb|CDP20097.1|  unnamed protein product                              46.2    6e-04   
ref|XP_009376755.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    6e-04   
gb|EAY72542.1|  hypothetical protein OsI_00407                        46.6    6e-04   
ref|XP_010051564.1|  PREDICTED: putative receptor-like protein ki...  46.6    6e-04   
ref|XP_002453320.1|  hypothetical protein SORBIDRAFT_04g003820        46.6    6e-04   
ref|XP_006493184.1|  PREDICTED: leucine-rich repeat receptor-like...  46.6    6e-04   
ref|XP_008366446.1|  PREDICTED: probable LRR receptor-like serine...  46.2    6e-04   
ref|XP_010684922.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
ref|XP_004167791.1|  PREDICTED: probable LRR receptor-like serine...  46.6    6e-04   
ref|XP_006648315.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  46.6    6e-04   
gb|EMS44961.1|  Tyrosine-sulfated glycopeptide receptor 1             46.6    6e-04   
ref|XP_008796001.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    6e-04   
ref|XP_007019765.1|  Leucine-rich receptor protein kinase family ...  46.2    6e-04   
emb|CDO96821.1|  unnamed protein product                              46.6    6e-04   
ref|XP_010236270.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-sul...  46.6    6e-04   
ref|NP_001233866.1|  somatic embryogenesis receptor kinase 1          46.2    6e-04   
gb|ABR18800.1|  somatic embryogenesis receptor-like kinase 1          46.2    6e-04   
gb|EPS62032.1|  hypothetical protein M569_12758                       46.6    6e-04   
ref|XP_006493183.1|  PREDICTED: leucine-rich repeat receptor-like...  46.6    6e-04   
ref|XP_004150224.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    6e-04   
gb|KDO52815.1|  hypothetical protein CISIN_1g001226mg                 46.6    6e-04   
ref|NP_001042027.2|  Os01g0149700                                     46.6    6e-04   
ref|XP_006441216.1|  hypothetical protein CICLE_v10018613mg           46.6    7e-04   
ref|XP_002437446.1|  hypothetical protein SORBIDRAFT_10g027210        46.6    7e-04   
ref|XP_010093040.1|  putative LRR receptor-like serine/threonine-...  46.6    7e-04   
ref|XP_010519011.1|  PREDICTED: receptor-like protein 2               46.6    7e-04   
ref|XP_008443430.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
gb|KCW79201.1|  hypothetical protein EUGRSUZ_C00631                   46.6    7e-04   
ref|XP_007010868.1|  Leucine-rich repeat receptor-like protein ki...  46.6    7e-04   
ref|XP_004168556.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    7e-04   
ref|XP_003529146.2|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
ref|XP_009373066.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
ref|XP_010050402.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
emb|CDP11194.1|  unnamed protein product                              46.6    7e-04   
ref|XP_004246208.2|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
emb|CDP21738.1|  unnamed protein product                              46.2    7e-04   
ref|XP_009603852.1|  PREDICTED: protein TOO MANY MOUTHS               46.2    7e-04   
ref|XP_010664968.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
gb|KEH29237.1|  LRR receptor-like kinase                              46.6    7e-04   
emb|CBI35487.3|  unnamed protein product                              46.6    7e-04   
emb|CDP21965.1|  unnamed protein product                              45.8    7e-04   
ref|XP_009617538.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    7e-04   
ref|XP_010068227.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
ref|XP_010234377.1|  PREDICTED: probable LRR receptor-like serine...  46.6    7e-04   
gb|KDP31070.1|  hypothetical protein JCGZ_11446                       46.2    7e-04   
gb|KHN22739.1|  Putative LRR receptor-like serine/threonine-prote...  46.2    7e-04   
ref|XP_010051566.1|  PREDICTED: LRR receptor-like serine/threonin...  46.2    7e-04   
ref|XP_010260175.1|  PREDICTED: LRR receptor-like serine/threonin...  46.6    7e-04   
ref|XP_007020590.1|  Receptor like protein 53, putative               46.2    7e-04   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...  46.2    7e-04   
ref|XP_003633210.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_009772313.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_007201734.1|  hypothetical protein PRUPE_ppa002871mg           46.2    8e-04   
ref|XP_007022610.1|  Leucine-rich repeat protein kinase family pr...  46.2    8e-04   
ref|XP_006657082.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_006442392.1|  hypothetical protein CICLE_v10023311mg           46.2    8e-04   
ref|XP_002466337.1|  hypothetical protein SORBIDRAFT_01g005880        46.2    8e-04   
ref|XP_009589467.1|  PREDICTED: putative receptor-like protein ki...  46.2    8e-04   
ref|XP_010039625.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
emb|CBI30839.3|  unnamed protein product                              46.2    8e-04   
ref|XP_004969827.1|  PREDICTED: probable leucine-rich repeat rece...  45.8    8e-04   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1      46.2    8e-04   
ref|XP_004173608.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  46.2    8e-04   
ref|XP_003636114.1|  Receptor-like protein kinase                     46.2    8e-04   
gb|KCW45849.1|  hypothetical protein EUGRSUZ_L00313                   46.2    8e-04   
ref|XP_009598073.1|  PREDICTED: protein TOO MANY MOUTHS-like          45.8    8e-04   
ref|XP_006448720.1|  hypothetical protein CICLE_v10017727mg           46.2    8e-04   
ref|XP_006655511.1|  PREDICTED: probable leucine-rich repeat rece...  45.4    8e-04   
ref|XP_010268403.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_003527668.1|  PREDICTED: probable LRR receptor-like serine...  46.2    8e-04   
ref|XP_009415416.1|  PREDICTED: probably inactive leucine-rich re...  46.2    8e-04   
ref|XP_006468351.1|  PREDICTED: LRR receptor-like serine/threonin...  46.2    8e-04   
ref|XP_008355308.1|  PREDICTED: LRR receptor-like serine/threonin...  45.8    9e-04   
gb|AEC46975.1|  somatic embryogenesis receptor-like kinase            45.8    9e-04   
gb|KEH19253.1|  LRR receptor-like kinase, putative                    46.2    9e-04   
ref|XP_007162226.1|  hypothetical protein PHAVU_001G134600g           46.2    9e-04   
ref|XP_004234250.2|  PREDICTED: LRR receptor-like serine/threonin...  46.2    9e-04   
gb|KDO75298.1|  hypothetical protein CISIN_1g047591mg                 46.2    9e-04   
ref|XP_003521177.1|  PREDICTED: leucine-rich repeat receptor-like...  46.2    9e-04   
ref|XP_004152065.1|  PREDICTED: leucine-rich repeat receptor-like...  46.2    9e-04   
emb|CDP20776.1|  unnamed protein product                              45.4    9e-04   
ref|XP_010039509.1|  PREDICTED: LRR receptor-like serine/threonin...  45.8    0.001   
gb|KEH19251.1|  LRR receptor-like kinase, putative                    46.2    0.001   
gb|KDP26461.1|  hypothetical protein JCGZ_17619                       46.2    0.001   
gb|KEH19252.1|  LRR receptor-like kinase, putative                    46.2    0.001   
dbj|BAH20868.1|  putative LRR-kinase protein                          46.2    0.001   
gb|KCW45930.1|  hypothetical protein EUGRSUZ_L00196                   46.2    0.001   
gb|AGT16591.1|  LRR-kinase protein                                    46.2    0.001   
ref|XP_006376510.1|  hypothetical protein POPTR_0013s13660g           46.2    0.001   
ref|XP_009611716.1|  PREDICTED: probable LRR receptor-like serine...  45.8    0.001   
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...  46.2    0.001   
ref|XP_006448927.1|  hypothetical protein CICLE_v10014011mg           46.2    0.001   
gb|KEH36626.1|  LRR receptor-like kinase                              46.2    0.001   
gb|KDO45445.1|  hypothetical protein CISIN_1g045798mg                 46.2    0.001   
ref|XP_010476870.1|  PREDICTED: receptor-like protein 2               45.8    0.001   
gb|KCW45935.1|  hypothetical protein EUGRSUZ_L00204                   45.8    0.001   
ref|XP_002307734.1|  receptor protein kinase                          45.8    0.001   
gb|EYU21247.1|  hypothetical protein MIMGU_mgv1a000928mg              45.8    0.001   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g           45.8    0.001   
ref|XP_009415415.1|  PREDICTED: probably inactive leucine-rich re...  45.8    0.001   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg              45.4    0.001   



>emb|CDP20953.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +N F G++P+ +GS  ML++L L  N  EG IP  +FNIS L +  L +NHLSGILP NM
Sbjct  228  FNWFNGSMPKELGSLKMLEVLDLGYNLVEGPIPNEMFNISTLRVFDLSDNHLSGILPSNM  287

Query  184  C  186
            C
Sbjct  288  C  288



>ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1160

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N F G+IPRGIGS  +L++L L +NN EG IP+T+FN+S+L    L +N+L GILP +
Sbjct  253  SFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLRNFELGSNNLGGILPAD  312

Query  181  MC  186
            MC
Sbjct  313  MC  314



>emb|CDP21228.1| unnamed protein product [Coffea canephora]
Length=558

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NN  G+IPR I +  ML+ L +  NN  G IP  +FNIS L +  L +NHLSGILP NM
Sbjct  231  HNNLTGSIPREIRNLTMLEELYIYKNNLSGPIPNEMFNISTLRVFDLSDNHLSGILPSNM  290

Query  184  C  186
            C
Sbjct  291  C  291



>emb|CDP11291.1| unnamed protein product [Coffea canephora]
Length=1190

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F G+IP+ IG+   L+ L L  N  EG IP  IFNIS+L II L NN L G+LP +
Sbjct  227  SYNEFGGSIPKEIGALKKLEELYLGYNYLEGNIPIGIFNISSLQIIDLTNNGLFGVLPSD  286

Query  181  MC  186
            MC
Sbjct  287  MC  288



>emb|CDP15116.1| unnamed protein product [Coffea canephora]
Length=1134

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++NN  GTIP  IG    L+ L+ + N   G++P  IFNIS+L +I L +NHLSG LP +
Sbjct  177  SFNNLEGTIPNEIGKLQNLKKLICERNQLSGSLPSEIFNISSLEMIALRDNHLSGSLPGD  236

Query  181  MC  186
            MC
Sbjct  237  MC  238



>gb|AGT17229.1| hypothetical protein SHCRBa_019_G01_R_25 [Saccharum hybrid cultivar 
R570]
Length=572

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F G IPR +G+C ML++L   +N F GT+P  +FNI++L  ++L NNHL G + P 
Sbjct  215  SYNQFHGGIPRELGNCSMLRVLKAGHNQFCGTLPAELFNITSLEHLSLPNNHLQGKIDPE  274

Query  181  M  183
            +
Sbjct  275  L  275



>gb|EYU38095.1| hypothetical protein MIMGU_mgv1a024467mg, partial [Erythranthe 
guttata]
Length=236

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NN  GTIP  IG+   L +LL+  N   G+IP +IFNIS+L II++ NN+LSG LP ++
Sbjct  123  FNNLDGTIPEEIGNLHQLNMLLMGFNKLTGSIPPSIFNISSLGIISIPNNNLSGTLPVDL  182

Query  184  C  186
            C
Sbjct  183  C  183


 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
              GTIP  IG+   L  L +  N+F G IP +IFN+S L II+L NN+LSG LP ++C
Sbjct  3    LVGTIPPEIGNLSSLVSLDMSGNSFHGRIPRSIFNMSRLEIISLANNNLSGKLPVDIC  60



>emb|CBI31777.3| unnamed protein product [Vitis vinifera]
Length=628

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISA---LTIITLENNHLSGIL  171
            ++N F G+IPRGIGS  +L++L L +NN EG IP+T+FN+S+   L +I L  N L G +
Sbjct  213  SFNEFMGSIPRGIGSLSVLEVLYLGSNNLEGEIPQTLFNLSSLPRLQVINLSQNQLKGEI  272

Query  172  PPNM  183
            PP++
Sbjct  273  PPSL  276



>gb|KEH19795.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=732

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NN  GT+P  IG  D L+ LLL NN+F G+IP  IFN+S+L  + LE NHLSGI+P N
Sbjct  94   NNMEGTMPEEIGYLDKLEQLLLANNSFTGSIPSKIFNMSSLIGLYLEQNHLSGIIPSN  151



>gb|EMS52374.1| Tyrosine-sulfated glycopeptide receptor 1 [Triticum urartu]
Length=1030

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            ++N F+G++P+G+G C  +  L    N+  GTIP+ +FN ++L  ++L NNHL G+L
Sbjct  210  SFNRFSGSLPQGLGDCSKMIELRAGYNDLSGTIPDELFNATSLEYLSLSNNHLHGVL  266



>emb|CDP02657.1| unnamed protein product [Coffea canephora]
Length=177

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 39/65 (60%), Gaps = 5/65 (8%)
 Frame = +1

Query  7    NNFAGTIPRG-----IGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            NN  G IP       IG+   L+ L L  N+  G+IP  IFNIS L ++ L NNHLSGIL
Sbjct  58   NNLNGQIPESPIPNEIGNLLKLESLDLVENSLSGSIPVAIFNISTLRMLNLANNHLSGIL  117

Query  172  PPNMC  186
            P NMC
Sbjct  118  PSNMC  122



>emb|CDP11293.1| unnamed protein product [Coffea canephora]
Length=2312

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  7     NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
             NN  G  P  IGS   L+ + L  N  +G IP  IFNIS+L II L NN LSG+LP +MC
Sbjct  1404  NNLEGEFPHWIGSFPQLEEISLSYNLLQGNIPIGIFNISSLQIIALSNNGLSGVLPSDMC  1463


