BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5003_g2_i1 len=662 path=[471:0-661]

Length=662
                                                                      Score     E

sp|Q941H7.1|PROF_LITCN  RecName: Full=Profilin; AltName: Full=Min...    223   2e-70   Litchi chinensis [litchi]
gb|ABC02750.1|  profilin                                                221   9e-70   Litchi chinensis [litchi]
ref|XP_011000942.1|  PREDICTED: profilin-3                              220   3e-69   
ref|XP_002299743.1|  Profilin 3 family protein                          219   5e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006426857.1|  hypothetical protein CICLE_v10026756mg             218   1e-68   
ref|XP_002304225.1|  Profilin 3 family protein                          218   1e-68   Populus trichocarpa [western balsam poplar]
gb|KDP40849.1|  hypothetical protein JCGZ_24848                         218   2e-68   
gb|ADL18409.1|  profilin                                                217   2e-68   
gb|AFG16922.1|  profilin                                                217   3e-68   
gb|AFG16923.1|  profilin                                                217   3e-68   
gb|ABW37745.1|  Ama v 1.02 allergen                                     217   4e-68   Amaranthus viridis [bledo]
ref|XP_010047296.1|  PREDICTED: profilin                                217   5e-68   
sp|A4GFC4.1|PROCH_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    216   5e-68   Olea europaea
sp|Q9XF38.1|PROF_PYRCO  RecName: Full=Profilin; AltName: Full=All...    216   8e-68   Pyrus communis
gb|ABB76134.1|  profilin 1                                              216   8e-68   Mangifera indica
sp|A4GFC2.1|PROCF_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    216   1e-67   Olea europaea
gb|KCW79179.1|  hypothetical protein EUGRSUZ_C00615                     218   1e-67   
sp|Q9M7N0.1|PROF3_HEVBR  RecName: Full=Profilin-3; AltName: Full=...    216   1e-67   Hevea brasiliensis [jebe]
gb|ADB93072.1|  profilin-1                                              215   2e-67   
gb|AFG16926.1|  profilin                                                215   2e-67   
ref|XP_007223916.1|  hypothetical protein PRUPE_ppa013278mg             214   3e-67   
sp|A4GFB9.1|PROCD_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    214   4e-67   Olea europaea
ref|XP_011081736.1|  PREDICTED: profilin                                214   4e-67   
gb|AFG16925.1|  profilin                                                214   4e-67   
ref|XP_010526418.1|  PREDICTED: profilin                                214   4e-67   
ref|XP_009344483.1|  PREDICTED: profilin                                214   4e-67   
ref|NP_001235595.1|  profilin                                           214   5e-67   
gb|AAK01236.1|AF327623_1  minor allergen hazelnut profilin              214   6e-67   Corylus avellana [European hazelnut]
ref|XP_010033829.1|  PREDICTED: profilin                                214   6e-67   
ref|XP_004291152.1|  PREDICTED: profilin-like                           214   7e-67   
ref|XP_010668781.1|  PREDICTED: profilin-3-like                         213   9e-67   
sp|A4KA41.1|PROF5_CORAV  RecName: Full=Profilin-5; AltName: Full=...    213   1e-66   Corylus avellana [European hazelnut]
sp|Q9LEI8.1|PROF6_HEVBR  RecName: Full=Profilin-6; AltName: Full=...    213   1e-66   Hevea brasiliensis [jebe]
ref|XP_004290829.1|  PREDICTED: profilin-3-like                         213   1e-66   
gb|AAX19855.1|  profilin 1                                              213   2e-66   Malus domestica [apple tree]
gb|EPS66446.1|  profilin                                                213   2e-66   
ref|XP_009367418.1|  PREDICTED: profilin-3-like                         213   2e-66   
emb|CAD46559.1|  profilin                                               213   2e-66   Malus domestica [apple tree]
ref|XP_011005518.1|  PREDICTED: profilin-6-like                         213   2e-66   
sp|Q9M7M9.1|PROF4_HEVBR  RecName: Full=Profilin-4; AltName: Full=...    213   2e-66   Hevea brasiliensis [jebe]
pdb|1G5U|A  Chain A, Latex Profilin Hevb8                               212   2e-66   
sp|Q9XF42.1|PROF3_MALDO  RecName: Full=Profilin-3; AltName: Full=...    212   2e-66   Malus domestica [apple tree]
emb|CAK93753.1|  profilin                                               212   3e-66   Malus domestica [apple tree]
ref|XP_010267106.1|  PREDICTED: profilin-1                              212   3e-66   
ref|XP_006655796.1|  PREDICTED: profilin LP04-like                      212   4e-66   
ref|XP_008365251.1|  PREDICTED: profilin                                212   4e-66   
ref|XP_002514199.1|  profilin, putative                                 212   4e-66   Ricinus communis
gb|KHG29269.1|  Profilin-1                                              211   5e-66   
sp|Q9STB6.1|PROF2_HEVBR  RecName: Full=Profilin-2; AltName: Full=...    211   5e-66   Hevea brasiliensis [jebe]
ref|XP_008233911.1|  PREDICTED: profilin-like                           211   5e-66   
ref|XP_010668774.1|  PREDICTED: profilin-3                              211   5e-66   
gb|AFK38257.1|  unknown                                                 211   6e-66   
emb|CAN67015.1|  hypothetical protein VITISV_041272                     211   7e-66   Vitis vinifera
gb|AAK01235.1|AF327622_1  minor allergen hazelnut profilin              211   7e-66   Corylus avellana [European hazelnut]
ref|XP_008380843.1|  PREDICTED: profilin                                211   7e-66   
ref|NP_001234138.1|  profilin                                           211   8e-66   
ref|XP_010915373.1|  PREDICTED: profilin isoform X2                     211   8e-66   
gb|AIV43661.1|  profilin                                                211   9e-66   
sp|P0C0Y3.1|PROF_FRAAN  RecName: Full=Profilin; AltName: Allergen...    211   9e-66   Fragaria x ananassa
ref|XP_004503498.1|  PREDICTED: profilin-1-like                         211   1e-65   
sp|Q9M7M8.1|PROF5_HEVBR  RecName: Full=Profilin-5; AltName: Full=...    211   1e-65   Hevea brasiliensis [jebe]
emb|CAT99617.1|  profilin                                               211   1e-65   Malus domestica [apple tree]
ref|XP_007012986.1|  Profilin 1 isoform 1                               211   1e-65   
gb|KHF97992.1|  Profilin                                                210   1e-65   
ref|NP_001275370.1|  profilin-like protein                              210   1e-65   
ref|XP_007202751.1|  hypothetical protein PRUPE_ppa013285mg             210   1e-65   
sp|Q8GT39.1|PROF_PRUPE  RecName: Full=Profilin; AltName: Allergen...    210   1e-65   Prunus persica
gb|AFK40156.1|  unknown                                                 210   1e-65   
ref|XP_009350242.1|  PREDICTED: profilin                                210   1e-65   
gb|AAX19853.1|  profilin 1                                              210   1e-65   Malus domestica [apple tree]
sp|O65812.1|PROF1_HEVBR  RecName: Full=Profilin-1; AltName: Full=...    210   1e-65   Hevea brasiliensis [jebe]
ref|XP_004302848.1|  PREDICTED: profilin-like                           210   1e-65   
ref|XP_009628677.1|  PREDICTED: profilin-1                              210   1e-65   
ref|XP_006340251.1|  PREDICTED: profilin-like                           210   2e-65   
ref|XP_010536838.1|  PREDICTED: profilin-like                           210   2e-65   
gb|AFK47285.1|  unknown                                                 210   2e-65   
emb|CAD37201.1|  profilin                                               210   2e-65   Prunus persica
gb|ABA81885.1|  profilin-like                                           210   2e-65   Solanum tuberosum [potatoes]
ref|XP_002324161.1|  profilin 2 family protein                          210   2e-65   Populus trichocarpa [western balsam poplar]
gb|ADB96066.1|  profilin                                                209   2e-65   Arachis hypogaea [goober]
ref|XP_003564327.1|  PREDICTED: profilin-1                              209   2e-65   
ref|XP_007024334.1|  Profilin 5                                         209   3e-65   
ref|XP_008220131.1|  PREDICTED: profilin                                209   3e-65   
ref|XP_010688354.1|  PREDICTED: profilin                                209   3e-65   
ref|XP_008337609.1|  PREDICTED: profilin-2                              209   3e-65   
gb|ACP43298.1|  Ama r 2 pollen allergen                                 209   3e-65   Amaranthus retroflexus [common amaranth]
ref|XP_004287490.1|  PREDICTED: profilin-like                           209   3e-65   
sp|Q9XF40.1|PROF1_MALDO  RecName: Full=Profilin-1; AltName: Full=...    209   3e-65   Malus domestica [apple tree]
ref|XP_009796122.1|  PREDICTED: profilin-2                              209   3e-65   
ref|XP_008798583.1|  PREDICTED: profilin-1                              209   3e-65   
ref|XP_010541007.1|  PREDICTED: profilin-2                              209   3e-65   
emb|CAD46561.1|  profilin                                               209   4e-65   Malus domestica [apple tree]
emb|CAK93757.1|  profilin                                               209   4e-65   Malus domestica [apple tree]
ref|XP_003630698.1|  Profilin                                           209   4e-65   
ref|XP_008799778.1|  PREDICTED: profilin-1                              209   4e-65   
gb|AFK47224.1|  unknown                                                 209   4e-65   
ref|XP_008794098.1|  PREDICTED: profilin-like                           209   4e-65   
emb|CAK93713.1|  profilin                                               209   5e-65   Malus domestica [apple tree]
ref|XP_008795502.1|  PREDICTED: profilin-1-like                         209   5e-65   
ref|XP_002274966.2|  PREDICTED: profilin-1                              211   5e-65   Vitis vinifera
sp|Q93YI9.1|PROF_CAPAN  RecName: Full=Profilin; AltName: Full=Min...    209   5e-65   Capsicum annuum
gb|AAX19857.1|  profilin 2                                              209   5e-65   Malus domestica [apple tree]
gb|EPS59245.1|  profilin                                                209   6e-65   
ref|XP_007223783.1|  hypothetical protein PRUPE_ppa010614mg             213   6e-65   
sp|Q84V37.1|PROF_CHEAL  RecName: Full=Profilin; AltName: Full=Min...    209   6e-65   Chenopodium album [lamb's-quarters]
ref|XP_006353502.1|  PREDICTED: profilin-1-like                         209   6e-65   
ref|XP_010914952.1|  PREDICTED: profilin-1                              209   7e-65   
gb|AAQ63002.1|  oil palm profilin-like allergen PF2                     209   7e-65   Elaeis guineensis
ref|XP_004251645.1|  PREDICTED: profilin-1                              208   7e-65   
ref|XP_011019559.1|  PREDICTED: profilin                                208   7e-65   
ref|XP_002308591.1|  profilin 2 family protein                          208   8e-65   Populus trichocarpa [western balsam poplar]
sp|O65809.1|PROF1_SOYBN  RecName: Full=Profilin-1; AltName: Full=...    208   8e-65   Glycine max [soybeans]
gb|AAX19859.1|  profilin 2                                              208   9e-65   Malus domestica [apple tree]
ref|XP_006451338.1|  hypothetical protein CICLE_v10009877mg             208   9e-65   
ref|XP_007217879.1|  hypothetical protein PRUPE_ppa013277mg             208   9e-65   
ref|NP_001288607.1|  uncharacterized protein LOC103711216               207   1e-64   
sp|Q9XF39.1|PROF_PRUAV  RecName: Full=Profilin; AltName: Full=All...    207   2e-64   Prunus avium [gean]