 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N+F G IP  I +   L+ + L  N  +G IP  IFNIS+L +I L NN LSG+LP +MC
Sbjct  156  NSFTGLIPSSISNLSKLESISLSYNPLQGNIPIGIFNISSLQVINLINNSLSGVLPSDMC  215


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            F G +P  I +   L+ + L  N   G IP  IFNIS+L +I L NN LSG+LP NMC
Sbjct  303  FTGLLPSSISNMSKLEEISLSYNLLAGDIPTGIFNISSLQMIDLANNSLSGVLPSNMC  360



>emb|CDP00845.1| unnamed protein product [Coffea canephora]
Length=1059

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  7     NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
             NNF G IP GIG C  LQ+L L +N F G IP+ I+N++ LT + L  N L+G LP ++C
Sbjct  989   NNFEGEIPSGIGECSRLQVLALSSNKFRGYIPKEIWNLTTLTQLYLGGNDLTGKLPTSLC  1048



>ref|XP_010261079.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=1159

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP  I  C  L  LLLD N   G+IP+++ N+S LT++TL  NHL+G++P N+
Sbjct  661  NNFSGEIPEEISKCSSLTSLLLDENQLVGSIPDSLSNLSNLTMLTLSTNHLTGMIPTNL  719



>ref|XP_004509927.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Cicer arietinum]
Length=1207

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N F G++P+ IG  D L+ L+L NN+F G+IP  +FN+S LT + LE N+ SGI+P N
Sbjct  424  NFFTGSLPKEIGYVDQLKFLILANNSFSGSIPSKLFNMSKLTYLHLEQNYFSGIIPSN  481



>ref|XP_004295584.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Fragaria vesca subsp. vesca]
Length=1094

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +NNF G IP   GS   L+   L  N F G+IP  IFN++AL +I+L NN LSG +P
Sbjct  128  FNNFMGAIPSWFGSLSKLETFDLYGNQFSGSIPAAIFNLTALQVISLSNNQLSGSIP  184


 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +N   GTIP  IG    L  L L  NN +G IP +IFNIS +T++ L +N LSG LP N+
Sbjct  296  WNYLTGTIPHEIGHLPSLDRLALGINNLDGLIPSSIFNISTITLMDLHDNQLSGTLPANV  355



>ref|XP_009351430.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Pyrus x bretschneideri]
Length=381

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            ++NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL ++ L NN LSG +P
Sbjct  138  SFNNFIGTIPSWFGSLSELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIP  195



>ref|XP_010657153.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Vitis vinifera]
Length=1524

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NN AG IPRG+G+   L++L L +N  +G IPE IFNIS+L +I   NN LSG LP  +C
Sbjct  597  NNLAGGIPRGMGNLLNLKMLSLVSNRLQGPIPEEIFNISSLQMIDFTNNSLSGNLPIAIC  656


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F G+IP+GIG+   L++L L   +  G IPE +FNIS+L I  L +N+LSG LP  
Sbjct  450  SYNEFIGSIPKGIGNLSELEVLYLGQKHLTGEIPEALFNISSLRIFDLPSNNLSGELPQA  509

Query  181  M  183
            +
Sbjct  510  L  510



>ref|XP_011002880.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X1 [Populus euphratica]
Length=992

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN F G IPR IG+   L +L   NN   G+IP T+ N+S L+++ L NNHLSG +PP +
Sbjct  187  YNQFTGYIPRDIGTMMKLNVLSFSNNLLLGSIPATVENLSNLSVLNLANNHLSGSIPPEL  246



>emb|CDP15118.1| unnamed protein product [Coffea canephora]
Length=574

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
              GTIP+ IG    L+ L+   N   G++P  IFNIS+L II L  NHLSG LP +MC
Sbjct  156  LEGTIPKEIGKLHNLKKLICQRNQLSGSLPSEIFNISSLEIIALRANHLSGSLPSDMC  213



>ref|XP_008226831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=984

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP   G+   LQ   L  N F G+IP T+FN+S L +I L NN LSG +P  +
Sbjct  130  YNNFMGSIPSWFGAFPKLQSFYLHGNQFSGSIPATVFNLSTLQVINLNNNQLSGQIPKEI  189



>ref|XP_011002881.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 isoform X2 [Populus euphratica]
Length=936

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN F G IPR IG+   L +L   NN   G+IP T+ N+S L+++ L NNHLSG +PP +
Sbjct  131  YNQFTGYIPRDIGTMMKLNVLSFSNNLLLGSIPATVENLSNLSVLNLANNHLSGSIPPEL  190



>ref|XP_007217616.1| hypothetical protein PRUPE_ppa016276mg [Prunus persica]
 gb|EMJ18815.1| hypothetical protein PRUPE_ppa016276mg [Prunus persica]
Length=1090

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F+G IP G+G+C  L       +N EGTIP +   +  L+I+ L  NHLSG +PP 
Sbjct  244  SYNKFSGGIPPGLGNCSNLTQFSAVGSNLEGTIPSSFGQLKYLSILYLPLNHLSGKIPPE  303

Query  181  M  183
            +
Sbjct  304  L  304



>ref|XP_008371720.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=634

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            ++NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL ++ L NN LSG +P
Sbjct  138  SFNNFIGTIPSWFGSLSELQTFDLYGNQFSGFIPNAIFNLSALQVLDLRNNELSGSIP  195



>gb|EYU38094.1| hypothetical protein MIMGU_mgv1a019689mg, partial [Erythranthe 
guttata]
Length=654

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NNF G +P GIG+   L  L +  N   G +P +IFNIS+L +++  NN LSG LP ++
Sbjct  97   HNNFVGNVPGGIGNLSSLVDLFMFENLLHGPVPTSIFNISSLQVVSFWNNSLSGNLPVDL  156

Query  184  C  186
            C
Sbjct  157  C  157



>gb|KEH19873.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=806

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            F+GTIP  IG  D L+LL+L +N   G+IP  IFN+S+LT + +ENN LSG +P N
Sbjct  26   FSGTIPEEIGYLDKLELLVLGDNRLSGSIPSKIFNLSSLTALVVENNSLSGTIPSN  81



>gb|KDP44902.1| hypothetical protein JCGZ_01402 [Jatropha curcas]
Length=445

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN +G IP  IG+C+ LQ L L +NNF G IP +  N+S L+ + +ENN+++G +PP++
Sbjct  27   YNNISGPIPSFIGNCNQLQGLDLSDNNFSGLIPPSFANLSQLSYLIMENNNINGPIPPDI  86

Query  184  C  186
            C
Sbjct  87   C  87



>ref|XP_007212637.1| hypothetical protein PRUPE_ppa018076mg, partial [Prunus persica]
 gb|EMJ13836.1| hypothetical protein PRUPE_ppa018076mg, partial [Prunus persica]
Length=880

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NNF   IP+ IG+ D L+ L + +N  +G +P  +FN+S+LT++TL  N LSG+LP N+
Sbjct  50   HNNF-NEIPKEIGNLDKLEKLHVLSNALKGPVPVAVFNMSSLTMLTLYENSLSGVLPDNI  108

Query  184  C  186
            C
Sbjct  109  C  109



>ref|XP_008355519.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Malus domestica]
 ref|XP_008360148.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Malus domestica]
Length=165

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YNNF GTIP   GS   LQ   L  N F G IP  IFN+SAL  I L  N LSG +P
Sbjct  48   YNNFIGTIPSWFGSFAKLQAFQLHGNGFSGFIPTAIFNLSALETINLSGNQLSGSIP  104



>ref|XP_008225338.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1128

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NNF   IP+ IG+ D L+ L + +N  +G +P  +FN+S+LT++TL  N LSG+LP N+
Sbjct  244  HNNF-NEIPKEIGNLDKLEKLHVQSNALKGPVPVAVFNMSSLTMLTLYENSLSGVLPDNI  302

Query  184  C  186
            C
Sbjct  303  C  303


 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            YNNF G+IP   GS   LQ   L  NNF G+IP TIFN+S L +I L  N LSG
Sbjct  116  YNNFMGSIPSWFGSFPKLQSFYLYGNNFSGSIPATIFNLSTLQVIDLSINQLSG  169



>ref|XP_008383875.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=910

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++ NFAG IP   GS   LQ   L  N F G+IP  IFN+SAL ++ L NN LSG +P  
Sbjct  138  SFXNFAGXIPSWFGSLSELQTFDLYGNQFSGSIPNDIFNLSALQVLDLRNNQLSGSIPKE  197

Query  181  M  183
            +
Sbjct  198  V  198



>ref|XP_006355253.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Solanum tuberosum]
Length=479

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +N+  G IP  IG    L+ L ++ N   G+IP +IFNIS + +I L +N LSG LPP+M
Sbjct  161  FNSLGGQIPEKIGKLQNLKELNIEANRLTGSIPFSIFNISGIKVIALTDNTLSGNLPPDM  220

Query  184  C  186
            C
Sbjct  221  C  221


 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YN   GTIP+ IG  D L  L LD+N   G IP +IFNIS+L  + LE NHL G LP
Sbjct  354  YNMLTGTIPQEIGILDNLVELGLDSNQITGHIPISIFNISSLETLYLERNHLIGSLP  410



>ref|XP_010909229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
 ref|XP_010909230.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Elaeis guineensis]
Length=1026

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN  G+IP GIG    L+ L +  N   GTIP +++N+SALT I +  N L G LPPN+
Sbjct  210  NNLVGSIPHGIGLISGLEFLQIAENQISGTIPRSLYNLSALTFIAIATNQLHGSLPPNL  268



>gb|EMT29923.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1193

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F+G IP  IG C  LQ++    N F G+IP +I N+S L  + L  N LSG++PP +
Sbjct  421  NQFSGEIPESIGECSSLQMIDFFGNQFNGSIPASIGNLSELIFLHLRQNELSGLIPPEL  479



>ref|XP_008225314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Prunus mume]
Length=1160

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YNNF G+IP   GS   LQ + L  N F G+IP  IFN+S L +I L NN LSG +P
Sbjct  165  YNNFMGSIPLWFGSFPKLQSIDLRGNQFSGSIPAIIFNLSTLQVINLSNNQLSGSVP  221



>ref|XP_009375059.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Pyrus x bretschneideri]
Length=1132

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
             YNNF GTIP   GS   LQ  +L  N F G IP  IFN+SAL  I L NN LSG +P
Sbjct  145  QYNNFTGTIPSWFGSFPKLQTFILWGNGFSGFIPAAIFNLSALEKIDLSNNQLSGSIP  202


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G+IP+ +G+   L  ++L +NN EGTIP+ I ++  L I+TL  N+LSG++P  +
Sbjct  315  NNFRGSIPKSLGNLTYLSKIILSDNNLEGTIPDEIGDLPQLEILTLHTNNLSGVIPSKL  373



>gb|EMS60862.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Triticum 
urartu]
Length=814

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F+G IP  IG C  LQ++    N F G+IP +I N+S L  + L  N LSG++PP +
Sbjct  103  NQFSGEIPETIGECSSLQMIDFFGNQFNGSIPASIGNLSELIFLHLRQNELSGLIPPEL  161



>ref|XP_009375060.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Pyrus x bretschneideri]
Length=1012

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
             YNNF GTIP   GS   LQ  +L  N F G IP  IFN+SAL  I L NN LSG +P
Sbjct  145  QYNNFTGTIPSWFGSFPKLQTFILWGNGFSGFIPAAIFNLSALEKIDLSNNQLSGSIP  202


 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N  +G+IPR IG+  M++++ LD+N FEGTIP+ I ++  L I+TL  N+LSG++P  +
Sbjct  195  NQLSGSIPREIGNLTMVKVIYLDDNKFEGTIPDEIGDLPQLEILTLHTNNLSGVIPSKL  253



>ref|XP_002453318.1| hypothetical protein SORBIDRAFT_04g003800 [Sorghum bicolor]
 gb|EES06294.1| hypothetical protein SORBIDRAFT_04g003800 [Sorghum bicolor]
Length=1067

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +YN F+G+IP G+G+C M+  L   +NNF GT+P+ +FNI+ L  ++  NN L G L
Sbjct  236  SYNQFSGSIPPGLGNCSMMTSLNAGHNNFSGTLPDELFNITLLEHLSFPNNQLEGSL  292



>ref|XP_008349051.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Malus domestica]
Length=134

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  16   AGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            A  IP  IGS D ++ L +  N  +G IP  +FN+S+LTI+ L  N+LSG LP N+C
Sbjct  14   AEEIPNLIGSKDQVERLFVQGNALKGHIPVAVFNMSSLTILALAQNNLSGSLPDNIC  70



>ref|XP_008229366.1| PREDICTED: receptor-like protein kinase [Prunus mume]
Length=1086

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F+G +P G+G+C  L       +N EGTIP +   ++ L+I+ L  NHLSG +PP 
Sbjct  247  SYNKFSGGLPPGLGNCSNLTQFSAVGSNLEGTIPSSFGQLAYLSILYLPLNHLSGKIPPE  306

Query  181  M  183
            +
Sbjct  307  L  307


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP+ + +C +L+ L L  N F G IPE++F I AL  + L  N L+G +P N+
Sbjct  105  NNFSGKIPKELANCSLLENLDLYKNGFSGAIPESLFAIPALAYVHLYTNSLNGSIPGNV  163