gb|ACS34771.1|  Sal k 4 pollen allergen                                 207   2e-64   Kali turgidum [common saltwort]
ref|XP_010047663.1|  PREDICTED: profilin-1-like                         207   2e-64   
sp|Q9XF41.1|PROF2_MALDO  RecName: Full=Profilin-2; AltName: Full=...    207   2e-64   Malus domestica [apple tree]
gb|KHM99817.1|  Profilin-1                                              207   2e-64   
pdb|4ESP|A  Chain A, Crystal Structure Of Peanut Allergen Ara H 5       207   2e-64   
gb|AGA84056.1|  profilin                                                207   2e-64   
ref|XP_009404548.1|  PREDICTED: profilin-like                           207   3e-64   
emb|CDP08197.1|  unnamed protein product                                207   3e-64   
ref|NP_001056833.1|  Os06g0152100                                       207   3e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KHG15153.1|  Profilin                                                207   3e-64   
ref|NP_001237519.1|  profilin                                           207   4e-64   
emb|CAD46560.1|  profilin                                               207   4e-64   Malus domestica [apple tree]
ref|XP_009120170.1|  PREDICTED: profilin-5                              207   4e-64   
emb|CAD92666.1|  profilin                                               206   4e-64   Cucumis melo [Oriental melon]
ref|XP_003564682.1|  PREDICTED: profilin-2                              206   4e-64   
sp|P84177.2|PROF1_CITSI  RecName: Full=Profilin; AltName: Allerge...    206   5e-64   Citrus sinensis [apfelsine]
ref|XP_009602785.1|  PREDICTED: profilin-2                              206   5e-64   
ref|XP_007012985.1|  Profilin 5                                         206   5e-64   
sp|Q64LH2.1|PROF2_AMBAR  RecName: Full=Profilin-2; AltName: Full=...    206   5e-64   Ambrosia artemisiifolia [annual ragweed]
ref|XP_010924449.1|  PREDICTED: profilin-1-like                         206   6e-64   
gb|AAP15200.1|  profilin-like protein                                   206   6e-64   Humulus scandens
gb|AAQ63003.1|  oil palm profilin-like allergen PF3                     206   6e-64   Elaeis guineensis
ref|XP_010925517.1|  PREDICTED: profilin-1-like                         207   6e-64   
ref|XP_009389903.1|  PREDICTED: profilin-like isoform X4                206   7e-64   
gb|ACV66156.2|  profilin                                                206   7e-64   Akebia trifoliata
ref|NP_001236192.1|  profilin-2                                         206   7e-64   
emb|CDY32870.1|  BnaC09g33170D                                          206   8e-64   
sp|Q9SNW7.1|PROF1_LILLO  RecName: Full=Profilin-1                       206   8e-64   Lilium longiflorum [Easter lily]
ref|XP_010548681.1|  PREDICTED: profilin                                206   9e-64   
ref|XP_002283490.1|  PREDICTED: profilin-1                              206   9e-64   Vitis vinifera
emb|CDY64971.1|  BnaAnng19920D                                          205   1e-63   
gb|AFK47485.1|  unknown                                                 205   1e-63   
ref|XP_010249472.1|  PREDICTED: profilin-1-like                         205   1e-63   
ref|XP_002515952.1|  profilin, putative                                 205   1e-63   Ricinus communis
ref|XP_010249471.1|  PREDICTED: profilin-like                           205   1e-63   
ref|XP_004964829.1|  PREDICTED: profilin LP04-like                      205   1e-63   
ref|XP_006853720.1|  hypothetical protein AMTR_s00056p00160320          205   1e-63   
gb|AET05174.2|  profilin                                                205   1e-63   
gb|AAU81921.1|  profilin                                                205   2e-63   Arachis hypogaea [goober]
gb|AHY24177.1|  profilin                                                205   2e-63   
ref|XP_006451339.1|  hypothetical protein CICLE_v10009871mg             205   2e-63   
ref|XP_009352571.1|  PREDICTED: profilin-2                              205   2e-63   
ref|XP_009405220.1|  PREDICTED: profilin-1                              205   2e-63   
ref|XP_009400573.1|  PREDICTED: profilin-A                              205   2e-63   
gb|ABU95412.1|  Sin a 4 allergen                                        205   2e-63   
ref|XP_010254422.1|  PREDICTED: profilin-like                           205   2e-63   
gb|AHL24658.1|  Sal k 4.03 allergen                                     205   2e-63   
gb|KHG22026.1|  Profilin                                                205   2e-63   
dbj|BAJ86041.1|  predicted protein                                      205   2e-63   
emb|CAB61833.1|  profilin                                               205   2e-63   Nicotiana tabacum [American tobacco]
ref|XP_008458981.1|  PREDICTED: profilin-4                              204   3e-63   
ref|NP_001105450.1|  profilin-1                                         204   3e-63   Zea mays [maize]
ref|XP_004241753.1|  PREDICTED: profilin-1-like                         204   3e-63   
ref|XP_006853719.1|  hypothetical protein AMTR_s00056p00159630          204   3e-63   
sp|Q5EF31.1|PROF_CROSA  RecName: Full=Profilin; AltName: Full=Pol...    204   4e-63   Crocus sativus [saffron crocus]
ref|XP_009405712.1|  PREDICTED: profilin-1-like                         204   4e-63   
sp|Q64LH1.1|PROF1_AMBAR  RecName: Full=Profilin-1; AltName: Full=...    204   4e-63   Ambrosia artemisiifolia [annual ragweed]
gb|ABC61055.1|  profilin-like protein                                   204   4e-63   Cinnamomum camphora
ref|XP_009789538.1|  PREDICTED: profilin-1                              204   5e-63   
gb|ABW37744.1|  Ama v 1.01 allergen                                     204   5e-63   Amaranthus viridis [bledo]
ref|XP_010095450.1|  hypothetical protein L484_005874                   204   5e-63   
ref|XP_004969894.1|  PREDICTED: profilin-A-like                         204   5e-63   
gb|KHN16653.1|  Profilin-1                                              204   5e-63   
ref|XP_003569765.1|  PREDICTED: profilin-2                              204   6e-63   
gb|AIV43662.1|  profilin                                                204   6e-63   
gb|AAU43733.1|  profilin                                                203   7e-63   Citrullus lanatus [wild melon]
sp|O24650.1|PROF2_PHLPR  RecName: Full=Profilin-2; AltName: Full=...    203   7e-63   Phleum pratense [timothy]
ref|XP_008458990.1|  PREDICTED: profilin                                203   7e-63   
ref|XP_006298806.1|  hypothetical protein CARUB_v10014910mg             203   7e-63   
emb|CCP19647.1|  profilin allergen                                      203   8e-63   
ref|XP_003525290.1|  PREDICTED: profilin-like                           203   8e-63   
ref|XP_006661690.1|  PREDICTED: profilin-A-like                         203   8e-63   
ref|XP_009415731.1|  PREDICTED: profilin-3                              203   8e-63   
ref|XP_010267105.1|  PREDICTED: profilin-2                              203   8e-63   
gb|KDP33777.1|  hypothetical protein JCGZ_07348                         203   8e-63   
gb|EMT25354.1|  Profilin-2/4                                            203   8e-63   
ref|NP_001235025.1|  uncharacterized protein LOC100499717               203   9e-63   
ref|XP_009409369.1|  PREDICTED: profilin-like                           203   1e-62   
gb|AAP15198.1|  profilin-like protein                                   203   1e-62   Humulus scandens
dbj|BAJ34266.1|  unnamed protein product                                203   1e-62   
emb|CDM84005.1|  unnamed protein product                                203   1e-62   
ref|XP_002441408.1|  hypothetical protein SORBIDRAFT_09g026120          203   1e-62   Sorghum bicolor [broomcorn]
ref|XP_004503499.1|  PREDICTED: profilin-like                           203   1e-62   
emb|CDP03236.1|  unnamed protein product                                203   1e-62   
ref|NP_001284474.1|  profilin                                           202   1e-62   
ref|NP_001104885.1|  profilin-4                                         202   2e-62   Zea mays [maize]
sp|Q9ST99.1|PROF2_TOBAC  RecName: Full=Profilin-2; AltName: Full=...    202   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_010541006.1|  PREDICTED: profilin-4                              202   2e-62   
gb|AAQ63001.1|  oil palm profilin-like allergen PF1                     202   2e-62   Elaeis guineensis
gb|AHL24660.1|  Fra e 2.01 allergen                                     202   2e-62   
ref|XP_008795503.1|  PREDICTED: profilin-2-like                         202   2e-62   
gb|ADK22841.1|  Sal k 4.02                                              202   2e-62   
gb|EMS66850.1|  Profilin-2/4                                            203   2e-62   
gb|AFK47381.1|  unknown                                                 202   2e-62   
ref|NP_001064348.1|  Os10g0323600                                       202   2e-62   Oryza sativa Japonica Group [Japonica rice]
gb|ACN36779.1|  unknown                                                 202   2e-62   Zea mays [maize]
sp|A4K9Z8.1|PROF2_BETPN  RecName: Full=Profilin-2; AltName: Full=...    202   2e-62   Betula pendula [white birch]
sp|Q94JN3.1|PROF_MUSAC  RecName: Full=Profilin; AltName: Full=Min...    202   2e-62   Musa acuminata [banana]
gb|EMT00312.1|  Profilin-2/4                                            202   2e-62   
pdb|1CQA|A  Chain A, Birch Pollen Profilin                              202   3e-62   
ref|XP_006661691.1|  PREDICTED: profilin-A-like                         202   3e-62   
emb|CDM81724.1|  unnamed protein product                                202   3e-62   
ref|XP_004149180.1|  PREDICTED: profilin-like                           202   3e-62   
ref|XP_010098156.1|  hypothetical protein L484_026290                   202   3e-62   
gb|AEW90957.1|  pollen profilin 3R4-2                                   202   3e-62   
ref|XP_004141027.1|  PREDICTED: profilin-like                           202   3e-62   
gb|AEC10960.1|  profilin 2                                              202   3e-62   
ref|XP_007012197.1|  Profilin 5 isoform 2                               203   3e-62   
gb|ABO43717.1|  profilin                                                202   3e-62   Gossypium hirsutum [American cotton]
ref|XP_010483134.1|  PREDICTED: profilin-5                              202   4e-62   
ref|XP_008447563.1|  PREDICTED: profilin-like                           202   4e-62   
ref|XP_007160275.1|  hypothetical protein PHAVU_002G307600g             201   4e-62   
ref|NP_001105622.1|  profilin-5                                         201   4e-62   Zea mays [maize]
gb|ACG33212.1|  profilin-2                                              201   4e-62   Zea mays [maize]
ref|XP_009392682.1|  PREDICTED: profilin                                201   4e-62   
dbj|BAK07752.1|  predicted protein                                      201   4e-62   
ref|NP_001233869.1|  profilin-1                                         201   4e-62   
sp|P41372.1|PROF1_TOBAC  RecName: Full=Profilin-1                       201   5e-62   Nicotiana tabacum [American tobacco]
sp|P35079.1|PROF1_PHLPR  RecName: Full=Profilin-1; AltName: Full=...    201   5e-62   Phleum pratense [timothy]
ref|XP_002456332.1|  hypothetical protein SORBIDRAFT_03g034110          201   5e-62   Sorghum bicolor [broomcorn]
ref|XP_004513067.1|  PREDICTED: profilin-like                           201   5e-62   
gb|ACA49387.1|  putative actin- and phospholipid-binding protein        201   5e-62   Gerbera hybrid cultivar
ref|XP_003546590.1|  PREDICTED: profilin-4-like                         201   5e-62   