>emb|CDP11031.1| unnamed protein product [Coffea canephora]
Length=380

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NNF G IP GIG C  LQ+L L +N F G IP+ ++N++ LT I L    L+G LP ++C
Sbjct  225  NNFEGEIPSGIGECSRLQVLSLSSNKFRGHIPKGVWNLTTLTQIHLGGTDLTGKLPTSLC  284



>ref|XP_002489144.1| hypothetical protein SORBIDRAFT_0019s003400 [Sorghum bicolor]
 gb|EES20388.1| hypothetical protein SORBIDRAFT_0019s003400 [Sorghum bicolor]
Length=728

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YN F G IP  +G+C +L++L    N F GT+P  +FN+++L  ++L NNHL G L P
Sbjct  215  SYNQFHGGIPPELGNCPVLRVLKAGQNQFSGTLPRELFNVTSLEHLSLPNNHLQGKLDP  273



>ref|XP_008442449.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Cucumis 
melo]
Length=980

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+F G+IP  IG    ++   +  NN  GT+P +I+NIS+LT++    NHL G LPPN+
Sbjct  153  NDFHGSIPSEIGRLSKMEFFTVVENNLTGTVPPSIYNISSLTLLHFTKNHLQGTLPPNI  211



>emb|CDP18966.1| unnamed protein product [Coffea canephora]
Length=1300

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N F G IP GIG C  LQ+L L  N F G IP  I+N++ LT + L +N L+G LP +
Sbjct  419  SWNYFEGEIPSGIGECSGLQVLSLSYNKFRGYIPREIWNLTTLTGLYLGDNDLTGKLPTS  478

Query  181  MC  186
            +C
Sbjct  479  LC  480



>ref|XP_004951813.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Setaria 
italica]
Length=1063

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            YN F+GT+P G+G+C ML++L   +NN  GT+P+ +FN ++L  ++  NN+L G+L
Sbjct  213  YNQFSGTVPPGLGNCSMLRVLKAGHNNLTGTLPDELFNATSLEYLSFPNNNLQGVL  268



>ref|XP_008665971.1| PREDICTED: receptor-like protein 2 [Zea mays]
Length=185

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            YN F G IP  +G+C  L++L    N   GT+P  IFN+++L  ++  NNHL G L P
Sbjct  58   YNQFIGRIPSELGNCSGLKVLKAGQNQLNGTLPSEIFNVTSLEHLSFPNNHLQGTLDP  115



>emb|CBJ30535.1| Hypothetical leucine rich repeat protein [Ectocarpus siliculosus]
Length=1196

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN  GTIP G+G+ D L+ L L NN   G+IP T+ N+  L ++ LE N LSG++ P +
Sbjct  76   NNLQGTIPAGLGTLDALEHLDLSNNKLSGSIPWTLANLGELQVLILEANQLSGVVSPEL  134



>ref|XP_007213507.1| hypothetical protein PRUPE_ppa020889mg [Prunus persica]
 gb|EMJ14706.1| hypothetical protein PRUPE_ppa020889mg [Prunus persica]
Length=945

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YNNF G+IP   GS   LQ   L  N F GT+P TIFN+SAL  I L NN LSG +P
Sbjct  134  YNNFMGSIPSWFGSFPKLQGFHLSGNQFSGTVPTTIFNLSALQDIDLCNNKLSGGIP  190



>ref|XP_004156664.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At3g47110-like [Cucumis sativus]
Length=1343

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G+IP  IG    ++   +  NN  G +P +I+NIS+LT++    NHL G LPPN+
Sbjct  196  NNFHGSIPSEIGRLSKMEFFTVVENNLTGIVPPSIYNISSLTLLQFTKNHLQGTLPPNI  254



>ref|XP_008442450.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Cucumis melo]
Length=1076

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G IP  +G    L+   +  N   GT+P ++FNI++LT+++L  N L G LPPN+
Sbjct  242  YNNFQGNIPNELGHLRRLEFFAITANYLTGTVPLSLFNITSLTLMSLTVNRLQGTLPPNI  301



>ref|XP_004137908.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At3g47110-like [Cucumis sativus]
Length=1343

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G+IP  IG    ++   +  NN  G +P +I+NIS+LT++    NHL G LPPN+
Sbjct  196  NNFHGSIPSEIGRLSKMEFFTVVENNLTGIVPPSIYNISSLTLLQFTKNHLQGTLPPNI  254



>gb|KGN58773.1| hypothetical protein Csa_3G731830 [Cucumis sativus]
Length=1019

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G+IP  IG    ++   +  NN  G +P +I+NIS+LT++    NHL G LPPN+
Sbjct  196  NNFHGSIPSEIGRLSKMEFFTVVENNLTGIVPPSIYNISSLTLLQFTKNHLQGTLPPNI  254



>ref|XP_006367570.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Solanum tuberosum]
Length=763

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN+F G IP+ I +   L++  ++ N+F G++P  IFNIS L II L  N+LSG LPPN+
Sbjct  81   YNHFTGEIPKEIRNLVELEVFDVEFNSFSGSLPMEIFNISRLRIIGLSGNNLSGTLPPNI  140



>dbj|BAJ92367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1262

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F+G IP  IG C  LQ++    N F G+IP +I N+S L  + L  N LSG++PP +
Sbjct  456  NQFSGEIPETIGKCSSLQMIDFFGNQFNGSIPASIGNLSELIFLHLRQNELSGLIPPEL  514



>ref|XP_007212752.1| hypothetical protein PRUPE_ppa016624mg, partial [Prunus persica]
 gb|EMJ13951.1| hypothetical protein PRUPE_ppa016624mg, partial [Prunus persica]
Length=1066

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YNNF G+IP   GS   LQ + L  N F G+IP  IFN+S L +I L NN LSG +P
Sbjct  130  YNNFMGSIPLWFGSFPKLQSIDLCGNQFSGSIPAIIFNLSTLQVINLSNNQLSGSVP  186



>emb|CDP00850.1| unnamed protein product [Coffea canephora]
Length=2175

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G IP GIG C  LQ+L L  N F G IP  I+N++ LT + L  N L+GILP  +
Sbjct  257  NNFEGEIPSGIGECSGLQVLSLSYNKFRGYIPREIWNLTTLTRLVLGGNDLTGILPQEV  315



>ref|XP_004293986.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1105

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +NNF G IP  +GS   LQ+L L  N F G+IP  IFN+SAL ++ L+ N LSG +P
Sbjct  111  FNNFVGEIPSWLGSLSKLQILNLYGNGFSGSIPTVIFNLSALQVLDLKYNQLSGTIP  167



>ref|XP_010657053.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Vitis vinifera]
Length=1457

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YNN AG IPR IG+   L +L   ++   G IP  IFNIS+L II L +N L G LP +
Sbjct  307  DYNNLAGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISSLQIIDLTDNSLPGSLPMD  366

Query  181  MC  186
            +C
Sbjct  367  IC  368



>ref|XP_010657052.1| PREDICTED: putative receptor-like protein kinase At3g47110 isoform 
X1 [Vitis vinifera]
Length=1522

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YNN AG IPR IG+   L +L   ++   G IP  IFNIS+L II L +N L G LP +
Sbjct  372  DYNNLAGGIPREIGNLSNLNILDFGSSGISGPIPPEIFNISSLQIIDLTDNSLPGSLPMD  431

Query  181  MC  186
            +C
Sbjct  432  IC  433



>ref|XP_009383987.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=675

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++NN +G IPRGI +   L  L L+ NN  G+IPE I ++  L ++ L NN LSG +PP 
Sbjct  106  HFNNISGEIPRGIANLTELSELYLNVNNLSGSIPEEIGDMDGLQVLQLSNNKLSGSIPPK  165

Query  181  M  183
            +
Sbjct  166  L  166



>gb|EMT32020.1| Tyrosine-sulfated glycopeptide receptor 1 [Aegilops tauschii]
Length=806

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +N F+G+IP G+G C  L+ L   +NN  GT+P+ +FN ++L  ++LENN L G+L
Sbjct  216  FNKFSGSIPPGLGDCSKLRELKAGHNNLSGTLPDELFNATSLEYLSLENNDLHGVL  271



>ref|XP_002449703.1| hypothetical protein SORBIDRAFT_05g021860 [Sorghum bicolor]
 gb|EES08691.1| hypothetical protein SORBIDRAFT_05g021860 [Sorghum bicolor]
Length=730

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YN F G IP+ +G+C ML++L   +N   GT+P  +FNI++L  ++  NNHL G + P
Sbjct  207  SYNQFHGGIPQELGNCSMLRVLKAGHNQLSGTLPAELFNITSLEHLSFPNNHLQGKIDP  265



>ref|XP_002460722.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
 gb|EER97243.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
Length=1255

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G IP  IG C  LQL+    N F G+IP ++ N+S LT +    N LSG++PP +
Sbjct  448  NQFVGEIPESIGDCASLQLIDFFGNRFNGSIPASMGNLSQLTFLDFRQNELSGVIPPEL  506



>gb|KHN34330.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=962

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YNNF G IP  +G+C  L  L L +NN  G IP+ I N+++L ++ L+ N  SGI+PP
Sbjct  678  SYNNFRGKIPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFSGIIPP  736



>gb|AFY98537.3| somatic embryogenesis receptor kinase [Momordica charantia]
Length=627

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N F+G IP  +G    L+ L L+NN+  G IP ++ NISAL ++ L NNHLSG++P N
Sbjct  129  NRFSGPIPDSLGKLSKLRFLRLNNNSLAGPIPMSLTNISALQVLDLSNNHLSGVVPDN  186



>ref|XP_004980623.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1145

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN  +G IP  +G    L  L L  NNF G IP +I+NIS+L   T++ N+LSG LPPN
Sbjct  335  DYNKLSGAIPSSLGHLSNLSRLTLGFNNFTGLIPNSIWNISSLQAFTVQQNYLSGSLPPN  394



>ref|XP_004137906.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
Length=938

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G IP  +G    L+   +  N   GT+P +++NI++LT+++L  N L G LPPN+
Sbjct  241  YNNFQGNIPNELGHLRRLEFFAITANYLTGTVPLSLYNITSLTLMSLTANRLQGTLPPNI  300



>ref|XP_009110420.1| PREDICTED: receptor-like protein 2 [Brassica rapa]
Length=682

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            +YN+F+G IPRG+G C  L +L    N+  G IP  I+N+S L  + L  NHLSG
Sbjct  169  SYNDFSGHIPRGLGRCLRLSVLRAGFNHLSGEIPRDIYNLSKLEKLVLPANHLSG  223



>gb|KGN58770.1| hypothetical protein Csa_3G731800 [Cucumis sativus]
Length=1075

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G IP  +G    L+   +  N   GT+P +++NI++LT+++L  N L G LPPN+
Sbjct  241  YNNFQGNIPNELGHLRRLEFFAITANYLTGTVPLSLYNITSLTLMSLTANRLQGTLPPNI  300



>ref|XP_008372676.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1233

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ  +L  N F G+IP +IFN+SAL II++ +N LSG +P
Sbjct  238  NNFTGTIPSWFGSFPKLQTFILSGNGFSGSIPTSIFNLSALEIISVSSNQLSGSIP  293


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP+ +G+   L+ + L NNN EGTIP+ I +IS L I+ L  N+L+G++P  +
Sbjct  47   YNNFRGSIPKSLGNLTYLRKIYLYNNNLEGTIPDEIGDISQLEILGLMINNLNGVIPSKL  106



>emb|CDX96780.1| BnaA08g23230D [Brassica napus]
Length=682

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            +YN+F+G IPRG+G C  L +L    N+  G IP  I+N+S L  + L  NHLSG
Sbjct  169  SYNDFSGHIPRGLGRCLRLSVLRAGFNHLSGEIPRDIYNLSKLEKLVLPANHLSG  223



>ref|XP_010316832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Solanum lycopersicum]
Length=292

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP+ IG+   L+ L+L  N F GTIP +IFN+S+L I+ L NN L+G LP ++C
Sbjct  161  NRLQGNIPKEIGNLKNLKELILFGNQFTGTIPLSIFNMSSLEILGLSNNQLTGSLPVDIC  220



>emb|CDP20521.1| unnamed protein product [Coffea canephora]
Length=668

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NNF G +P  +G+   L+ L   +N F G +P+ +FN+S+L II   NN LSG LP ++C
Sbjct  136  NNFEGELPSWLGALTALRFLSFRDNGFSGPLPQALFNLSSLQIIRFTNNSLSGYLPAHIC  195



>emb|CDX83918.1| BnaC08g17270D [Brassica napus]
Length=682

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            +YN+F+G IPRG+G C  L +L    N+  G IP  I+N+S L  + L  NHLSG
Sbjct  169  SYNDFSGHIPRGLGRCLRLSVLRAGFNHLSGEIPRDIYNLSKLEKLVLPANHLSG  223



>ref|XP_003525510.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=988

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YNNF G IP  +G+C  L  L L +NN  G IP+ I N+++L ++ L+ N  SGI+PP
Sbjct  688  SYNNFRGKIPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFSGIIPP  746



>ref|XP_004305138.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1023

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN  G+IP  +G    L+  +L +NN  GT+P +I+NIS+L   T+ NNHL G LPPN+
Sbjct  190  NNLQGSIPSELGGLTSLRKFVLASNNLSGTVPSSIYNISSLYYFTIANNHLHGELPPNI  248



>ref|XP_004156666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
Length=938

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G IP  +G    L+   +  N   GT+P +++NI++LT+++L  N L G LPPN+
Sbjct  241  YNNFQGNIPNELGHLRRLEFFAITANYLTGTVPLSLYNITSLTLMSLTANRLQGTLPPNI  300