ref|XP_008799779.1|  PREDICTED: profilin-2                              201   5e-62   
gb|AAP42151.3|  profilin                                                201   5e-62   Cucumis melo var. cantalupo [netted muskmelon]
sp|O24169.1|PROFA_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    201   5e-62   Olea europaea
ref|XP_002514198.1|  profilin, putative                                 201   5e-62   Ricinus communis
gb|AFK33983.1|  unknown                                                 201   5e-62   
gb|ACV50427.1|  profilin-like protein                                   201   6e-62   Jatropha curcas
ref|XP_009591293.1|  PREDICTED: profilin-2                              201   6e-62   
gb|EMS49855.1|  Profilin-2/4                                            201   6e-62   
ref|XP_004157894.1|  PREDICTED: profilin-like                           201   6e-62   
ref|XP_007160276.1|  hypothetical protein PHAVU_002G307700g             201   6e-62   
sp|A4KA32.1|PROF5_PHLPR  RecName: Full=Profilin-5; AltName: Full=...    201   6e-62   Phleum pratense [timothy]
sp|Q94JN2.1|PROF_ANACO  RecName: Full=Profilin; AltName: Full=Min...    201   6e-62   Ananas comosus
ref|XP_007012196.1|  Profilin 5 isoform 1                               201   6e-62   
ref|XP_010914972.1|  PREDICTED: profilin-2                              201   6e-62   
ref|XP_010416676.1|  PREDICTED: profilin-1-like                         201   7e-62   
sp|P49233.2|PROF2_WHEAT  RecName: Full=Profilin-2                       201   7e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002883972.1|  hypothetical protein ARALYDRAFT_480492             201   7e-62   
gb|ABD62998.1|  profilin 2                                              201   7e-62   Mangifera indica
emb|CAQ57979.1|  profilin                                               201   7e-62   Triticum aestivum [Canadian hard winter wheat]
sp|Q9XF37.1|PROF_APIGR  RecName: Full=Profilin; AltName: Full=Min...    201   8e-62   Apium graveolens
sp|A4KA45.1|PROF4_CORAV  RecName: Full=Profilin-4; AltName: Full=...    201   8e-62   Corylus avellana [European hazelnut]
sp|A4GE44.1|PROBR_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    201   9e-62   Olea europaea
ref|XP_009395053.1|  PREDICTED: profilin-1-like                         201   1e-61   
ref|XP_003620753.1|  Profilin                                           201   1e-61   
gb|KHG23640.1|  Profilin-3                                              201   1e-61   
sp|A4KA53.1|PROCM_OLEEU  RecName: Full=Profilin-8; AltName: Full=...    200   1e-61   Olea europaea
ref|NP_179567.1|  profilin 5                                            200   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20403.1|  hypothetical protein MIMGU_mgv1a016186mg                200   1e-61   
ref|XP_010489132.1|  PREDICTED: profilin-1-like                         200   1e-61   
ref|NP_001233973.1|  profilin-2                                         200   1e-61   
gb|KFK40342.1|  hypothetical protein AALP_AA3G361600                    200   1e-61   
ref|XP_010536839.1|  PREDICTED: profilin-4                              200   1e-61   
gb|ABK28500.1|  unknown                                                 200   1e-61   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK02673.1|  predicted protein                                      200   1e-61   
ref|XP_002866157.1|  profilin-5                                         200   1e-61   
sp|A4KA37.1|PROF9_PHLPR  RecName: Full=Profilin-9; AltName: Full=...    200   1e-61   Phleum pratense [timothy]
sp|A4GDQ6.1|PROAK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    200   2e-61   Olea europaea
ref|XP_002283450.1|  PREDICTED: profilin-1                              200   2e-61   Vitis vinifera
sp|A4GDR1.1|PROAS_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    200   2e-61   Olea europaea
gb|EMT03530.1|  Profilin                                                200   2e-61   
ref|XP_010924448.1|  PREDICTED: profilin-2-like                         200   2e-61   
sp|A4GDU2.1|PROBK_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    200   2e-61   
emb|CDX81945.1|  BnaC08g36560D                                          200   2e-61   
ref|XP_004961445.1|  PREDICTED: profilin-A-like                         200   2e-61   
sp|A4KA44.1|PROF3_CORAV  RecName: Full=Profilin-3; AltName: Full=...    200   2e-61   
sp|O24170.1|PROFB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    200   2e-61   
sp|A4GE38.1|PROBO_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    200   2e-61   
ref|XP_003568071.1|  PREDICTED: profilin-2-like                         200   2e-61   
sp|A4GD54.1|PROFY_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    200   2e-61   
sp|A4GDR7.1|PROAW_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    200   2e-61   
gb|AGN33441.1|  profilin                                                199   2e-61   
sp|A4KA36.1|PROF8_PHLPR  RecName: Full=Profilin-8; AltName: Full=...    199   2e-61   
sp|P0DKE3.1|PROFV_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    200   2e-61   
sp|A4GCR6.1|PROFF_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    200   2e-61   
ref|XP_006284576.1|  hypothetical protein CARUB_v10005801mg             202   2e-61   
sp|P0DKE4.1|PROFW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    199   2e-61   
ref|XP_006299812.1|  hypothetical protein CARUB_v10016013mg             199   2e-61   
gb|AAD02560.1|  PGPS/NH20                                               199   2e-61   
sp|A4KA33.1|PROF6_PHLPR  RecName: Full=Profilin-6; AltName: Full=...    199   2e-61   
ref|XP_010925516.1|  PREDICTED: profilin-1-like                         199   2e-61   
sp|P49232.2|PROF1_WHEAT  RecName: Full=Profilin-1                       199   2e-61   
sp|O04725.1|PROF_CYNDA  RecName: Full=Profilin; AltName: Full=Pol...    199   2e-61   
gb|AEW90958.1|  profilin R2-2                                           199   2e-61   
ref|XP_006356135.1|  PREDICTED: profilin-1-like                         199   2e-61   
ref|XP_009102139.1|  PREDICTED: profilin-1                              199   3e-61   
sp|A4GCR5.1|PROFE_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    199   3e-61   
sp|P25816.1|PROF1_BETPN  RecName: Full=Profilin-1; AltName: Full=...    199   3e-61   
emb|CDY03342.1|  BnaC09g10060D                                          199   3e-61   
gb|KFK27226.1|  hypothetical protein AALP_AA8G353900                    199   3e-61   
ref|XP_009757178.1|  PREDICTED: profilin-3-like                         199   3e-61   
gb|ABM53028.1|  profilin                                                199   3e-61   
ref|XP_009413861.1|  PREDICTED: profilin-like                           199   3e-61   
ref|XP_003516387.1|  PREDICTED: profilin-like                           199   3e-61   
sp|A4KA50.1|PROCJ_OLEEU  RecName: Full=Profilin-5; AltName: Full=...    199   3e-61   
sp|A4KA52.1|PROCL_OLEEU  RecName: Full=Profilin-7; AltName: Full=...    199   4e-61   
sp|A4GCR7.1|PROFP_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    199   4e-61   
ref|XP_007152957.1|  hypothetical protein PHAVU_004G174400g             199   4e-61   
ref|XP_002436493.1|  hypothetical protein SORBIDRAFT_10g003670          199   4e-61   
sp|A4KA34.1|PROF7_PHLPR  RecName: Full=Profilin-7; AltName: Full=...    199   4e-61   
sp|A4GD50.1|PROFT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    199   4e-61   
sp|A4KA49.1|PROCI_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    199   4e-61   
sp|A4GDQ8.1|PROAL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    199   5e-61   
sp|A4GE45.1|PROBS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    199   5e-61   
ref|XP_004141028.1|  PREDICTED: profilin-like                           199   5e-61   
sp|A4GE39.1|PROBP_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    199   5e-61   
gb|ADK35122.1|  profilin                                                199   5e-61   
sp|A4KA38.1|PRO10_PHLPR  RecName: Full=Profilin-10; AltName: Full...    199   5e-61   
gb|ABM53030.1|  profilin                                                199   6e-61   
gb|ABP58623.1|  pollen allergen Ole e 2                                 199   6e-61   
sp|A4KA39.1|PROF1_CORAV  RecName: Full=Profilin-1; AltName: Full=...    198   7e-61   
gb|AAW84279.1|  profilin 5                                              198   7e-61   
sp|O24282.1|PROF3_PHLPR  RecName: Full=Profilin-3; AltName: Full=...    198   7e-61   
ref|NP_179566.1|  profilin 1                                            198   7e-61   
ref|XP_010447864.1|  PREDICTED: profilin-2-like                         198   7e-61   
sp|Q9ST98.1|PROF3_TOBAC  RecName: Full=Profilin-3                       198   7e-61   
sp|P49234.2|PROF3_WHEAT  RecName: Full=Profilin-3                       198   8e-61   
sp|O24171.1|PROFC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    198   8e-61   
ref|XP_004287491.1|  PREDICTED: profilin-like                           198   8e-61   
sp|A4KA40.1|PROF2_CORAV  RecName: Full=Profilin-2; AltName: Full=...    198   8e-61   
ref|XP_009112628.1|  PREDICTED: profilin-4-like                         198   8e-61   
sp|A4GCR8.1|PROFQ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    198   9e-61   
gb|AAW84277.1|  profilin 3                                              198   9e-61   
dbj|BAK06398.1|  predicted protein                                      198   1e-60   
gb|EYU21444.1|  hypothetical protein MIMGU_mgv1a016199mg                198   1e-60   
sp|A4GDR9.1|PROAY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    198   1e-60   
sp|A4GDT5.1|PROBH_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    198   1e-60   
ref|XP_009112626.1|  PREDICTED: profilin-1-like                         198   1e-60   
sp|A4GDT3.1|PROBF_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    198   1e-60   
ref|XP_010495947.1|  PREDICTED: profilin-1-like                         197   1e-60   
ref|XP_010915371.1|  PREDICTED: profilin-like                           197   1e-60   
sp|A4GD56.1|PROAA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    198   1e-60   
ref|XP_004968458.1|  PREDICTED: profilin-like                           197   1e-60   
sp|A4GDS0.1|PROAZ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    197   1e-60   
emb|CDY35886.1|  BnaA07g01010D                                          197   1e-60   
sp|P0DKG1.1|PROCC_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    197   1e-60   
ref|XP_009777310.1|  PREDICTED: profilin-3                              197   1e-60   
ref|NP_001288512.1|  profilin-7                                         197   1e-60   
sp|A4GDR4.1|PROAU_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    197   1e-60   
ref|XP_003630696.1|  Profilin                                           197   1e-60   
ref|NP_001105452.1|  profilin-3                                         197   2e-60   
sp|A4GE42.1|PROBQ_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    197   2e-60   
ref|XP_010489131.1|  PREDICTED: profilin-4                              197   2e-60   
sp|A4GDU5.1|PROBM_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    197   2e-60   
sp|A4GDS6.1|PROBA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    197   2e-60   
ref|XP_010416663.1|  PREDICTED: profilin-4-like                         197   2e-60   
sp|Q9SNW5.1|PROF3_LILLO  RecName: Full=Profilin-3                       197   2e-60   
ref|XP_007160274.1|  hypothetical protein PHAVU_002G307500g             197   2e-60   