>ref|XP_006428283.1| hypothetical protein CICLE_v10010969mg [Citrus clementina]
 gb|ESR41523.1| hypothetical protein CICLE_v10010969mg [Citrus clementina]
Length=1023

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALT-IITLENNHLSGILPP  177
            N NN +G IP  +G+   L  L +  N   GTIPE IFNIS L+  + L  NHL GI+PP
Sbjct  445  NNNNLSGVIPFSLGNLKRLAFLEMSGNELSGTIPEDIFNISYLSNSLNLARNHLVGIIPP  504

Query  178  NMC  186
             +C
Sbjct  505  RIC  507



>emb|CBI35485.3| unnamed protein product [Vitis vinifera]
Length=715

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G IP+ +G+   L  L L  N F G IP +++NIS+L+ ++L  NHL G LP +M
Sbjct  169  NNFRGEIPKELGNLHNLVSLRLSENQFSGQIPNSLYNISSLSFLSLTQNHLVGKLPTDM  227



>ref|XP_003535237.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Glycine max]
Length=1118

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN  +G IP+ IG C  L+ L L+NN FEGTIP  +  +SAL  + + NN LSG+LP  +
Sbjct  121  YNKLSGNIPKEIGECLNLEYLNLNNNQFEGTIPAELGKLSALKSLNIFNNKLSGVLPDEL  180



>ref|XP_007221162.1| hypothetical protein PRUPE_ppa020518mg, partial [Prunus persica]
 gb|EMJ22361.1| hypothetical protein PRUPE_ppa020518mg, partial [Prunus persica]
Length=226

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +NNF G IP   G    L+ L L  N F G+IP  I+N+SAL ++ L NN LSG +P
Sbjct  143  FNNFMGIIPAWFGHLSKLRTLGLYGNQFSGSIPNAIYNLSALQVLDLSNNQLSGSIP  199



>ref|XP_002534492.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF27892.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=661

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN   G IP ++ NIS+L ++ L NNHLSG++P N
Sbjct  111  NSFTGPIPESLGKLSKLRFLRLNNNTLTGRIPMSLTNISSLQVLDLSNNHLSGVVPDN  168



>ref|XP_011038199.1| PREDICTED: somatic embryogenesis receptor kinase 2 [Populus euphratica]
Length=627

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  G IP ++ NISAL ++ L NNHLSG++P N
Sbjct  129  NSFTGPIPDTLGKLSKLRFLRLNNNSLTGPIPMSLTNISALQVLDLSNNHLSGVVPDN  186



>ref|XP_006646898.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Oryza 
brachyantha]
Length=1046

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +YN+F+G+IP G+GSC  L++L   +NN  GTIP+ +FN ++L I++  +N L G L
Sbjct  208  SYNHFSGSIPPGLGSCSRLRVLKAGHNNLSGTIPDELFNATSLEILSFSSNDLQGTL  264



>gb|KHN20812.1| Putative leucine-rich repeat receptor-like protein kinase [Glycine 
soja]
Length=1118

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN  +G IP+ IG C  L+ L L+NN FEGTIP  +  +SAL  + + NN LSG+LP  +
Sbjct  121  YNKLSGNIPKEIGECLNLEYLNLNNNQFEGTIPAELGKLSALKSLNIFNNKLSGVLPDEL  180



>ref|XP_010316831.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Solanum lycopersicum]
Length=338

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP+ IG+   L+ L+L  N F GTIP +IFN+S+L I+ L NN L+G LP ++C
Sbjct  161  NRLQGNIPKEIGNLKNLKELILFGNQFTGTIPLSIFNMSSLEILGLSNNQLTGSLPVDIC  220



>ref|XP_002533428.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF28948.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=963

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N  +G IPR +GSC  L++L +  NNF+G IP ++ ++ AL I+ L NNHLSG++P
Sbjct  531  NKLSGEIPRTLGSCISLEILNMAGNNFQGLIPSSLSSLRALQILDLSNNHLSGMVP  586



>ref|XP_010316830.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Solanum lycopersicum]
Length=352

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP+ IG+   L+ L+L  N F GTIP +IFN+S+L I+ L NN L+G LP ++C
Sbjct  161  NRLQGNIPKEIGNLKNLKELILFGNQFTGTIPLSIFNMSSLEILGLSNNQLTGSLPVDIC  220



>gb|EMT02814.1| Tyrosine-sulfated glycopeptide receptor 1 [Aegilops tauschii]
Length=1049

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            ++N F+G++P+G+G C  +  L    N+  GTIP+ +F  ++L  ++L NNHL G+L
Sbjct  210  SFNRFSGSLPQGLGDCSKMIELRAGYNDLSGTIPDELFIATSLEYLSLSNNHLHGVL  266



>ref|XP_008665972.1| PREDICTED: receptor-like protein 2 [Zea mays]
Length=250

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            YN F G IP  +G+C  L++L    N   GT+P  IFN+++L  ++  NNHL G L P
Sbjct  123  YNQFIGRIPSELGNCSGLKVLKAGQNQLNGTLPSEIFNVTSLEHLSFPNNHLQGTLDP  180



>ref|XP_002459536.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor]
 gb|EER96057.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor]
Length=1036

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NN +G IP   G+C ++Q+LL+D+N+FEG+IP T  N++ LT++ L NN L+G +P N+ 
Sbjct  532  NNLSGEIPDTFGNCKLMQILLMDDNSFEGSIPATFKNMAGLTVLNLMNNKLNGSIPSNLA  591



>emb|CAN79365.1| hypothetical protein VITISV_033877 [Vitis vinifera]
Length=797

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+  GTIP  IG+   L  +    NNF G IP TIFNIS L  I+LE+N LSG LP  +
Sbjct  121  NHLHGTIPNEIGNLQNLMGIGFAENNFTGLIPLTIFNISTLEQISLEDNSLSGTLPATL  179



>ref|XP_008665969.1| PREDICTED: receptor-like protein 2 [Zea mays]
Length=250

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            YN F G IP  +G+C  L++L    N   GT+P  IFN+++L  ++  NNHL G L P
Sbjct  123  YNQFIGRIPSELGNCSGLKVLKAGQNQLNGTLPSEIFNVTSLEHLSFPNNHLQGTLDP  180



>ref|XP_010999778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1041

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            ++N F+G+IP  IGSC  L+ L +DNN F G+IP T+ ++  L I+ L +NH+SG +P
Sbjct  540  SHNYFSGSIPDTIGSCKSLEELFMDNNMFSGSIPATLGDVKGLEILDLSSNHISGTIP  597



>ref|XP_003524106.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Glycine max]
Length=1214

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N F G+IP+ IG   ML  L L +N+  G+IP  IFN+S+LT ++LE+N LSG LP
Sbjct  425  NCFTGSIPKEIGDLPMLANLTLGSNHLNGSIPSNIFNMSSLTYLSLEHNSLSGFLP  480


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G+IPR IG+C +L+ L L +N F G+IP+ I ++  L  +TL +NHL+G +P N+
Sbjct  401  NQFKGSIPRSIGNCTLLEELYLGDNCFTGSIPKEIGDLPMLANLTLGSNHLNGSIPSNI  459



>gb|KHN25863.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1195

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N F G+IP+ IG   ML  L L +N+  G+IP  IFN+S+LT ++LE+N LSG LP
Sbjct  406  NCFTGSIPKEIGDLPMLANLTLGSNHLNGSIPSNIFNMSSLTYLSLEHNSLSGFLP  461


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G+IPR IG+C +L+ L L +N F G+IP+ I ++  L  +TL +NHL+G +P N+
Sbjct  382  NQFKGSIPRSIGNCTLLEELYLGDNCFTGSIPKEIGDLPMLANLTLGSNHLNGSIPSNI  440



>emb|CDP21317.1| unnamed protein product [Coffea canephora]
Length=261

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++NNF G IP   G  + LQ L L NN+F G +P  +FNIS L +I    N+LSGI+P +
Sbjct  131  SHNNFTGEIPSWFGFLEKLQHLSLRNNSFTGFLPPPLFNISGLGVIDFSENNLSGIIPVD  190

Query  181  MC  186
            MC
Sbjct  191  MC  192



>ref|XP_008352360.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Malus domestica]
Length=206

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL  I L +N LSG +P
Sbjct  137  NNFMGTIPSWFGSFPKLQTFTLARNGFSGFIPAAIFNLSALEAIDLSSNQLSGSIP  192



>gb|KHN17066.1| Somatic embryogenesis receptor kinase 1 [Glycine soja]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  G IP ++ NI+AL ++ L NNHLSG++P N
Sbjct  126  NHFTGPIPDSLGKLSKLRFLRLNNNSLSGPIPMSLTNITALQVLDLSNNHLSGVVPDN  183



>ref|XP_003556185.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Glycine 
max]
 gb|KHN00778.1| Somatic embryogenesis receptor kinase 1 [Glycine soja]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  G IP ++ NI+AL ++ L NNHLSG++P N
Sbjct  126  NHFTGPIPDSLGKLSKLRFLRLNNNSLSGPIPMSLTNITALQVLDLSNNHLSGVVPDN  183



>ref|XP_002969053.1| hypothetical protein SELMODRAFT_18890, partial [Selaginella moellendorffii]
 gb|EFJ30169.1| hypothetical protein SELMODRAFT_18890, partial [Selaginella moellendorffii]
Length=125

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G++PR +G+C  L+ L    N  +G IP  +  +  L I+ L+NN LSG LPP++ 
Sbjct  27   NRLTGSLPRDLGNCSALRFLNAQQNQLQGPIPPQLGALQRLEILVLDNNRLSGSLPPSLA  86



>gb|ABS32233.1| somatic embryogenesis receptor kinase [Carica papaya]
 gb|ABY60783.1| somatic embryogenesis receptor kinase [Carica papaya]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F+G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NNHLSG++P N
Sbjct  126  NSFSGPIPDSLGKLSKLRFLRLNNNSLTGPIPMSLTNISSLQVLDLSNNHLSGVVPDN  183



>ref|XP_011002514.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Populus 
euphratica]
Length=627

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  G IP ++ NISAL ++ L NNHLSG++P N
Sbjct  129  NSFTGPIPDTLGKLSKLRFLRLNNNSLAGPIPMSLTNISALQVLDLSNNHLSGVVPDN  186



>gb|ABS32228.1| somatic embryogenesis receptor kinase [Carica papaya]
 gb|ABY60779.1| somatic embryogenesis receptor kinase [Carica papaya]
Length=624

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F+G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NNHLSG++P N
Sbjct  126  NSFSGPIPDSLGKLSKLRFLRLNNNSLTGPIPMSLTNISSLQVLDLSNNHLSGVVPDN  183



>emb|CDY15361.1| BnaC04g42620D [Brassica napus]
Length=715

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YNNF  +IP  IG  + L+++ L +N+F G +P TI N+++LT + LE+NHL+G  PP
Sbjct  186  SYNNFNSSIPSEIGILNRLEVISLSSNDFSGQVPPTISNLTSLTELYLEDNHLTGSFPP  244



>ref|XP_006358151.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=765

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NNF G IP+  G+   L+ L+L +N   G+IP +IFNIS+L I+ L  N LSG LP ++C
Sbjct  228  NNFTGQIPKDFGNLMRLEKLVLVSNKLSGSIPFSIFNISSLEILALTYNQLSGSLPVDIC  287



>tpg|DAA40884.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1207

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N FAG IP  IG C  LQ +    N F G+IP ++ N+S L  + L  N LSG++PP +
Sbjct  447  NQFAGEIPASIGDCASLQQVDFFGNRFNGSIPASMGNLSQLIFLDLRQNDLSGVIPPEL  505



>emb|CDO96776.1| unnamed protein product [Coffea canephora]
Length=1107

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            Y+   G I   IG+   L++L L +N   G+IP T+FNIS+L +ITL NN LSG LP N+
Sbjct  177  YSQLEGIIAEEIGNLGNLKILDLQDNELMGSIPRTLFNISSLQVITLTNNSLSGTLPMNI  236

Query  184  C  186
            C
Sbjct  237  C  237



>gb|EMT02815.1| Tyrosine-sulfated glycopeptide receptor 1 [Aegilops tauschii]
Length=607

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            YN F G+IP G+G+C ML++L   +N+  G +P  +F+ S L  ++L NNHL+G L
Sbjct  189  YNQFTGSIPPGLGNCSMLRVLKAGHNHLRGALPNELFDASLLEYLSLPNNHLNGKL  244



>ref|NP_001238274.1| somatic embryogenesis receptor kinase precursor [Glycine max]
 gb|ACJ64717.1| somatic embryogenesis receptor kinase [Glycine max]
Length=624

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  G IP ++ NI+AL ++ L NNHLSG++P N
Sbjct  126  NHFTGPIPDSLGKLSKLRFLRLNNNSLSGPIPMSLTNITALQVLDLSNNHLSGVVPDN  183



>ref|XP_004963189.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like isoform X4 [Setaria italica]
Length=1056

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NYN   G IP G+G    L  L L     +GTIP ++FN+S L  + L NN LSG+LPPN
Sbjct  245  NYN-LGGYIPDGLGRLTKLNFLRLAFTGLKGTIPASLFNMSLLITLDLGNNELSGVLPPN  303

Query  181  M  183
            +
Sbjct  304  I  304



>ref|XP_004963190.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR-like isoform X5 [Setaria italica]
Length=1028