ref|NP_001106002.1|  profilin-9                                         197   2e-60   
sp|A4GDU6.1|PROBN_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    197   3e-60   
ref|XP_011072445.1|  PREDICTED: profilin                                197   3e-60   
sp|A4KA59.1|PRO10_MAIZE  RecName: Full=Profilin-10; AltName: Full...    197   3e-60   
sp|Q8SAE6.1|PROF_DAUCA  RecName: Full=Profilin; AltName: Full=Min...    197   3e-60   
ref|XP_011078238.1|  PREDICTED: profilin-3-like                         197   3e-60   
ref|XP_009387128.1|  PREDICTED: profilin-A-like                         197   3e-60   
sp|P0DKE1.1|PROFS_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    197   3e-60   
sp|A4KA55.1|PROF6_MAIZE  RecName: Full=Profilin-6; AltName: Full=...    197   3e-60   
ref|XP_011078237.1|  PREDICTED: profilin-3                              197   3e-60   
sp|A4GFC3.1|PROCG_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    196   3e-60   
gb|AFW85125.1|  profilin-3                                              196   3e-60   
sp|A4GE47.1|PROBT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    197   4e-60   
gb|AAW84278.1|  profilin 4                                              196   4e-60   
emb|CAT99619.1|  profilin                                               196   4e-60   
ref|XP_006281613.1|  hypothetical protein CARUB_v10027731mg             197   4e-60   
ref|XP_008242467.1|  PREDICTED: profilin-4                              196   5e-60   
ref|XP_008337608.1|  PREDICTED: profilin-4                              196   5e-60   
sp|A4GDR6.1|PROAV_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    196   5e-60   
ref|XP_007204757.1|  hypothetical protein PRUPE_ppa013242mg             196   5e-60   
gb|ABQ23999.1|  pollen-specific profilin3                               196   5e-60   
tpg|DAA57720.1|  TPA: profilin                                          196   5e-60   
sp|A4GDU3.1|PROBL_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    196   5e-60   
gb|AAW84275.1|  profilin 1                                              196   5e-60   
ref|NP_001105987.1|  profilin-7                                         196   6e-60   
gb|AFW85126.1|  profilin 3, mRNA                                        196   6e-60   
ref|XP_009352573.1|  PREDICTED: profilin-4                              196   6e-60   
sp|A4GFB7.1|PROCA_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   6e-60   
sp|A4KA51.1|PROCK_OLEEU  RecName: Full=Profilin-6; AltName: Full=...    196   6e-60   
sp|A4GDS7.1|PROBB_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   7e-60   
sp|A4GDU0.1|PROBJ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   7e-60   
sp|Q9SQI9.1|PROF_ARAHY  RecName: Full=Profilin; AltName: Allergen...    196   7e-60   
ref|XP_010451283.1|  PREDICTED: profilin-5-like                         197   7e-60   
sp|A4GE53.1|PROBX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   8e-60   
gb|ACE82291.1|  profilin                                                196   8e-60   
sp|A4GDT1.1|PROBE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    196   9e-60   
gb|AAW84276.1|  profilin 2                                              196   9e-60   
ref|NP_001149484.1|  profilin A                                         196   9e-60   
sp|P0DKE6.1|PROAB_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    196   9e-60   
sp|P0DKF4.1|PROAM_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    196   9e-60   
sp|A4GDT0.1|PROBD_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   9e-60   
ref|NP_001105451.1|  profilin-2                                         196   1e-59   
emb|CDY68825.1|  BnaA01g34880D                                          195   1e-59   
gb|KFK29491.1|  hypothetical protein AALP_AA7G141400                    196   1e-59   
sp|A4GDR3.1|PROAT_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    196   1e-59   
sp|P52184.1|PROF1_HORVU  RecName: Full=Profilin-1                       195   1e-59   
sp|Q9SNW6.1|PROF2_LILLO  RecName: Full=Profilin-2                       195   1e-59   
sp|A4GD58.1|PROAJ_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    195   1e-59   
gb|KFK29496.1|  hypothetical protein AALP_AA7G141900                    195   1e-59   
gb|ABW17183.1|  profilin                                                195   1e-59   
sp|P35082.2|PROF2_MAIZE  RecName: Full=Profilin-2; AltName: Full=...    195   1e-59   
sp|A4KA57.1|PROF8_MAIZE  RecName: Full=Profilin-8; AltName: Full=...    195   1e-59   
ref|XP_009117522.1|  PREDICTED: profilin-1-like                         195   1e-59   
ref|XP_009117521.1|  PREDICTED: profilin-4-like                         195   1e-59   
gb|ABM53029.1|  profilin                                                195   1e-59   
ref|XP_006583560.1|  PREDICTED: profilin-like                           195   1e-59   
emb|CDY62034.1|  BnaC03g77670D                                          195   2e-59   
sp|A4GE48.1|PROBU_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    195   2e-59   
ref|XP_009128837.1|  PREDICTED: profilin-1                              194   2e-59   
sp|A4GDT9.1|PROBI_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    195   2e-59   
ref|XP_010433105.1|  PREDICTED: profilin-2                              194   2e-59   
ref|XP_002883973.1|  PFN1/PRF1                                          194   2e-59   
ref|XP_009137845.1|  PREDICTED: profilin-3-like                         194   2e-59   
gb|ABP58621.1|  pollen allergen Ole e 2                                 194   2e-59   
ref|NP_194663.1|  profilin 4                                            194   2e-59   
ref|XP_009586833.1|  PREDICTED: profilin-like                           194   2e-59   
gb|AAD21619.1|  putative profilin                                       194   2e-59   
sp|A4GE50.1|PROBW_OLEEU  RecName: Full=Profilin-4; AltName: Full=...    194   2e-59   
gb|KFK40340.1|  hypothetical protein AALP_AA3G361400                    194   2e-59   
ref|XP_009128846.1|  PREDICTED: profilin-3                              194   3e-59   
gb|ABP35953.1|  profillin                                               194   3e-59   
ref|XP_009389900.1|  PREDICTED: profilin-like isoform X1                194   3e-59   
ref|XP_010656249.1|  PREDICTED: profilin-2                              194   3e-59   
ref|XP_002869439.1|  hypothetical protein ARALYDRAFT_328774             194   3e-59   
ref|XP_009389901.1|  PREDICTED: profilin-like isoform X2                194   3e-59   
gb|EPS71087.1|  profilin                                                194   4e-59   
sp|O49894.1|PROF_MERAN  RecName: Full=Profilin; AltName: Full=Pol...    194   4e-59   
sp|A4GDR8.1|PROAX_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    194   4e-59   
gb|ABW17184.1|  profilin                                                194   4e-59   
sp|A4KA43.1|PROF6_CORAV  RecName: Full=Profilin-6; AltName: Full=...    194   4e-59   
gb|ABK22288.1|  unknown                                                 194   5e-59   
ref|XP_006584806.1|  PREDICTED: profilin-like                           194   5e-59   
gb|ABW17187.1|  profilin                                                194   5e-59   
gb|ABW17190.1|  profilin                                                194   5e-59   
sp|A4GFC0.1|PROCE_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    194   5e-59   
sp|Q9FUB8.1|PROF_BRANA  RecName: Full=Profilin                          194   5e-59   
gb|AAK59494.2|  putative profilin protein                               194   6e-59   
sp|A4GE55.1|PROBZ_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    193   6e-59   
sp|Q9FE63.1|PROF5_ARATH  RecName: Full=Profilin-5                       193   7e-59   
ref|NP_194664.1|  profilin 2                                            193   7e-59   
ref|XP_010049601.1|  PREDICTED: profilin-2                              193   7e-59   
ref|XP_010033714.1|  PREDICTED: profilin-like                           193   8e-59   
sp|A4KA61.1|PRO12_MAIZE  RecName: Full=Profilin-12; AltName: Full...    193   8e-59   
ref|XP_009109044.1|  PREDICTED: profilin                                193   8e-59   
sp|A4GD55.1|PROFZ_OLEEU  RecName: Full=Profilin-1; AltName: Full=...    193   8e-59   
ref|XP_010688357.1|  PREDICTED: profilin-like                           193   9e-59   
sp|A4GDT4.1|PROBG_OLEEU  RecName: Full=Profilin-2; AltName: Full=...    193   9e-59   
gb|AAO41991.1|  putative profilin 3                                     193   9e-59   
sp|A4KA60.1|PRO11_MAIZE  RecName: Full=Profilin-11; AltName: Full...    193   9e-59   
ref|XP_009102137.1|  PREDICTED: profilin-4                              193   1e-58   
ref|XP_006284736.1|  hypothetical protein CARUB_v10005999mg             193   1e-58   
ref|NP_200471.2|  profilin 3                                            194   1e-58   
ref|XP_009622655.1|  PREDICTED: profilin-3                              193   1e-58   
gb|AAX77687.1|  profilin isoallergen 1                                  193   1e-58   
gb|ABW17185.1|  profilin                                                192   1e-58   
sp|A4GE54.1|PROBY_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    192   1e-58   
ref|XP_010438310.1|  PREDICTED: profilin-3-like                         192   1e-58   
sp|Q64LH0.1|PROF3_AMBAR  RecName: Full=Profilin-3; AltName: Full=...    192   1e-58   
ref|XP_009389902.1|  PREDICTED: profilin-like isoform X3                192   1e-58   
gb|ABK27012.1|  unknown                                                 192   2e-58   
gb|EYU30692.1|  hypothetical protein MIMGU_mgv1a016198mg                192   2e-58   
ref|XP_008794097.1|  PREDICTED: profilin-like                           192   2e-58   
gb|KHM99818.1|  Profilin                                                191   3e-58   
ref|XP_009399807.1|  PREDICTED: profilin-like                           191   3e-58   
sp|Q8H2C9.3|PROF1_ARTVU  RecName: Full=Profilin-1; AltName: Full=...    191   3e-58   
ref|XP_002869438.1|  PFN2/PRF2/PRO2                                     191   4e-58   
sp|A4GE49.1|PROBV_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    191   5e-58   
gb|AAM63638.1|  profilin 2                                              191   5e-58   
pdb|3NUL|A  Chain A, Profilin I From Arabidopsis Thaliana               191   7e-58   
sp|A4GDS9.1|PROBC_OLEEU  RecName: Full=Profilin-3; AltName: Full=...    190   1e-57   
ref|XP_010110871.1|  Glucan endo-1,3-beta-glucosidase 13                208   1e-57   
ref|XP_010526419.1|  PREDICTED: profilin-4-like                         190   1e-57   
sp|O81982.1|PROF_HELAN  RecName: Full=Profilin; AltName: Full=Pol...    190   2e-57   
ref|XP_011093655.1|  PREDICTED: profilin-3-like                         190   2e-57   
gb|AAG10088.1|U43591_1  profilin                                        189   2e-57   
gb|AAX77688.1|  profilin isoallergen 2                                  189   3e-57   
gb|EYU30691.1|  hypothetical protein MIMGU_mgv1a016415mg                189   3e-57   
emb|CDP03238.1|  unnamed protein product                                189   3e-57   
emb|CDY11912.1|  BnaC03g13380D                                          189   4e-57   
ref|XP_009628678.1|  PREDICTED: LOW QUALITY PROTEIN: profilin-3-like    189   4e-57   
gb|EYU27249.1|  hypothetical protein MIMGU_mgv1a016111mg                188   7e-57   
gb|ABU97473.1|  profilin                                                188   7e-57   
emb|CAJ38383.1|  profilin                                               188   8e-57   