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NYN   G IP G+G    L  L L     +GTIP ++FN+S L  + L NN LSG+LPPN
Sbjct  245  NYN-LGGYIPDGLGRLTKLNFLRLAFTGLKGTIPASLFNMSLLITLDLGNNELSGVLPPN  303

Query  181  M  183
            +
Sbjct  304  I  304



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            N+N F+G IP GIG C  L  L L  N+F+G +P+++  +S++T ++L NN LSG + P
Sbjct  270  NHNQFSGVIPAGIGLCPHLDTLDLSFNSFDGHLPDSVQYLSSMTFLSLSNNQLSGDVLP  328



>emb|CDP00840.1| unnamed protein product [Coffea canephora]
Length=1092

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN   G IP GIG C  LQ L L  N F G++P+  +N++AL  I L N +L G+LP
Sbjct  262  SYNQLQGEIPSGIGECSRLQNLSLSYNKFNGSLPKEFWNLTALERIRLGNTYLEGLLP  319



>ref|XP_008364201.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=603

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS  +LQ+  L  N F G IP  IFN+S L II L NN LSG +P
Sbjct  182  NNFMGTIPSWFGSFPILQIFTLYGNRFSGFIPAAIFNLSXLEIIDLSNNQLSGSIP  237



>ref|XP_002969046.1| hypothetical protein SELMODRAFT_18440, partial [Selaginella moellendorffii]
 gb|EFJ30162.1| hypothetical protein SELMODRAFT_18440, partial [Selaginella moellendorffii]
Length=136

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G++PR +G+C  L+ L    N  +G IP  +  +  L I+ L+NN LSG LPP++ 
Sbjct  40   NRLTGSLPRDLGNCSALRFLNAQQNQLQGPIPPQLGALQRLEILVLDNNRLSGSLPPSLA  99



>ref|XP_009631801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana tomentosiformis]
Length=1153

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N  AG IP  IG+  ML  L LD NNF G+IP  IFN+S+L II+L  NH+SG +P
Sbjct  373  NKLAGVIPDEIGNLQMLTQLQLDLNNFSGSIPVGIFNMSSLIIISLAQNHISGNIP  428



>ref|XP_003590907.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=2047

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  1     NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
             N N F G IP  IG    L  L L NN   G +P+ I N+S+L+I+TL  NHLSG  PP+
Sbjct  1090  NINEFEGQIPVEIGRLSNLTELHLSNNQLSGPLPDAIGNLSSLSIVTLYTNHLSGPFPPS  1149

Query  181   M  183
             +
Sbjct  1150  I  1150


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7     NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
             N F+G+IP+ IG+C  LQ+L L+ N FEG IP  I  +S LT + L NN LSG LP
Sbjct  1068  NTFSGSIPKEIGNCSSLQVLGLNINEFEGQIPVEIGRLSNLTELHLSNNQLSGPLP  1123



>ref|XP_008229445.1| PREDICTED: receptor-like protein kinase [Prunus mume]
Length=211

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP+ + +C +L+ L L  N F G IPE++F I AL  + L  N L+G LP ++
Sbjct  105  NNFSGKIPKELANCSLLENLDLYKNGFSGAIPESLFAIPALAYVHLYTNSLNGELPKSL  163



>ref|XP_004972644.1| PREDICTED: putative receptor-like protein kinase At3g47110-like 
[Setaria italica]
Length=1159

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NN AG IP  +G+   L  L LDNN  +G+IP T+FNIS+L  + ++ N+L+G LPPN
Sbjct  336  NNLAGAIPGALGNLKALTGLYLDNNMLQGSIPSTVFNISSLQKLDVQMNNLTGTLPPN  393



>emb|CAN72496.1| hypothetical protein VITISV_010511 [Vitis vinifera]
Length=1241

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN   G IPR IG+   L +L L +N   G IP  IFNIS+L II   NN LSG LP +
Sbjct  336  SYNKLTGGIPREIGNLSNLNILQLGSNGISGPIPAEIFNISSLQIIDFSNNSLSGSLPMD  395

Query  181  MC  186
            +C
Sbjct  396  IC  397


 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+  G+IP   G+   L+ L L  N   GT+PE IFNIS L I+ L  NHLSG LPP++
Sbjct  459  NSLVGSIPTSFGNLMALKYLDLGMNFLTGTVPEAIFNISELQILVLVQNHLSGSLPPSI  517


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP+ +     L++L    NN  G+IP TIFNIS+L  I+L NN+LSG LP +MC
Sbjct  73   NELIGEIPKKMNHLQNLKVLSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSLPKDMC  132



>ref|XP_008357586.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Malus domestica]
Length=474

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL II L +N LSG +P
Sbjct  122  NNFMGTIPSWFGSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIP  177



>ref|XP_009799275.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Nicotiana sylvestris]
Length=1045

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN  +GTIP  +G  +ML+LL L  NN EG IP+TI N+  L  + LENNHL G +P
Sbjct  174  SYNKLSGTIPPELGKLEMLELLSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIP  231



>ref|XP_002971926.1| hypothetical protein SELMODRAFT_96692 [Selaginella moellendorffii]
 gb|EFJ26843.1| hypothetical protein SELMODRAFT_96692 [Selaginella moellendorffii]
Length=1010

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N  +GTIP  +  C  +  LLL +N  EG IP  I ++S+L I+ L NNHLSG +PP++
Sbjct  504  NKLSGTIPDNLCKCSSMSKLLLGSNQLEGEIPSNIGDLSSLAILDLSNNHLSGSIPPSI  562



>emb|CDP11286.1| unnamed protein product [Coffea canephora]
Length=1096

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N+F G IP  I +   L+ + L NN+ +G IP  I NIS+L +I L NN LSG+LP +MC
Sbjct  137  NSFTGLIPSSISNLSKLEEISLSNNHLQGNIPIGILNISSLQVINLRNNGLSGVLPSDMC  196



>ref|XP_002993050.1| hypothetical protein SELMODRAFT_136413 [Selaginella moellendorffii]
 gb|EFJ05889.1| hypothetical protein SELMODRAFT_136413 [Selaginella moellendorffii]
Length=1010

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N  +GTIP  +  C  +  LLL +N  EG IP  I ++S+L I+ L NNHLSG +PP++
Sbjct  504  NKLSGTIPDNLCKCSSMSKLLLGSNQLEGEIPSNIGDLSSLAILDLSNNHLSGSIPPSI  562



>ref|XP_010529507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Tarenaya hassleriana]
Length=688

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
             YNN  G IP  +G+ DML  L +  N+  G IP+T+ +I  L  + L NN LSGI+PP 
Sbjct  172  QYNNLTGEIPSSLGNLDMLSRLDVSFNDLLGPIPKTLSDIPQLDTLDLRNNSLSGIVPPG  231

Query  181  M  183
            +
Sbjct  232  L  232



>ref|XP_003574032.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850 [Brachypodium distachyon]
Length=1077

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NN +GTIP  IG    L+LL L  N F GTIP TI N+S L I+ L +N L+G+LP
Sbjct  335  NNLSGTIPSAIGRLTNLKLLDLAENQFSGTIPRTIGNLSRLEILRLYDNKLTGLLP  390



>ref|XP_008679939.1| PREDICTED: receptor-like protein 2 [Zea mays]
 gb|AFW66474.1| hypothetical protein ZEAMMB73_123162 [Zea mays]
Length=716

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YN F G IP  +G+C  L++L    N   GT+P  IFN+++L  ++  NNHL G L P
Sbjct  212  SYNQFVGRIPSELGNCSGLKVLKAGQNQLNGTLPSEIFNVTSLEHLSFPNNHLQGTLDP  270



>gb|KHN18441.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=938

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YNNF+G +P  +G+C  L  L L +NN  G IP+ I N+++L ++ L+ N  SG++PP
Sbjct  655  SYNNFSGKVPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFSGLIPP  713



>gb|EPS65472.1| hypothetical protein M569_09303 [Genlisea aurea]
Length=749

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  G IP  IGS   L+ L L  N+F G+IP  +FN S+L  I L  N+LSG+LPP++C
Sbjct  92   NLRGYIPSEIGSLSYLRRLNLHGNHFYGSIPAQLFNASSLHTIFLYGNNLSGLLPPSLC  150



>ref|XP_003525760.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Glycine max]
 gb|KHN04759.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=683

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+NN +GTIP  IG+   LQ+L L  N  EGTIPE + ++  L +I+L++N L+G +P +
Sbjct  123  NFNNLSGTIPSDIGNMTSLQVLQLGYNQLEGTIPEELGSLKQLNVISLQHNKLTGEIPQS  182

Query  181  M  183
            +
Sbjct  183  L  183



>ref|XP_009362012.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1091

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +N+F GTIP   G    LQ   L  N F G+IP  IFN+SAL ++ L +N LSG +P
Sbjct  141  FNDFEGTIPSWFGLLSKLQTFNLYGNQFSGSIPNAIFNLSALQVLNLRSNQLSGTIP  197


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N NN +GTIP  +G+   LQ L LD +N  G IP TIFN+S +T+++L  N LSG LP +
Sbjct  283  NRNNLSGTIPYEVGNLQSLQYLSLDFSNLNGPIPSTIFNMSKMTVLSLVGNQLSGSLPAD  342

Query  181  M  183
            +
Sbjct  343  I  343



>ref|XP_004502737.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cicer arietinum]
Length=1004

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            N F+G IP  IG C  L  L L++N   G IPE IF +S LT + L+ N L+G LPP
Sbjct  423  NQFSGRIPTSIGQCKKLTSLDLESNKLVGEIPEEIFQLSGLTSLYLQGNSLNGSLPP  479



>ref|XP_009589465.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana tomentosiformis]
Length=1142

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN  +GTIP  +G  +ML++L L  NN EG IPETI N+  L  + LENNH+ G +P
Sbjct  271  SYNKLSGTIPPELGKLEMLEILSLGGNNLEGIIPETIGNLRKLQKLQLENNHIVGSIP  328



>emb|CDO96775.1| unnamed protein product [Coffea canephora]
Length=1014

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP+ IG+   L++L + NN   G IP T+FNIS+L I+ L NN LSG LP N+C
Sbjct  158  NQLQGNIPQEIGNLGNLKVLRMANNQLTGLIPLTLFNISSLQIVNLRNNTLSGDLPVNLC  217


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N FAGTIP+ IG+   L +L    N   G +P TI+NIS +T I L  N LSG LP
Sbjct  279  NKFAGTIPKEIGNLQKLNMLNFALNTLSGQVPVTIYNISTMTFIRLTGNKLSGSLP  334



>ref|XP_009382007.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Musa acuminata subsp. malaccensis]
Length=689

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N  +G IPR IG+   L  L L+ NN  G+IPE I N+  L ++ L NN LSG +PP 
Sbjct  105  HFNKISGVIPREIGNLSRLSDLYLNVNNLSGSIPEEIGNMGGLQVLQLSNNKLSGSVPPK  164

Query  181  M  183
            +
Sbjct  165  L  165



>ref|XP_009589466.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nicotiana tomentosiformis]
Length=1141

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN  +GTIP  +G  +ML++L L  NN EG IPETI N+  L  + LENNH+ G +P
Sbjct  271  SYNKLSGTIPPELGKLEMLEILSLGGNNLEGIIPETIGNLRKLQKLQLENNHIVGSIP  328



>ref|XP_006436344.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 ref|XP_006436345.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 gb|ESR49584.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 gb|ESR49585.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
Length=333

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  89   NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  147



>ref|XP_009799274.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR isoform X2 [Nicotiana sylvestris]
Length=1141

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN  +GTIP  +G  +ML+LL L  NN EG IP+TI N+  L  + LENNHL G +P
Sbjct  271  SYNKLSGTIPPELGKLEMLELLSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIP  328



>ref|XP_004957750.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Setaria italica]
Length=1264

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N FAG IP  IG C  LQ++ +  N F G+IP ++ N+S L  I    N LSG +PP +
Sbjct  455  NQFAGEIPESIGDCTSLQMIDIFGNRFNGSIPASMGNLSQLAFIDFRQNELSGSIPPEL  513



>ref|XP_003550728.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=971

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            +YNNF+G +P  +G+C  L  L L +NN  G IP+ I N+++L ++ L+ N  SG++PP
Sbjct  688  SYNNFSGKVPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFSGLIPP  746



>ref|XP_002280395.1| PREDICTED: receptor-like protein kinase 5 [Vitis vinifera]
Length=1021

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN +GTIP   G    L++L+L +N F G IPE+I N++AL  + L +N+LSGILPP+ 
Sbjct  301  NNLSGTIPEDFGRLSKLEVLVLYSNQFTGEIPESIGNLTALRDVRLFSNNLSGILPPDF  359



>ref|XP_009799273.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Nicotiana sylvestris]
Length=1142

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN  +GTIP  +G  +ML+LL L  NN EG IP+TI N+  L  + LENNHL G +P
Sbjct  271  SYNKLSGTIPPELGKLEMLELLSLGGNNLEGIIPDTIGNLRKLQKLQLENNHLVGSIP  328



>ref|XP_006436346.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 ref|XP_006436347.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 gb|ESR49586.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
 gb|ESR49587.1| hypothetical protein CICLE_v100305551mg, partial [Citrus clementina]
Length=358

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  89   NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  147



>ref|XP_007143618.1| hypothetical protein PHAVU_007G086800g [Phaseolus vulgaris]
 gb|ESW15612.1| hypothetical protein PHAVU_007G086800g [Phaseolus vulgaris]
Length=624

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N F G IP  +G    L+ L L++N+  G IP ++ NI+AL ++ L NNHLSG++P N
Sbjct  126  NRFTGPIPDSLGKLSKLRFLRLNDNSLSGPIPMSLTNITALQVLDLSNNHLSGVVPDN  183



>emb|CBI31006.3| unnamed protein product [Vitis vinifera]
Length=725

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN+F G+IP GIG+   LQ L L NN+F G IP+ +FNIS+L  + L  N+L G +P N+
Sbjct  109  YNDFTGSIPSGIGNLVELQRLSLQNNSFTGEIPQLLFNISSLRFLNLAVNNLEGEIPSNL  168



>ref|XP_009362010.1| PREDICTED: receptor-like protein kinase 2 [Pyrus x bretschneideri]
Length=738

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +N+F GTIP   G    LQ   L  N F G+IP  IFN+SAL ++ L +N LSG +P
Sbjct  141  FNDFEGTIPSWFGLLSKLQTFNLYGNQFSGSIPNAIFNLSALQVLNLRSNQLSGTIP  197



>ref|XP_003570944.2| PREDICTED: uncharacterized protein LOC100830520 [Brachypodium 
distachyon]
Length=2135

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            YN+F G+IP G+G+C ML +L   +N   GT+P+ +FN S+L  ++  +N L G+L
Sbjct  220  YNHFTGSIPPGLGNCSMLSVLKAGHNKLNGTLPDELFNASSLEYLSFPDNRLHGML  275



>emb|CDP17451.1| unnamed protein product, partial [Coffea canephora]
Length=198

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN   GTIP  IG  + L+ +++  N   G +P  IFNIS+L II L+ N LSG LP  
Sbjct  107  SYNPLRGTIPMEIGYLNKLKNIVMYYNQLSGPLPLEIFNISSLEIIALKGNSLSGSLPVE  166

Query  181  MC  186
            +C
Sbjct  167  IC  168



>ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis]
 gb|EEF32790.1| receptor-kinase, putative [Ricinus communis]
Length=1028

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G IP  IG    LQ   L  +NF G IP +IFN+S+LTI+++  N L G LPP++
Sbjct  206  NNFHGEIPNSIGQLKSLQTFSLGGSNFSGVIPPSIFNLSSLTILSVPINQLHGNLPPDL  264



>ref|XP_007214468.1| hypothetical protein PRUPE_ppa023770mg, partial [Prunus persica]
 gb|EMJ15667.1| hypothetical protein PRUPE_ppa023770mg, partial [Prunus persica]
Length=300

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            YNNF G+IP   GS   LQ   L  NNF G+IP TIFN+S L +I L  N LSG
Sbjct  137  YNNFTGSIPSWFGSFPKLQSFYLYGNNFSGSIPATIFNLSTLQVIDLSINQLSG  190



>emb|CDP11283.1| unnamed protein product [Coffea canephora]
Length=1027

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N+F G IP  I +   L+ + L  N  +G IP  IFNIS+L +I+L  N LSG+LP +MC
Sbjct  156  NSFTGLIPSSISNLSKLESISLSFNRLQGNIPIGIFNISSLQMISLTGNGLSGVLPSDMC  215



>ref|XP_004138361.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cucumis 
sativus]
 gb|KGN45898.1| hypothetical protein Csa_6G020120 [Cucumis sativus]
Length=627

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N F+G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NNHLSG++P N
Sbjct  129  NRFSGPIPDTLGKLSKLRFLRLNNNSLAGPIPMSLTNISSLQVLDLSNNHLSGVVPDN  186



>ref|XP_002311065.2| hypothetical protein POPTR_0008s03370g [Populus trichocarpa]
 gb|EEE88432.2| hypothetical protein POPTR_0008s03370g [Populus trichocarpa]
Length=1027

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN  +G IPR +GSC  L+ L L +N+F G+IPE++ ++ AL ++ L  N+L+G +P +
Sbjct  518  SYNRLSGEIPRTLGSCVSLEYLYLADNSFHGSIPESLSSLRALQVLYLSRNNLTGKIPKS  577

Query  181  M  183
            +
Sbjct  578  L  578



>gb|ABO14173.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum]
Length=629

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NNF G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NN LSG++P N
Sbjct  131  NNFVGPIPDSLGKLSKLRFLRLNNNSLTGNIPMSLTNISSLQVLDLSNNRLSGVVPDN  188



>ref|XP_002310619.1| brassinosteroid insensitive 1 precursor family protein [Populus 
trichocarpa]
 gb|EEE91069.1| brassinosteroid insensitive 1 precursor family protein [Populus 
trichocarpa]
Length=1193

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN  +G+IP  IGS   L +L+L +NNF G IP+ I  ++ L I+ L NN L GI+PP+
Sbjct  662  SYNMLSGSIPAAIGSMSYLYVLILGHNNFSGNIPQEIGKLTGLDILDLSNNRLEGIIPPS  721

Query  181  M  183
            M
Sbjct  722  M  722



>ref|XP_008225251.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=930

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGI  168
            YNNF G+IP   GS   LQ   L  N F G IP TIFN+S L II L NN LS I
Sbjct  152  YNNFMGSIPSWFGSFPKLQSFYLYGNQFSGFIPSTIFNLSTLQIIYLNNNQLSEI  206


 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NN    IP  IGS D L +L +  N  +G +P T+FN+S+L I+ L  N+LSG LP N+C
Sbjct  200  NNQLSEIPNEIGSLDQLGMLTVQMNALKGHVPVTVFNLSSLIILNLYGNNLSGGLPDNIC  259



>emb|CDP20522.1| unnamed protein product [Coffea canephora]
Length=334

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N F G IP GIG C  LQ+L L +N F G IP  ++N++ L  + L +N L+G LP +
Sbjct  255  SWNYFEGEIPSGIGECSGLQILSLSHNKFRGYIPNGVWNLTTLITLYLGDNDLTGKLPTS  314

Query  181  MC  186
            +C
Sbjct  315  LC  316



>ref|XP_008358702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=223

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGI  168
            ++ NFAG IP   GS   LQ   L  N F G+IP  IFN+SAL ++ L NN LS I
Sbjct  138  SFXNFAGXIPSWFGSLSELQTFDLYGNQFSGSIPNDIFNLSALQVLDLRNNQLSVI  193



>ref|XP_010655821.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=611

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YN+F G+IP GIG+   LQ L L NN+F G IP+ +FNIS+L  + L  N+L G +P N+
Sbjct  248  YNDFTGSIPSGIGNLVELQRLSLQNNSFTGEIPQLLFNISSLRFLNLAVNNLEGEIPSNL  307



>ref|XP_008346278.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=1018

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            YNNF G+IP+ +G+   L  + L NNN  G+IP  I N+SAL II L NN LSG +P
Sbjct  372  YNNFRGSIPKSLGNLTYLTEIYLHNNNLTGSIPREIGNLSALEIIGLSNNQLSGSIP  428



>ref|XP_008804489.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X1 
[Phoenix dactylifera]
Length=627

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN +GTIP  +GS   L  L L  NNF G IP+++ N+S L  + L NN LSG +PP++
Sbjct  105  NNISGTIPTELGSLTNLVSLDLYLNNFTGGIPDSLGNLSKLRFLRLNNNSLSGQIPPSL  163



>ref|XP_009333988.1| PREDICTED: receptor-like protein kinase [Pyrus x bretschneideri]
Length=1061

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP G+ +C +L+ L L  N F G IPE +F+IS+L  I L  N L+G +P N+
Sbjct  104  NNFSGKIPTGLANCTLLEYLNLSVNRFSGEIPEPLFSISSLVHIDLYENSLNGSIPANV  162



>ref|NP_001275293.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum]
 gb|ABO14172.1| somatic embryogenesis receptor-like kinase 1 [Solanum tuberosum]
Length=629

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NNF G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NN LSG++P N
Sbjct  131  NNFVGPIPDSLGKLSKLRFLRLNNNSLTGNIPMSLTNISSLQVLDLSNNRLSGVVPDN  188



>emb|CAN81714.1| hypothetical protein VITISV_005816 [Vitis vinifera]
Length=1420

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN AG IPR IG+   L  L L +    G IP  IFNIS+L +I L +N L G LP ++
Sbjct  296  YNNLAGGIPREIGNLSNLNSLQLGSCGISGPIPPEIFNISSLQMIDLTDNSLHGSLPMDI  355

Query  184  C  186
            C
Sbjct  356  C  356


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F G+IPR IG+   LQ L L NN+  G IP+++F IS+L  + L  N+L GILP  
Sbjct  174  SYNEFTGSIPRAIGNLVELQSLSLXNNSLTGEIPQSLFKISSLRFLRLGENNLVGILPTG  233

Query  181  M  183
            M
Sbjct  234  M  234



>ref|XP_010657057.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Vitis vinifera]
Length=1213

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN  G IP  IG+   L +L  ++    G IP  IFNIS+L +I   NN LSG LP ++
Sbjct  275  YNNLGGGIPSEIGNLHNLNILNFESARLSGPIPAQIFNISSLQVIAFSNNSLSGSLPIDI  334

Query  184  C  186
            C
Sbjct  335  C  335



>ref|XP_010657056.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Vitis vinifera]
Length=1286

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN  G IP  IG+   L +L  ++    G IP  IFNIS+L +I   NN LSG LP ++
Sbjct  348  YNNLGGGIPSEIGNLHNLNILNFESARLSGPIPAQIFNISSLQVIAFSNNSLSGSLPIDI  407

Query  184  C  186
            C
Sbjct  408  C  408


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F G+IP+GIG+   LQ L   NNN  G IP+++FNIS+L  + L  N L G +P N
Sbjct  251  SYNEFTGSIPKGIGNLVELQRLSFRNNNLIGEIPQSLFNISSLRFLNLAANQLEGEIPSN  310

Query  181  M  183
            +
Sbjct  311  L  311



>ref|XP_009376752.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Pyrus x bretschneideri]
Length=1114

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL II L +N LSG +P
Sbjct  132  NNFMGTIPSWFGSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIP  187


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP+ +G+   L  + L +NN EGTIP+ I N+  L I+ L  N+L+G++PP +
Sbjct  299  YNNFRGSIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKL  358



>ref|XP_008380264.1| PREDICTED: receptor-like protein kinase [Malus domestica]
Length=1061

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP G+ +C +L+ L L  N F G IPE +F+IS L  I L  N L+G +P N+
Sbjct  104  NNFSGKIPTGLANCTLLEYLDLSVNGFSGEIPEPLFSISGLVYIYLYENSLNGSIPANV  162



>gb|EMT20015.1| Tyrosine-sulfated glycopeptide receptor 1 [Aegilops tauschii]
Length=1050

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +N F+G+IP+G+G C  L+ L    NN  GT+P+ +FN ++L  ++  NN L G+L
Sbjct  212  FNRFSGSIPQGLGGCSKLRELRAGYNNLSGTVPDEVFNATSLEYLSFSNNDLHGVL  267



>ref|XP_009376753.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X3 [Pyrus x bretschneideri]
Length=1099

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL II L +N LSG +P
Sbjct  117  NNFMGTIPSWFGSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIP  172


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP+ +G+   L  + L +NN EGTIP+ I N+  L I+ L  N+L+G++PP +
Sbjct  284  YNNFRGSIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKL  343



>ref|XP_009376751.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Pyrus x bretschneideri]
Length=1134

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L  N F G IP  IFN+SAL II L +N LSG +P
Sbjct  152  NNFMGTIPSWFGSFPKLQTFKLLGNGFSGFIPAAIFNLSALEIIDLSSNQLSGSIP  207


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP+ +G+   L  + L +NN EGTIP+ I N+  L I+ L  N+L+G++PP +
Sbjct  319  YNNFRGSIPKSLGNLTYLSRIYLYHNNLEGTIPDEISNLPQLEILGLMINNLNGVIPPKL  378



>ref|XP_004971665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1030

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N  +GTIP  IG C +LQ L LDNN+FEG+IP ++ N+  LT + L  N LSGI+P
Sbjct  517  NQLSGTIPDSIGECTVLQSLWLDNNSFEGSIPPSVRNLKGLTTLDLSMNKLSGIIP  572



>ref|XP_007217286.1| hypothetical protein PRUPE_ppa017871mg [Prunus persica]
 gb|EMJ18485.1| hypothetical protein PRUPE_ppa017871mg [Prunus persica]
Length=1086

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN F+G IP G+G+C  L       +N EGTIP +   +  L+ + L  NHLSG +PP 
Sbjct  247  SYNKFSGGIPPGLGNCSNLTQFSAVGSNLEGTIPSSFGQLKYLSTLYLPLNHLSGKIPPE  306

Query  181  M  183
            +
Sbjct  307  L  307


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+G IP+ + +C +L+ L L  N F G IPE++F I AL  + L  N+L+G +P N+
Sbjct  105  NNFSGKIPKELANCSLLENLDLYKNGFSGAIPESLFAIPALAYVHLYTNNLNGSIPGNV  163



>ref|XP_011078428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1153

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            YNN  GTIP+ IG+   LQ+L L  NN  G+IP  IFNIS L  IT+  N LSG LP N
Sbjct  398  YNNLIGTIPKEIGNLQSLQVLYLGVNNLRGSIPTEIFNISTLQSITVLMNQLSGQLPSN  456


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN+  G IP  IG+   L+ L L  N F+G IP TIFNIS+L  + L  N LSG L  +
Sbjct  155  SYNSLQGKIPDEIGNLHNLKRLSLQFNKFDGLIPTTIFNISSLESLALTGNSLSGDLQGD  214