>sp|Q941H7.1|PROF_LITCN RecName: Full=Profilin; AltName: Full=Minor allergen Lit c 1; 
AltName: Allergen=Lit c 1 [Litchi chinensis]
 gb|AAL07320.1| profilin [Litchi chinensis]
Length=131

 Score =   223 bits (568),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+ +G  LTAAAI+GHDGS+WAQSANFP+F P EIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKTTQ L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|ABC02750.1| profilin [Litchi chinensis]
Length=131

 Score =   221 bits (563),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+ +G  LTAAAI+GHDGS+WAQSANFP+F P EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPVEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKTTQ L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_011000942.1| PREDICTED: profilin-3 [Populus euphratica]
Length=131

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAI+GHDGS+WAQSA FP+F P+EI+AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCEIEGNHLTAAAIIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT+Q L+ GLYDEP+TPGQCNM+VERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTVKKTSQALVIGLYDEPLTPGQCNMIVERLGDYLT  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_002299743.1| Profilin 3 family protein [Populus trichocarpa]
 gb|ABK95977.1| unknown [Populus trichocarpa]
 gb|EEE84548.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   219 bits (558),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAI+GHDGS+WAQSA FP+F P+EI+AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCEIEGNHLTAAAIIGHDGSVWAQSATFPQFKPEEISAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT+Q L+ GLYDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTVKKTSQALVIGLYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQ  296
            DQ
Sbjct  128  DQ  129



>ref|XP_006426857.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 ref|XP_006465706.1| PREDICTED: profilin-3-like [Citrus sinensis]
 gb|ESR40097.1| hypothetical protein CICLE_v10026756mg [Citrus clementina]
 gb|KDO51829.1| hypothetical protein CISIN_1g032890mg [Citrus sinensis]
Length=131

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LT+AAI+GHDGS+WAQS+NFP+F P+EIAAI++DF+EPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTSAAIVGHDGSVWAQSSNFPQFKPEEIAAIMKDFEEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALIFGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_002304225.1| Profilin 3 family protein [Populus trichocarpa]
 ref|XP_011011002.1| PREDICTED: profilin-4 [Populus euphratica]
 ref|XP_011015508.1| PREDICTED: profilin-4 [Populus euphratica]
 gb|ABK93735.1| unknown [Populus trichocarpa]
 gb|EEE79204.1| Profilin 3 family protein [Populus trichocarpa]
Length=131

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LTAAAI+G DGS+WAQSA FP++ P+EI+AI++DFDEPGSLAPTGLH+
Sbjct  8    DDHLMCDIEGNHLTAAAIIGQDGSVWAQSATFPQYKPEEISAIMKDFDEPGSLAPTGLHI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTAQALIFGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|KDP40849.1| hypothetical protein JCGZ_24848 [Jatropha curcas]
Length=131

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+G +LTAAAI+GHDGS+WAQS +FP+F P+EIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DEHLMCDIDGQRLTAAAIIGHDGSVWAQSTSFPQFKPEEIAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT+Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGESGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|ADL18409.1| profilin [Gossypium hirsutum]
Length=131

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+ HDGS+WAQSANFP+F P+EI AI+ DF+EPG+LAPTGLHL
Sbjct  8    DDHLMCEIEGNHLSAAAIIAHDGSVWAQSANFPQFKPEEINAIMNDFNEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMALIIGIYDEPMTPGQCNMIVERLGDYLL  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>gb|AFG16922.1| profilin [Quercus suber]
 gb|AFG16924.1| profilin [Quercus suber]
Length=131

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AFG16923.1| profilin [Quercus suber]
Length=131

 Score =   217 bits (553),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ABW37745.1| Ama v 1.02 allergen [Amaranthus viridis]
Length=131

 Score =   217 bits (552),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+L+AAAILG DGS+WAQSA+FP+F P+EI AI++DFDEPG+LAPTGLHL
Sbjct  8    DDHLMCDIDGNRLSAAAILGTDGSVWAQSASFPQFRPEEIEAIVKDFDEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+CVKKT Q L+ G+YDEP+TPGQCNM++ERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGIYDEPVTPGQCNMIIERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010047296.1| PREDICTED: profilin [Eucalyptus grandis]
Length=131

 Score =   217 bits (552),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN L AAAI+GHDGS+WAQS++FP+F P+EI  I+RDFDEPG+LAPTGL+L
Sbjct  8    DEHLMCEIEGNHLAAAAIIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKGPGG+ +KKTT  L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPNAVIRGKKGPGGVTIKKTTMALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>sp|A4GFC4.1|PROCH_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33906.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|Q9XF38.1|PROF_PYRCO RecName: Full=Profilin; AltName: Full=Allergen Pyr c 3; AltName: 
Allergen=Pyr c 4 [Pyrus communis]
 gb|AAD29410.1| profilin [Pyrus communis]
Length=131

 Score =   216 bits (550),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WAQS+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT+Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|ABB76134.1| profilin 1 [Mangifera indica]
Length=131

 Score =   216 bits (550),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ LTAAAI+G DGS+WAQSANFPK NP+EI AI +DFDEPGSLAPTGLHL
Sbjct  8    DEHLMCDIEGHHLTAAAIVGLDGSVWAQSANFPKLNPEEITAINKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT    + G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMAFVIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|A4GFC2.1|PROCF_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33904.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   216 bits (549),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAA++GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAVIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|KCW79179.1| hypothetical protein EUGRSUZ_C00615, partial [Eucalyptus grandis]
Length=193

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN L AAAI+GHDGS+WAQS++FP+F P+EI  I+RDFDEPG+LAPTGL+L
Sbjct  70   DEHLMCEIEGNHLAAAAIIGHDGSVWAQSSSFPQFKPEEITGIMRDFDEPGTLAPTGLYL  129

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKGPGG+ +KKTT  L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  130  GGTKYMVIQGEPNAVIRGKKGPGGVTIKKTTMALIIGIYDEPMTPGQCNMIVERLGDYLV  189

Query  301  DQGY  290
            DQG+
Sbjct  190  DQGF  193



>sp|Q9M7N0.1|PROF3_HEVBR RecName: Full=Profilin-3; AltName: Full=Pollen allergen Hev b 
8.0201; AltName: Allergen=Hev b 8.0201 [Hevea brasiliensis]
 gb|AAF34341.1|AF119365_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   216 bits (549),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+G+ LTAAAI+GHDGS+WAQS++FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ADB93072.1| profilin-1 [Jatropha curcas]
 gb|KDP33778.1| hypothetical protein JCGZ_07349 [Jatropha curcas]
Length=131

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN L+AAAI+G DGS+WAQS+ FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIEGNHLSAAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AFG16926.1| profilin [Quercus suber]
Length=131

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPG+CN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGRCNIIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_007223916.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
 gb|EMJ25115.1| hypothetical protein PRUPE_ppa013278mg [Prunus persica]
Length=131

 Score =   214 bits (546),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQS++FPKF P+EIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGE GAV+RGKKG GG+ VKKT Q ++FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   AGTKYMVIQGEGGAVIRGKKGSGGITVKKTGQAMIFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|A4GFB9.1|PROCD_OLEEU RecName: Full=Profilin-4; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 gb|ABG33901.1| Ole e 2 allergen [Olea europaea]
Length=131

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVI+GEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIRGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGQCNIIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_011081736.1| PREDICTED: profilin [Sesamum indicum]
Length=131

 Score =   214 bits (546),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+GN LT+AAI+GHDG++WAQSANFP+F  +EIAAI+ DF+EPG LAPTGLHL
Sbjct  8    DDHLMCEIDGNHLTSAAIIGHDGAVWAQSANFPQFKAEEIAAIMDDFEEPGKLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q LL G+YDEPMTPGQCNMVVER+GDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITVKKTNQALLIGIYDEPMTPGQCNMVVERIGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AFG16925.1| profilin [Quercus suber]
Length=131

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG  LTAAAI+GHDGS+WAQSA FP+F P+E+ AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGQHLTAAAIIGHDGSVWAQSATFPQFKPEEVVAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+TPG+CN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGIYDEPLTPGRCNIIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010526418.1| PREDICTED: profilin [Tarenaya hassleriana]
Length=131

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN L+AAAILG DGS+WAQS+NFP+F P+EI AI++DFDEPG+LAPTGL L
Sbjct  8    DDHLMCDVEGNCLSAAAILGQDGSVWAQSSNFPQFKPEEITAIMKDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKTTQ L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTQALVIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>ref|XP_009344483.1| PREDICTED: profilin [Pyrus x bretschneideri]
Length=131

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WAQS+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|NP_001235595.1| profilin [Glycine max]
 gb|ABG88188.1| profilin [Glycine max]
Length=131

 Score =   214 bits (545),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+ +G  LTAAAI+GHDGS WAQSANFP+F P EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCETDGQHLTAAAIIGHDGSAWAQSANFPQFKPVEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKKTT+ L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGITVKKTTRALIIGIYDEPMTPGQCNMVVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AAK01236.1|AF327623_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN+L AAAI+GHDGS+WAQS+ FP+  P+EI  ++ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT+Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010033829.1| PREDICTED: profilin [Eucalyptus grandis]
 gb|KCW53663.1| hypothetical protein EUGRSUZ_J02930 [Eucalyptus grandis]
Length=131

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ L AAAI+GHDGS+WAQS+ FP+F PQEIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLAAAAIVGHDGSVWAQSSAFPQFKPQEIAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGE GAV+RGKKG GG+ VKKTTQ L+FG+Y+EP+TPGQCNMVVER+GDYL+
Sbjct  68   AGAKYMVIQGEDGAVIRGKKGAGGVTVKKTTQALIFGIYEEPLTPGQCNMVVERMGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_004291152.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   214 bits (544),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+GN LTAAAILG DGS+W+QS+NFP+F P+EIAAI++DFD+PG+LAPTGL L
Sbjct  8    DEHLMCDIDGNSLTAAAILGQDGSVWSQSSNFPQFKPEEIAAIMKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGVTVKKTNQALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010668781.1| PREDICTED: profilin-3-like [Beta vulgaris subsp. vulgaris]
Length=133

 Score =   213 bits (543),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMC+IEG  N LTAAAILG DGS+WAQS+ FP+F P EIAA+++DFDEPG+LAPTGL
Sbjct  8    DEHLMCEIEGTNNHLTAAAILGIDGSVWAQSSAFPQFKPDEIAAVVKDFDEPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKGPGG+CVKKT Q L+ GLYDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGLYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>sp|A4KA41.1|PROF5_CORAV RecName: Full=Profilin-5; AltName: Full=Allergen Cor a 2; AltName: 
Full=Pollen allergen Cor a 2; AltName: Allergen=Cor a 
2 [Corylus avellana]
 gb|ABG81298.1| pollen profilin variant 3 [Corylus avellana]
Length=131

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ L+AAAI+GHDGS+WAQS+ FP+F P+EIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DEHLMCEIDGHHLSAAAIIGHDGSVWAQSSTFPQFKPEEIAAIIKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT+Q L+FG+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGIKYMVIQGESGAVIRGKKGAGGITVKKTSQALIFGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
             QG
Sbjct  128  KQG  130



>sp|Q9LEI8.1|PROF6_HEVBR RecName: Full=Profilin-6; AltName: Full=Pollen allergen Hev b 
8.0204; AltName: Allergen=Hev b 8.0204 [Hevea brasiliensis]
 emb|CAB96215.1| profilin [Hevea brasiliensis]
Length=131

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G++LTAAAI+GHDGS+WAQS++FP+F   E+AA+++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_004290829.1| PREDICTED: profilin-3-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEG+ LTAAAI+GHD S+WAQS++FP+F P+E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGHHLTAAAIVGHDSSVWAQSSSFPQFKPEEVAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q ++ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGESGAVIRGKKGSGGITVKKTGQAMILGIYDEPITPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AAX19855.1| profilin 1 [Malus domestica]
 gb|AAX19856.1| profilin 1 [Malus domestica]
Length=131

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WAQS+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQDLVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|EPS66446.1| profilin, partial [Genlisea aurea]
Length=130

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+GN LT+AAI+GHDG +WAQS+ FP+F   EIAAI+ DFDEPG LAPTGLHL
Sbjct  8    DEHLMCEIDGNHLTSAAIIGHDGLVWAQSSTFPEFTADEIAAIVEDFDEPGKLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG+V+RGKKG GG+ VKKTTQ LLFG+YDEPMTPGQCN+VVER+GDYL+
Sbjct  68   GGIKYMVIQGEPGSVIRGKKGSGGITVKKTTQALLFGIYDEPMTPGQCNIVVERIGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_009367418.1| PREDICTED: profilin-3-like [Pyrus x bretschneideri]
Length=131

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN LTAAAILG DGS+WAQSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNSLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPLTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAD46559.1| profilin [Malus domestica]
 gb|AAX19852.1| profilin 1 [Malus domestica]
Length=131

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_011005518.1| PREDICTED: profilin-6-like [Populus euphratica]
Length=131

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LT+AAI+GHDGS+WAQSA+FP+F  +E++AI++DF+EPGSLAPTGL L
Sbjct  8    DDHLMCDIEGNTLTSAAIIGHDGSVWAQSASFPQFTQEEVSAIMKDFEEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|Q9M7M9.1|PROF4_HEVBR RecName: Full=Profilin-4; AltName: Full=Pollen allergen Hev b 
8.0202; AltName: Allergen=Hev b 8.0202 [Hevea brasiliensis]
 gb|AAF34342.1|AF119366_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G++LTAAAI+GHDGS+WAQS++FP+F   E+AAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT+Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>pdb|1G5U|A Chain A, Latex Profilin Hevb8
 pdb|1G5U|B Chain B, Latex Profilin Hevb8
Length=131

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G++LTAAAI+GHDGS+WAQS++FP+F   E+AA+++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VK+T Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|Q9XF42.1|PROF3_MALDO RecName: Full=Profilin-3; AltName: Full=GD4-5; AltName: Full=Pollen 
allergen Mal d 4.0101; AltName: Allergen=Mal d 4.0101 
[Malus domestica]
 gb|AAD29414.1|AF129428_1 profilin [Malus domestica]
 gb|AAX19861.1| profilin 3 [Malus domestica]
 gb|AAX19862.1| profilin 3 [Malus domestica]
 gb|AAX19863.1| profilin 3 [Malus domestica]
 gb|AAX19864.1| profilin 3 [Malus domestica]
 emb|CAK93744.1| profilin [Malus domestica]
 emb|CAK93749.1| profilin [Malus domestica]
Length=131

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA+FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAK93753.1| profilin [Malus domestica]
 emb|CAK93761.1| profilin [Malus domestica]
 emb|CAK93762.1| profilin [Malus domestica]
Length=131

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN LTAAAILG DGS+WAQSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNSLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010267106.1| PREDICTED: profilin-1 [Nelumbo nucifera]
 ref|XP_010267107.1| PREDICTED: profilin-1 [Nelumbo nucifera]
Length=131

 Score =   212 bits (539),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAI+G DGS+WAQSA FP+F P+E+ AI+ DF+EPGSLAPTGLHL
Sbjct  8    DDHLMCEIEGNHLTAAAIIGQDGSVWAQSATFPQFKPEEVTAIMNDFNEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEP+ PGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGITVKKTNQALIFGVYDEPLAPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_006655796.1| PREDICTED: profilin LP04-like [Oryza brachyantha]
Length=131

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+GN LTAAAILGHDG++WAQS NFP++ P+EI AI++DFDEPGSLAPTGL L
Sbjct  8    DDHLMCEIDGNHLTAAAILGHDGTVWAQSPNFPQYKPEEITAIMKDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+CVKKTT  L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGTGGICVKKTTLSLVMGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008365251.1| PREDICTED: profilin [Malus domestica]
Length=131

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAXSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_002514199.1| profilin, putative [Ricinus communis]
 sp|O82572.1|PROF1_RICCO RecName: Full=Profilin-1 [Ricinus communis]
 gb|AAC62482.1| profilin [Ricinus communis]
 gb|EEF48153.1| profilin, putative [Ricinus communis]
Length=131

 Score =   212 bits (539),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LT+AAI+G DGS+WAQS+ FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLTSAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   SGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|KHG29269.1| Profilin-1 [Gossypium arboreum]
Length=131

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN L+AAAI+G DGS+WAQS+NFP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DDHLMCDIEGNHLSAAAIIGQDGSVWAQSSNFPQFKPEEITGIMNDFSEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|Q9STB6.1|PROF2_HEVBR RecName: Full=Profilin-2; AltName: Full=Pollen allergen Hev b 
8.0102; AltName: Allergen=Hev b 8.0102 [Hevea brasiliensis]
 emb|CAB51914.1| profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+G DGS+WAQSANFP+F  +EI  I+ DF EPG+LAPTGL++
Sbjct  8    DDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGIMSDFHEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>ref|XP_008233911.1| PREDICTED: profilin-like [Prunus mume]
Length=131

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G  LTAAAI+GHDGS+WAQS++FPKF P+EIAAI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGQHLTAAAIVGHDGSVWAQSSSFPKFKPEEIAAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGE GAV+RGKKG GG+ VKKT Q ++FG+Y+EP+TPGQCN++VERLGDYL+
Sbjct  68   AGTKYMVIQGEGGAVIRGKKGSGGITVKKTGQAMIFGIYEEPLTPGQCNIIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010668774.1| PREDICTED: profilin-3 [Beta vulgaris subsp. vulgaris]
Length=133