Query  181  MC  186
            +C
Sbjct  215  LC  216



>ref|XP_008236450.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=970

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            F+G+IP+ IG+  M+++L L  N   GTIP +IFNIS +  ++L  N LSG LP N+
Sbjct  231  FSGSIPKSIGNLTMMKILSLSKNTLTGTIPWSIFNISTIEELSLSLNQLSGSLPANL  287



>ref|XP_011091710.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1217

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N   G IP  IG+   LQLL ++ N F G+IP +IFNIS+L ++ L  + LSG LP NMC
Sbjct  303  NYLTGEIPEEIGNLRRLQLLSMELNIFSGSIPLSIFNISSLVLLDLARSGLSGTLPSNMC  362



>ref|XP_009799747.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nicotiana sylvestris]
Length=1219

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NN  G IPR IGS   L+ L L  N   G+IPE +FNIS LT ++L  N++ G++P
Sbjct  395  NNIGGVIPREIGSLHKLETLYLQFNKLSGSIPEELFNISTLTRVSLSRNNIGGVIP  450



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+  G IP  IG+C  L  L L +NN  G IPETI N+++L I+ L  N L+G+LP  +
Sbjct  467  NSLTGNIPAQIGNCSALASLDLSHNNLTGAIPETIANLTSLEIVDLSRNRLTGVLPKQL  525



>ref|XP_007158089.1| hypothetical protein PHAVU_002G123200g [Phaseolus vulgaris]
 gb|ESW30083.1| hypothetical protein PHAVU_002G123200g [Phaseolus vulgaris]
Length=1021

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G IP+ I     L       N F GT+P  ++N+S+LT+I++  N L+G LPPNM
Sbjct  209  NNFEGHIPQEICRLKNLTFAAFGVNKFTGTLPSCLYNMSSLTMISVTENQLTGHLPPNM  267



>ref|XP_006436350.1| hypothetical protein CICLE_v10033735mg [Citrus clementina]
 gb|ESR49590.1| hypothetical protein CICLE_v10033735mg [Citrus clementina]
Length=509

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN S+L  I   NN L G LPPN C
Sbjct  86   NLTGTIPSELGNLSSLQTLDLSFNRFSGSIPASIFNTSSLLSINFRNNTLFGELPPNFC  144



>emb|CDP18612.1| unnamed protein product [Coffea canephora]
Length=593

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF GTIP  IG+C  L  L L  N   G IP  + NIS L  + L +N LSG +PP++
Sbjct  107  NNFYGTIPSDIGNCTYLGSLFLQGNYLSGLIPSELGNISELENLDLSSNSLSGSIPPSL  165



>ref|XP_008346977.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=289

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +N+F GTIP   G    LQ   L  N F G IP  IFN+SAL ++ L +N LSG +P
Sbjct  141  FNDFEGTIPSWFGLLSKLQTFNLYGNQFSGPIPNAIFNLSALQVLNLRSNQLSGTIP  197



>ref|XP_004296173.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Fragaria 
vesca subsp. vesca]
Length=335

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSG  165
            ++NNF G+IPRG+G C  LQ+     N   G +P+ I+N SAL  I+L  N  SG
Sbjct  55   SFNNFNGSIPRGLGKCSKLQVFRASYNYLSGLLPDDIYNDSALEEISLARNSFSG  109



>gb|EYU38400.1| hypothetical protein MIMGU_mgv1a023263mg [Erythranthe guttata]
Length=675

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
              G IP  IG+   L  L +  N F G IP +IFN+S L +I L NN LSG LP +MC
Sbjct  68   LVGPIPPQIGNLSFLVSLNMSENLFHGPIPLSIFNMSRLQVIALRNNSLSGSLPKDMC  125



>ref|XP_003563067.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Brachypodium distachyon]
Length=1264

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G IP  IG C  LQ++    N   G+IP +I N+S LT + L  N LSG +PP +
Sbjct  457  NQFTGEIPESIGECSTLQMMDFFGNQLNGSIPASIGNLSRLTFLHLRQNELSGEIPPEL  515



>ref|XP_008385922.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Malus domestica]
Length=973

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNNF G+IP  +G    +Q L    NN  GTIP +I+NIS++ ++ +  N L G LPPN+
Sbjct  214  YNNFQGSIPNELGRLTRMQKLSFIGNNLSGTIPASIYNISSIYLLIVGQNQLHGELPPNV  273



>ref|XP_006494760.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Citrus sinensis]
Length=1211

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>ref|XP_006436339.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49579.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1365

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>gb|EYU40635.1| hypothetical protein MIMGU_mgv1a026366mg [Erythranthe guttata]
Length=858

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N+F G IP+  G    LQ   ++NN   GTIP  IFN+S+L +I L  N LSG LP  MC
Sbjct  71   NSFQGNIPKEFGKLQSLQAFGMENNRLSGTIPLAIFNLSSLEVIALTGNELSGGLPSYMC  130



>ref|XP_011078429.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1216

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            YNN  GTIP+ IG+   L++L L  NN  GTIP  IFNIS L  I++  N LSG LP N
Sbjct  420  YNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSN  478



>ref|XP_006436327.1| hypothetical protein CICLE_v10030536mg [Citrus clementina]
 gb|ESR49567.1| hypothetical protein CICLE_v10030536mg [Citrus clementina]
Length=1231

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  85   NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  143



>sp|Q8LPB4.1|PSKR1_DAUCA RecName: Full=Phytosulfokine receptor 1; Short=DcPSKR1; AltName: 
Full=Phytosulfokine LRR receptor kinase 1; Flags: Precursor 
[Daucus carota]
 dbj|BAC00995.1| phytosulfokine receptor [Daucus carota]
Length=1021

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G+IP GIG+C  ++ L L +NN  G+IP+ +F +S L+++ L+NN LSG L   +
Sbjct  192  NYFDGSIPVGIGNCSSVEYLGLASNNLSGSIPQELFQLSNLSVLALQNNRLSGALSSKL  250



>ref|XP_006367143.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=837

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F G IP+ I +   L++L L  N+F G++P  IFNI ALTII L  N+LSG LPPN+
Sbjct  583  NRFTGEIPKEIRNLVELEVLHLAFNSFSGSLPMLIFNILALTIIDLSFNNLSGTLPPNI  641



>gb|EYU38097.1| hypothetical protein MIMGU_mgv1a019608mg, partial [Erythranthe 
guttata]
Length=571

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
              GTIP  IG+   L  L +  N F G IP +IFN+S L  I+L+NN LSG LP ++C
Sbjct  83   LVGTIPTEIGNLSSLVSLDMSGNLFHGHIPRSIFNMSRLETISLQNNSLSGNLPVDIC  140



>gb|KCW63152.1| hypothetical protein EUGRSUZ_G00765 [Eucalyptus grandis]
Length=874

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF GTIP  +G    L++L+L  N F GTIP +IFNISAL ++ +  N L G LP ++
Sbjct  57   NNFGGTIPETLGQLRNLKMLVLTANKFVGTIPISIFNISALALLDVAENQLEGGLPGDL  115



>ref|XP_011078427.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=1021

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            YNN  GTIP+ IG+   L++L L  NN  GTIP  IFNIS L  I++  N LSG LP N
Sbjct  398  YNNLIGTIPKEIGNLQSLEVLYLGVNNLMGTIPTEIFNISTLQSISVSMNQLSGQLPSN  456


 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN+  G IP  IG+   L+ L L  N F+G IP TIFNIS+L  + L  N LSG L  +
Sbjct  155  SYNSLQGKIPDEIGNLHNLKRLSLQFNKFDGLIPTTIFNISSLESLALTGNSLSGDLQGD  214

Query  181  MC  186
            +C
Sbjct  215  LC  216



>ref|XP_006436338.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49578.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1028

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>emb|CAC20842.1| receptor protein kinase [Pinus sylvestris]
Length=1145

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN  G IP  +GSCD LQ L L +N   G+IP ++F I  LT + L +N L+G LPP +
Sbjct  423  NNLEGPIPSSLGSCDNLQSLDLSHNRLTGSIPPSLFEIKNLTKLLLLSNELTGALPPEI  481



>ref|XP_010068229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
Length=1039

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF GTIP  +G    L++L+L  N F GTIP +IFNISAL ++ +  N L G LP ++
Sbjct  222  NNFGGTIPETLGQLRNLKMLVLTANKFVGTIPISIFNISALALLDVAENQLEGGLPGDL  280



>ref|XP_008804490.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X2 
[Phoenix dactylifera]
Length=610

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN +GTIP  +GS   L  L L  NNF G IP+++ N+S L  + L NN LSG +PP++
Sbjct  88   NNISGTIPTELGSLTNLVSLDLYLNNFTGGIPDSLGNLSKLRFLRLNNNSLSGQIPPSL  146



>ref|XP_006436337.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49577.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1028

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>ref|XP_009376795.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Pyrus 
x bretschneideri]
Length=1093

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ   L +N F G IP  IFN+SAL II + +N LSG +P
Sbjct  132  NNFMGTIPSWFGSFPKLQTFKLLDNGFSGFIPAAIFNLSALKIIDMSSNQLSGSIP  187



>ref|XP_006436336.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49576.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1137

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>ref|XP_006436335.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
 gb|ESR49575.1| hypothetical protein CICLE_v10030526mg [Citrus clementina]
Length=1137

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            N  GTIP  +G+   LQ L L  N F G+IP +IFN+S+L  I   NN L G LPPN C
Sbjct  110  NLTGTIPSELGNLSSLQTLDLSFNWFSGSIPASIFNMSSLLSIRFTNNTLFGELPPNFC  168



>ref|XP_002270847.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Vitis vinifera]
 emb|CBI35327.3| unnamed protein product [Vitis vinifera]
Length=624

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+F G IP  +G    L+ L L+NN+  GTIP ++ NI+AL ++ L NN LSG++P N
Sbjct  126  NSFTGPIPETLGKLSKLRFLRLNNNSLTGTIPMSLTNITALQVLDLSNNRLSGVVPDN  183



>gb|KEH19907.1| LRR receptor-like kinase family protein, partial [Medicago truncatula]
Length=790

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            F+GTIP  IG  D L++L L NN+  G+IP  IFN+S+LT + ++ N LSG LP N
Sbjct  10   FSGTIPEEIGYLDKLEVLYLYNNSLSGSIPSKIFNLSSLTHLGVDQNSLSGTLPSN  65



>ref|XP_010227389.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Brachypodium 
distachyon]
Length=1062

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            YN F+G I +G+GSC ML++L   +NN  G +P+ +FN ++L  ++L NN L G+L
Sbjct  217  YNKFSGNISQGLGSCSMLRVLKAGHNNLSGVLPDELFNATSLEQLSLPNNVLQGVL  272



>ref|XP_007052241.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
 gb|EOX96398.1| Leucine-rich repeat receptor-like protein kinase family protein, 
putative [Theobroma cacao]
Length=1021

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N   G+IP  IG    L++L L +N  EG +PE I N+ ALT++ L  N LSG +PP 
Sbjct  381  DFNRINGSIPSKIGDLKTLRVLRLHSNFLEGLVPEEIGNLKALTLLNLYENELSGPIPPQ  440

Query  181  MC  186
            +C
Sbjct  441  IC  442



>ref|XP_011099195.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1210

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            ++N F+G+IP+GIG   ML+ L L  NNF+G IP+ I N+S L I ++  + L+G LP
Sbjct  275  SFNQFSGSIPKGIGELTMLKNLYLGANNFQGAIPQEIGNLSNLEIFSMRRSSLTGKLP  332


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF G IP+ IG+   L++  +  ++  G +P  +FNIS+L  I L  N LSG LPP++
Sbjct  301  NNFQGAIPQEIGNLSNLEIFSMRRSSLTGKLPSFVFNISSLKQIDLSYNRLSGSLPPDI  359



>ref|XP_008464349.1| PREDICTED: somatic embryogenesis receptor kinase 2 isoform X1 
[Cucumis melo]
Length=627

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N F+G IP  +G    L+ L L+NN+  G IP ++ NIS+L ++ L NNHLSG++P N
Sbjct  129  NRFSGPIPDTLGKLSKLRFLRLNNNSLAGPIPMSLTNISSLQVLDLSNNHLSGMVPDN  186



>ref|XP_006398111.1| hypothetical protein EUTSA_v10001203mg [Eutrema salsugineum]
 gb|ESQ39564.1| hypothetical protein EUTSA_v10001203mg [Eutrema salsugineum]
Length=1012

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N+F GTIP  +G C  L  L++++N F GTIP  +  IS L ++T+ NN L+G LP
Sbjct  445  NSFEGTIPPSLGKCSHLLHLVIEDNKFSGTIPREVMQISTLVLLTMSNNLLTGSLP  500



>ref|XP_010261130.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Nelumbo 
nucifera]
Length=627

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            NNF+G IP  +G    L+ L L+NN+  G IP ++ N+SAL ++ L NNHL G +P N
Sbjct  129  NNFSGPIPDSLGKLTKLRFLRLNNNSLSGQIPMSLTNVSALQVLDLSNNHLEGPVPDN  186



>emb|CDP10897.1| unnamed protein product [Coffea canephora]
Length=1138

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            ++N+F G+IP  IG  + L LL L +N F GTIP++I N++ L  + L  N LSG++PP 
Sbjct  870  SWNSFEGSIPETIGELNALYLLNLSHNAFTGTIPKSIGNLTQLESLDLSKNRLSGMIPPQ  929