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMC+IEG  N L+AAAILG DGS+WAQS++FP+F P+EIAAI++DFDEPGSLAPTGL
Sbjct  8    DEHLMCEIEGTANHLSAAAILGLDGSVWAQSSSFPQFKPEEIAAIVKDFDEPGSLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
             LGG KYMVIQGEPGAV+RGKKGPGG+CVKKT Q L+ GLYDEP+TPGQCNM+VERLGDY
Sbjct  68   FLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTGQALVIGLYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L++QG
Sbjct  128  LIEQG  132



>gb|AFK38257.1| unknown [Lotus japonicus]
 gb|AFK44821.1| unknown [Lotus japonicus]
Length=131

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L++AAILG DGS+WAQSANFP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DDHLLCEIEGNHLSSAAILGQDGSVWAQSANFPQFKPEEITGIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>emb|CAN67015.1| hypothetical protein VITISV_041272 [Vitis vinifera]
 emb|CBI20595.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   211 bits (537),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAILG DGS+WAQSA FP+F P+EI AI+ DF EPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGNHLTAAAILGQDGSVWAQSATFPQFKPEEITAIMTDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG C+KKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGACIKKTIQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AAK01235.1|AF327622_1 minor allergen hazelnut profilin [Corylus avellana]
Length=131

 Score =   211 bits (537),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN+L AAAI+GHDGS+WAQS+ FP+  P+EI  ++ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGVMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+R KKGPGG+ VKKT+Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_008380843.1| PREDICTED: profilin [Malus domestica]
Length=131

 Score =   211 bits (537),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAXSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQXLVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|NP_001234138.1| profilin [Solanum lycopersicum]
 ref|XP_010313200.1| PREDICTED: profilin isoform X1 [Solanum lycopersicum]
 gb|AAL29690.1| profilin [Solanum lycopersicum]
Length=131

 Score =   211 bits (537),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LT+AAI+G DGS+WAQSANFP+F P+EI AI+ DF EPG+LAPTGLHL
Sbjct  8    DDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAIMNDFAEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDY++
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYII  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010915373.1| PREDICTED: profilin isoform X2 [Elaeis guineensis]
Length=131

 Score =   211 bits (537),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G  LTAAAI+GHDGS+WAQ ANFP+F P+EI AI+ DFDEPGSLAPTGL+L
Sbjct  8    DDHLMCEIDGQHLTAAAIVGHDGSVWAQMANFPQFKPEEITAIMNDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG+V+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGSVIRGKKGSGGVTVKKTNLALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>gb|AIV43661.1| profilin, partial [Bassia scoparia]
Length=133

 Score =   211 bits (537),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDIEG  N LT AAILG DGS+WAQSANFP+F P EIAAI+++FDEPG+LAPTGL
Sbjct  8    DDHLMCDIEGTTNHLTGAAILGVDGSVWAQSANFPQFKPDEIAAIVKEFDEPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE G V+RGKKGPGG+CVKKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            LV+QG
Sbjct  128  LVEQG  132



>sp|P0C0Y3.1|PROF_FRAAN RecName: Full=Profilin; AltName: Allergen=Fra a 4 [Fragaria x 
ananassa]
Length=131

 Score =   211 bits (536),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+G DGS+WAQSA FP+  P+E+  I+RDFDEPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGQDGSVWAQSATFPQLKPEEVTGIVRDFDEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKTT  LL G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004503498.1| PREDICTED: profilin-1-like [Cicer arietinum]
Length=131

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+CDIEGN LT+AAILG DGS+WAQS NFP+F P+EI  I+ DF EPG+LAPTGL++
Sbjct  8    DEHLLCDIEGNHLTSAAILGQDGSVWAQSHNFPQFKPEEITGIMNDFAEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|Q9M7M8.1|PROF5_HEVBR RecName: Full=Profilin-5; AltName: Full=Pollen allergen Hev b 
8.0203; AltName: Allergen=Hev b 8.0203 [Hevea brasiliensis]
 gb|AAF34343.1|AF119367_1 latex profilin Hev b 8 [Hevea brasiliensis]
Length=131

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G++LTAAAI+GHDGS+WAQS+ FP+F   E+AA+++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAVMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPLTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAT99617.1| profilin [Malus domestica]
Length=131

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+E +TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEETLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_007012986.1| Profilin 1 isoform 1 [Theobroma cacao]
 ref|XP_007012987.1| Profilin 1 isoform 1 [Theobroma cacao]
 gb|EOY30605.1| Profilin 1 isoform 1 [Theobroma cacao]
 gb|EOY30606.1| Profilin 1 isoform 1 [Theobroma cacao]
Length=131

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+G +GS+WAQS+NFP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGQEGSVWAQSSNFPQFKPEEINGIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|KHF97992.1| Profilin [Gossypium arboreum]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+G DGS+WAQSA+FP+  P+EI+AI+ DF+EPGSLAPTGLHL
Sbjct  8    DDHLMCEIEGNHLSAAAIIGQDGSVWAQSASFPQLKPEEISAIMNDFNEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNMALIIGIYDEPMTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|NP_001275370.1| profilin-like protein [Solanum tuberosum]
 gb|ABB16985.1| profilin-like protein [Solanum tuberosum]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+C+IEGN LT+AAI+G DG++WAQSANFP+F P+EI+ I+ DF EPG+LAPTGL+L
Sbjct  8    DEHLLCEIEGNHLTSAAIVGQDGTVWAQSANFPQFKPEEISGIMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_007202751.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 ref|XP_007202752.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 ref|XP_008242468.1| PREDICTED: profilin [Prunus mume]
 gb|ACE80972.1| putative allergen Pru du 4.02 [Prunus dulcis x Prunus persica]
 gb|ACE80973.1| putative allergen Pru p 4.02 [Prunus dulcis x Prunus persica]
 gb|EMJ03950.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
 gb|EMJ03951.1| hypothetical protein PRUPE_ppa013285mg [Prunus persica]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  IL DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|Q8GT39.1|PROF_PRUPE RecName: Full=Profilin; AltName: Allergen=Pru p 4.02 [Prunus 
persica]
 emb|CAD37202.1| profilin [Prunus persica]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  IL DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGILNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLALLIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AFK40156.1| unknown [Medicago truncatula]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT AAILG DGS+WAQSANFP+F P+EI+AI +DFDEPG+LAPTGLH+
Sbjct  8    DDHLLCDIEGNHLTHAAILGVDGSVWAQSANFPQFKPEEISAINKDFDEPGTLAPTGLHI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009350242.1| PREDICTED: profilin [Pyrus x bretschneideri]
 ref|XP_009350243.1| PREDICTED: profilin [Pyrus x bretschneideri]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+WAQSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AAX19853.1| profilin 1 [Malus domestica]
 gb|AAX19854.1| profilin 1 [Malus domestica]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+E +TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEETLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|O65812.1|PROF1_HEVBR RecName: Full=Profilin-1; AltName: Full=Pollen allergen Hev b 
8.0101; AltName: Allergen=Hev b 8.0101 [Hevea brasiliensis]
 emb|CAA75312.1| profilin [Hevea brasiliensis]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DE LMC+IEGN LTAAAI+G DGS+WAQS+NFP+F  +EI AI+ DFDEPG+LAPTGLHL
Sbjct  8    DERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKGPGG+ V+KT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004302848.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDI+GN L +AAI+GHDGS+WAQS+NFPKF P+EI AI++DFDEPG+LAPTGLHL
Sbjct  8    DDHLLCDIDGNHLASAAIVGHDGSVWAQSSNFPKFKPEEITAIMKDFDEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   AGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_009628677.1| PREDICTED: profilin-1 [Nicotiana tomentosiformis]
 ref|XP_009776401.1| PREDICTED: profilin-1-like [Nicotiana sylvestris]
Length=131

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+CDIEGN LTAAAI+GHDG++WAQS+NFP+F P+EI AI+ DF+EPG+LAPTGLHL
Sbjct  8    DEHLLCDIEGNHLTAAAIVGHDGAVWAQSSNFPQFKPEEIKAIMNDFEEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMV+QGE G V+RGKKGPGG+ +KKT   +L G+YDEPMTPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVLQGEAGVVIRGKKGPGGITIKKTNMAILIGIYDEPMTPGQCNLVVERLGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_006340251.1| PREDICTED: profilin-like [Solanum tuberosum]
Length=131

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LT+AAI+GHDGS+WAQSANFP+F P+EI AI+ DF EPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGNYLTSAAIIGHDGSVWAQSANFPQFKPEEITAIMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGAGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010536838.1| PREDICTED: profilin-like [Tarenaya hassleriana]
Length=131

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN LTAAAILG DGS+WAQSA+FP+FNP EIA I+ DFDEPG+LAPTGL L
Sbjct  8    DDHLMCDVEGNHLTAAAILGEDGSVWAQSAHFPQFNPDEIAGIISDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q ++ G+YDEPM PGQCNMVVERLGDYL+
Sbjct  68   GGVKYMVIQGEPGAVIRGKKGPGGVTIKKTNQAMVIGIYDEPMAPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>gb|AFK47285.1| unknown [Lotus japonicus]
Length=131

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT+AAILG DGS+WAQS NFP+F P+EI  I+ DF EPG+LAPTGL++
Sbjct  8    DDHLLCDIEGNHLTSAAILGQDGSVWAQSTNFPQFKPEEITGIMNDFAEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAD37201.1| profilin [Prunus persica]
Length=131

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ABA81885.1| profilin-like [Solanum tuberosum]
Length=131

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+C+IEGN LT+AAI+G DG++WAQSANFP+F P+EI  ++ DF EPG+LAPTGL+L
Sbjct  8    DEHLLCEIEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGVMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_002324161.1| profilin 2 family protein [Populus trichocarpa]
 ref|XP_006371869.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 ref|XP_006371870.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 gb|ABK92706.1| unknown [Populus trichocarpa]
 gb|ABK92792.1| unknown [Populus trichocarpa]
 gb|ABK94118.1| unknown [Populus trichocarpa]
 gb|EEF02726.1| profilin 2 family protein [Populus trichocarpa]
 gb|ERP49666.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
 gb|ERP49667.1| hypothetical protein POPTR_0018s04840g [Populus trichocarpa]
Length=131