Query  181  MC  186
            + 
Sbjct  930  LA  931



>gb|KDO40017.1| hypothetical protein CISIN_1g0405402mg, partial [Citrus sinensis]
Length=443

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +1

Query  10   NFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N  G IP  IGS   L+ L L +N   G IP TIFNIS + I+TLE+N LSG LP
Sbjct  182  NLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLP  236



>ref|XP_002464503.1| hypothetical protein SORBIDRAFT_01g019670 [Sorghum bicolor]
 gb|EER91501.1| hypothetical protein SORBIDRAFT_01g019670 [Sorghum bicolor]
Length=985

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NN +G+IP+GIG  ++L+ L L  N   G IP++I N+S L+ + L NNHL G +P
Sbjct  828  NNLSGSIPQGIGRLNLLESLDLSWNELSGAIPQSISNLSCLSTLNLSNNHLWGEIP  883



>ref|XP_010039500.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=990

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+GTIP  +G    L++L L  + F GTIP +IFNISAL  + +  N L G LP ++
Sbjct  186  NNFSGTIPETLGQLRNLKILTLATSKFFGTIPISIFNISALAWLDVSGNQLEGGLPSDL  244



>ref|XP_004295582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Fragaria vesca subsp. vesca]
Length=1092

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN+  GTIP  IG    L++L L  NN  G IP +IFN+S +T+I+L NN LSG  P N
Sbjct  300  SYNSLTGTIPDEIGHLPNLEVLSLGINNLNGIIPSSIFNMSTITVISLPNNQLSGTFPAN  359

Query  181  M  183
            +
Sbjct  360  I  360



>gb|KCW45912.1| hypothetical protein EUGRSUZ_L00172, partial [Eucalyptus grandis]
Length=965

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF+GTIP  +G    L++L L  + F GTIP +IFNISAL  + +  N L G LP ++
Sbjct  198  NNFSGTIPETLGQLRNLKILTLATSKFFGTIPISIFNISALAWLDVSGNQLEGGLPSDL  256



>emb|CDP18731.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            +YN   GTIP  IG   MLQ L L +N   G IPETI N+ +L  I L +N L G+LP
Sbjct  225  SYNKLTGTIPSTIGQLGMLQKLDLSSNKLTGRIPETIGNLHSLVFIALSSNELKGLLP  282



>ref|XP_009339531.1| PREDICTED: receptor-like protein kinase [Pyrus x bretschneideri]
Length=1061

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+F+G IP G+ +C +L+ L L  N F G IPE +F+IS+L  I L  N L+G +P N+
Sbjct  106  NSFSGKIPVGLANCSLLEYLDLSENRFSGEIPEPLFSISSLVYIYLYRNSLNGSIPANV  164



>gb|KDO65860.1| hypothetical protein CISIN_1g0394191mg, partial [Citrus sinensis]
Length=332

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
             NNF G IP  IG+C  L+ + L  N F G++P++  N+S+L  + L NN++SG +PP
Sbjct  256  QNNFDGAIPEEIGNCKSLKTIDLSLNFFSGSLPQSFGNLSSLEELMLSNNNISGSIPP  313



>ref|XP_009113892.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brassica rapa]
Length=1030

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            + N+F GTIP  +G+C  +  L +D+N   GTIP  I  IS L  +T+ NN+L+G LP +
Sbjct  462  DKNSFEGTIPPSLGNCSYMLRLRMDHNTLTGTIPREIMQISPLVFLTMSNNYLTGSLPKD  521

Query  181  M  183
            +
Sbjct  522  V  522



>emb|CDO96774.1| unnamed protein product [Coffea canephora]
Length=864

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +1

Query  7    NNFA-GTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF  G IPR IG+   L++L + NN   G IP T+FNIS+L I+ L NN L+G LP N+
Sbjct  132  NNFVQGNIPREIGNLGNLKILRMANNQLTGFIPLTLFNISSLQIVNLTNNTLTGDLPVNL  191

Query  184  C  186
            C
Sbjct  192  C  192



>gb|KEH33634.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=915

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN  G IP  IG+ + +Q+L + NN+  G +P  +FNIS L  + LE N LSG+LPPNM
Sbjct  134  NNLEGLIPMEIGNLNQIQVLQMGNNSLSGHVPSKLFNISTLEHLHLELNSLSGMLPPNM  192



>ref|XP_009415698.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Musa acuminata subsp. malaccensis]
Length=1096

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPP  177
            N NN  G IPR IG C  LQL+ L +N  EG IP  + ++S L +++L NN L G +PP
Sbjct  171  NGNNLHGAIPRSIGRCSQLQLIGLTDNMLEGGIPSQLGSLSKLKVLSLWNNSLGGRIPP  229



>ref|XP_009409686.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Musa 
acuminata subsp. malaccensis]
Length=1675

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +N+F GT+P  IG+   L  L +  NN  G IP +I+N+S+L  + LENN+ +G +PP+M
Sbjct  863  FNDFVGTVPAAIGNLTSLTYLGVSFNNLGGVIPPSIWNLSSLRTLELENNNFTGSIPPDM  922



>emb|CDP21744.1| unnamed protein product [Coffea canephora]
Length=337

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
             +N+  G IP  IG+ + L+ ++LD N   G +P  +FNIS+L +I L+NN LSG LP +
Sbjct  179  QFNSLQGAIPMEIGNLNKLKQIVLDFNQLSGFLPLGMFNISSLEVIALQNNSLSGSLPSS  238

Query  181  MC  186
            +C
Sbjct  239  IC  240



>ref|XP_010039622.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Eucalyptus grandis]
 gb|KCW45843.1| hypothetical protein EUGRSUZ_L00303 [Eucalyptus grandis]
Length=1026

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NNF GTIP+ +G    L++L L  N F GTIP +IFNISAL ++ +  N L G LP ++
Sbjct  209  NNFDGTIPKTLGQLRNLKMLTLALNKFVGTIPISIFNISALVLLDVGGNQLEGGLPGDL  267



>ref|XP_008677920.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Zea mays]
 gb|AFW60254.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1043

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            +NNF+G IP+ +G    L  L +  N  EG I  T+FNIS+L  + L  N LSG LPPN+
Sbjct  212  WNNFSGQIPQALGKLPNLARLTMQGNQLEGLISPTLFNISSLENLNLGYNKLSGSLPPNI  271



>emb|CDP17630.1| unnamed protein product [Coffea canephora]
Length=1622

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  13   FAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            + G+IP  +G+   L+ L L  N+  G++P  IFNIS L  + L  NHLSGILP NMC
Sbjct  771  WTGSIPNEVGNLLKLESLDLVENSLSGSLPVEIFNISTLRELYLAANHLSGILPSNMC  828



>gb|AES95343.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1047

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN  G IPR I     L ++ + +N   GT P  ++N+S+LT+I+  +NH SG LP NM
Sbjct  219  YNNLEGDIPREICRLKNLIIITVTDNKLSGTFPPCLYNMSSLTLISTADNHFSGSLPSNM  278



>ref|XP_009373071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1102

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            NNF GTIP   GS   LQ + L  N F G IP  IFN+SAL  I L+ N LSG +P
Sbjct  117  NNFMGTIPSWFGSFAKLQAIKLYGNGFSGFIPAAIFNLSALETINLKRNQLSGSIP  172



>emb|CDY67983.1| BnaA09g53520D [Brassica napus]
Length=942

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            + N+F GTIP  +G+C  +  L +D+N   GTIP  I  IS L  +T+ NN+L+G LP +
Sbjct  418  DKNSFEGTIPPSLGNCSYMLRLRMDHNTLTGTIPREIMQISPLVFLTMSNNYLTGSLPKD  477

Query  181  M  183
            +
Sbjct  478  V  478



>ref|XP_010243324.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
 ref|XP_010243325.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
 ref|XP_010243326.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=1153

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            NN +G IP  I  C  L  LLL+ N   G+IP+++ N+S L  ++L  NHL+GI+P N+
Sbjct  654  NNLSGEIPEEISKCSSLTSLLLNENKLTGSIPDSLSNLSNLNALSLSMNHLTGIIPANL  712



>gb|EEE56325.1| hypothetical protein OsJ_05424 [Oryza sativa Japonica Group]
Length=703

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +YN F+G+IP GIG C  L++L +  NN  GT+P+ +F  ++L  ++  NNHL GI+
Sbjct  213  SYNQFSGSIPPGIGKCSSLRMLRVGQNNIIGTLPDDLFRATSLEYLSFPNNHLQGII  269



>ref|XP_003612385.1| Receptor kinase-like protein [Medicago truncatula]
Length=1032

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  4    YNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            YNN  G IPR I     L ++ + +N   GT P  ++N+S+LT+I+  +NH SG LP NM
Sbjct  219  YNNLEGDIPREICRLKNLIIITVTDNKLSGTFPPCLYNMSSLTLISTADNHFSGSLPSNM  278



>ref|XP_002532618.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF29784.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=383

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N   G IP+ IG+ + L++L L+ NNF G+IP  IFNIS+L +I L +N LSG +P
Sbjct  181  NKLQGYIPKAIGNLNSLRILSLEKNNFSGSIPSGIFNISSLQVIDLSDNRLSGSMP  236



>ref|XP_009115860.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brassica rapa]
Length=1029

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+  G IP  IG  + +  L L  N F G +P  I+N+S+L ++T+  NHLSG L P+
Sbjct  197  NSLEGEIPGDIGRLNQVVELYLAVNKFSGVLPSAIYNLSSLKLLTIRENHLSGFLRPD  254



>ref|XP_007213717.1| hypothetical protein PRUPE_ppa000550mg [Prunus persica]
 gb|EMJ14916.1| hypothetical protein PRUPE_ppa000550mg [Prunus persica]
Length=1101

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N+ +G IP GIG C  L++L L  N  EG++P  +  +  LT + L  NHLSG++PP +
Sbjct  201  NSLSGPIPTGIGECQSLEVLGLSQNQLEGSLPRELHKLQNLTDLILWQNHLSGLIPPEI  259



>gb|EAY84530.1| hypothetical protein OsI_05903 [Oryza sativa Indica Group]
Length=721

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGIL  171
            +YN F+G+IP GIG C  L++L +  NN  GT+P+ +F  ++L  ++  NNHL GI+
Sbjct  213  SYNQFSGSIPPGIGKCSSLRMLRVGQNNIIGTLPDDLFRATSLEYLSFPNNHLQGII  269



>ref|XP_011091709.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Sesamum indicum]
Length=1195

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNMC  186
            NN  G +P  IG+   LQ L +  N F G+IP +IFNIS+L ++ L  + LSG LP +MC
Sbjct  285  NNLTGDVPEEIGNLRRLQQLGMGKNIFSGSIPLSIFNISSLVLLNLAWSGLSGTLPSHMC  344



>ref|XP_009363421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009363423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X1 [Pyrus x bretschneideri]
Length=1028

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            N+F GTIP   GS   LQ   L +N F G+IP  IFN+SAL II L  N LSG +P
Sbjct  49   NSFMGTIPSWFGSFPKLQTFTLADNGFSGSIPVAIFNLSALKIIILSGNQLSGSIP  104



>emb|CDP16388.1| unnamed protein product [Coffea canephora]
Length=394

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            +YN  +G+IP   G+   L++L +D N+  G+IP  IFNIS L I  L  N LSG LPP+
Sbjct  182  SYNKLSGSIPEEFGNLKYLEVLNMDFNSLTGSIPAQIFNISTLQIWGLGGNKLSGRLPPS  241

Query  181  M  183
            M
Sbjct  242  M  242



>emb|CDX78030.1| BnaA09g32250D [Brassica napus]
Length=1006

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPN  180
            N+  G IP  IG  + +  L L  N F G +P  I+N+S+L ++T+  NHLSG L P+
Sbjct  197  NSLEGEIPGDIGRLNQVVELYLAVNKFSGVLPSAIYNLSSLKLLTIRENHLSGFLRPD  254



>ref|XP_002867439.1| hypothetical protein ARALYDRAFT_328832 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43698.1| hypothetical protein ARALYDRAFT_328832 [Arabidopsis lyrata subsp. 
lyrata]
Length=1015

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N   GTIP GI SC+ L  L L NNN  G IP  I  +SAL ++ L NN L+G+LP ++
Sbjct  512  NTLTGTIPSGIASCEKLVSLNLRNNNLTGEIPRQITTMSALAVLDLSNNSLTGVLPESI  570



>ref|XP_010050145.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1290

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    NYNNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILP  174
            ++N+F G+IPR IGS   LQ+L +  NN  GTIP TI N+S+L  + + NNH+ G +P
Sbjct  274  SFNSFQGSIPRDIGSFQKLQMLYIAVNNLTGTIPRTIGNMSSLQWLDIGNNHIQGEIP  331



>ref|NP_001045681.1| Os02g0116700 [Oryza sativa Japonica Group]
 dbj|BAD07721.1| putative Phytosulfokine receptor precursor [Oryza sativa Japonica 
Group]
 dbj|BAF07595.1| Os02g0116700 [Oryza sativa Japonica Group]
Length=1060

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +1

Query  7    NNFAGTIPRGIGSCDMlqlllldnnnFEGTIPETIFNISALTIITLENNHLSGILPPNM  183
            N F+G  P G G C  L  L LD N   G +P+ +F +++L +++L  N LSG LPP++
Sbjct  214  NGFSGDFPVGFGQCRSLVELSLDGNAIAGALPDDVFGLTSLQVLSLHTNSLSGHLPPSL  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 538862455824