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LT+AAI+GHDGS+WA SA+FP+F  +E++AI++DF+EPGSLAPTGL L
Sbjct  8    DDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|ADB96066.1| profilin [Arachis hypogaea]
Length=131

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D HL+C+IEGN L++AAILG DGS+WAQS+NFP+F P+EI AI+ DF EPGSLAPTGL+L
Sbjct  8    DNHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            D G
Sbjct  128  DTG  130



>ref|XP_003564327.1| PREDICTED: profilin-1 [Brachypodium distachyon]
Length=131

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LTAAAILG DGS+W+QS NFP+F P++I AI++DFDEPG+LAPTGL  
Sbjct  8    DEHLMCEIEGNHLTAAAILGQDGSVWSQSDNFPQFKPEQITAIMKDFDEPGTLAPTGLFF  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G +KYMVIQGEPG V+RGKKGPGG+ +KKT Q LL G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GSEKYMVIQGEPGVVIRGKKGPGGITIKKTGQALLVGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_007024334.1| Profilin 5 [Theobroma cacao]
 gb|EOY26956.1| Profilin 5 [Theobroma cacao]
Length=132

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 114/124 (92%), Gaps = 1/124 (1%)
 Frame = -2

Query  661  DEHLMCDIE-GNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLH  485
            D+HLMC+I+ G+ L+AAAI+GHDGS+WAQS +FP+F P+EI AI++DFDEPGSLAP+GLH
Sbjct  8    DDHLMCEIDSGHHLSAAAIIGHDGSVWAQSTSFPQFKPEEIIAIMKDFDEPGSLAPSGLH  67

Query  484  LGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYL  305
            LGG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FGLYDEP+TPGQCNMVVERLGDYL
Sbjct  68   LGGTKYMVIQGEPGAVIRGKKGAGGITVKKTGQALIFGLYDEPVTPGQCNMVVERLGDYL  127

Query  304  VDQG  293
            VDQG
Sbjct  128  VDQG  131



>ref|XP_008220131.1| PREDICTED: profilin [Prunus mume]
 sp|Q8GSL5.1|PROF_PRUDU RecName: Full=Profilin; AltName: Allergen=Pru du 4 [Prunus dulcis]
 gb|AAL91662.1| profilin [Prunus dulcis]
 gb|AAL91664.1| profilin [Prunus dulcis]
 gb|ACE80970.1| putative allergen Pru du 4.01 [Prunus dulcis x Prunus persica]
 gb|ACE80971.1| putative allergen Pru p 4.01 [Prunus dulcis x Prunus persica]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010688354.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
 ref|XP_010688355.1| PREDICTED: profilin [Beta vulgaris subsp. vulgaris]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LT+AAI+GHDG++WAQS +FP+  P E+AAI++DF+EPG+LAPTGLHL
Sbjct  8    DDHLMCDIEGNHLTSAAIVGHDGNVWAQSPSFPQLKPGEVAAIMKDFEEPGTLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG+V+RGKKGPGG+ V KT Q L+ G+YDEPMTPGQCNMVVER+GDYLV
Sbjct  68   GGTKYMVIQGEPGSVIRGKKGPGGVTVNKTNQALIIGIYDEPMTPGQCNMVVERIGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008337609.1| PREDICTED: profilin-2 [Malus domestica]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ACP43298.1| Ama r 2 pollen allergen, partial [Amaranthus retroflexus]
Length=133

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 2/126 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+IEG  N LT AAILG DGS+WAQSA+FP+F P EIAAI+ DFDEPG+LAPTGL
Sbjct  8    DDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIAAIVEDFDEPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKG GG+CVKKT Q L+ G+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTGQALVMGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQGY  290
            L++QGY
Sbjct  128  LIEQGY  133



>ref|XP_004287490.1| PREDICTED: profilin-like [Fragaria vesca subsp. vesca]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+G DGS+WAQSA FP+  P+E+  I++DFDEPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGQDGSVWAQSATFPQLKPEEVTGIVKDFDEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKTT  LL G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTTLALLIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|Q9XF40.1|PROF1_MALDO RecName: Full=Profilin-1; AltName: Full=GD4-1; AltName: Full=Pollen 
allergen Mal d 4.0301; AltName: Allergen=Mal d 4.0301 
[Malus domestica]
 gb|AAD29412.1|AF129426_1 profilin [Malus domestica]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+ LMCDI+G+ LTAAAILGHDGS+WA S+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+FG+Y+EP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQALVFGIYEEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_009796122.1| PREDICTED: profilin-2 [Nicotiana sylvestris]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT+AAI+G DG++WAQSANFP+F P+EI  I++DF EPG+LAPTGL+L
Sbjct  8    DDHLLCEIEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGIMKDFVEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008798583.1| PREDICTED: profilin-1 [Phoenix dactylifera]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+++G  LTAAAI+GHDGS+WAQSANFP+F P+EI AI+ DF+EPGSLAPTGL L
Sbjct  8    DDHLMCEMDGQHLTAAAIVGHDGSVWAQSANFPQFKPEEITAIMNDFNEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG+V+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGSVIRGKKGSGGVTVKKTNLALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>ref|XP_010541007.1| PREDICTED: profilin-2 [Tarenaya hassleriana]
Length=131

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+L AAAILG DGS+WAQS+ FP+F  +EI AI++DFDEPG+LAPTGL L
Sbjct  8    DDHLMCDVEGNRLAAAAILGQDGSVWAQSSGFPQFKSEEITAIMKDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALVIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>emb|CAD46561.1| profilin [Malus domestica]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G +LTAAAILG DGS+W+QSA+FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGYRLTAAAILGQDGSVWSQSASFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAK93757.1| profilin [Malus domestica]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN LTAAAILG  GS+WAQSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNSLTAAAILGQGGSVWAQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q LL G+YDEP+TPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQALLIGIYDEPVTPGQCNIVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_003630698.1| Profilin [Medicago truncatula]
 gb|ACJ83967.1| unknown [Medicago truncatula]
 gb|ACJ86124.1| unknown [Medicago truncatula]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT AAILG DGS+WAQSANFP+F P+EI AI +DFDEPG+LAPTGLH+
Sbjct  8    DDHLLCDIEGNHLTHAAILGVDGSVWAQSANFPQFKPEEINAINKDFDEPGTLAPTGLHI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008799778.1| PREDICTED: profilin-1 [Phoenix dactylifera]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCD++G  LTAAAI+GHDGS+WAQS++FP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DEHLMCDLDGQHLTAAAIVGHDGSVWAQSSSFPQFKPEEITNIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AFK47224.1| unknown [Lotus japonicus]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT+AAILG DGS+WAQS NFP+F P+EI  I+ DF EPG+LAPTGL++
Sbjct  8    DDHLLCDIEGNHLTSAAILGQDGSVWAQSTNFPQFKPEEITGIMDDFAEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008794098.1| PREDICTED: profilin-like [Phoenix dactylifera]
Length=131

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G  LT AAI+GHDGS+WAQSANFP+F P+EIAAI+ DF EPGSLAPTGL+L
Sbjct  8    DDHLMCEIDGQHLTTAAIVGHDGSVWAQSANFPQFKPEEIAAIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPG+V+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GATKYMVIQGEPGSVIRGKKGSGGVTVKKTNLALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>emb|CAK93713.1| profilin [Malus domestica]
 emb|CAK93718.1| profilin [Malus domestica]
 emb|CAK93723.1| profilin [Malus domestica]
 emb|CAK93731.1| profilin [Malus domestica]
 emb|CAK93736.1| profilin [Malus domestica]
 emb|CAK93739.1| profilin [Malus domestica]
Length=131

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008795502.1| PREDICTED: profilin-1-like [Phoenix dactylifera]
Length=131

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILGHDGS+WAQS++FP+F  +EI  I+ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_002274966.2| PREDICTED: profilin-1 [Vitis vinifera]
Length=191

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAILG DGS+WAQSA FP+F P+EI AI+ DF EPG+LAPTGL+L
Sbjct  68   DDHLMCEIEGNHLTAAAILGQDGSVWAQSATFPQFKPEEITAIMTDFAEPGTLAPTGLYL  127

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG C+KKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  128  GGTKYMVIQGEPGAVIRGKKGSGGACIKKTIQALIIGIYDEPLTPGQCNMIVERLGDYLI  187

Query  301  DQG  293
            DQG
Sbjct  188  DQG  190



>sp|Q93YI9.1|PROF_CAPAN RecName: Full=Profilin; AltName: Full=Minor food allergen Cap 
a 2; AltName: Allergen=Cap a 2 [Capsicum annuum]
 emb|CAD10376.1| profilin [Capsicum annuum]
Length=131

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN+LT+AAI+G DGS+WAQSA FP+F P+EI AI+ DF EPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAIMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKGPGG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQ  296
            +Q
Sbjct  128  EQ  129



>gb|AAX19857.1| profilin 2 [Malus domestica]
 gb|AAX19858.1| profilin 2 [Malus domestica]
Length=131

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|EPS59245.1| profilin [Genlisea aurea]
Length=131

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAI+G DG +WAQS+NFP+F P+EIAAIL DF+EPG LAP GL+L
Sbjct  8    DDHLMCDIDGNQLTAAAIVGLDGFVWAQSSNFPQFKPEEIAAILEDFEEPGKLAPLGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q LLFG+YDEPMTPGQCN+VVER+GDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALLFGIYDEPMTPGQCNVVVERIGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_007223783.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 ref|XP_007223784.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 gb|EMJ24982.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
 gb|EMJ24983.1| hypothetical protein PRUPE_ppa010614mg [Prunus persica]
Length=243

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F P+EIAAIL+DFD+PG+LAPTGL L
Sbjct  120  DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFL  179

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  180  GGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  239

Query  301  DQG  293
            +QG
Sbjct  240  EQG  242



>sp|Q84V37.1|PROF_CHEAL RecName: Full=Profilin; AltName: Full=Minor pollen allergen Che 
a 2; AltName: Allergen=Che a 2 [Chenopodium album]
 gb|AAL92870.1| pollen allergen Che a 2 [Chenopodium album]
Length=131

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN L++AAILGHDG++WAQS +FP+  P+E++AI++DF+EPGSLAPTGLHL
Sbjct  8    DDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAIMKDFNEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+Y EPMTPGQCNMVVER+GDYLV
Sbjct  68   GGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQALIIGIYGEPMTPGQCNMVVERIGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_006353502.1| PREDICTED: profilin-1-like [Solanum tuberosum]
Length=131

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+CDIEGN L+AAAI+G DG++WA+S+ FP+F P EI AIL DF+EPGSLAPTGLHL
Sbjct  8    DEHLLCDIEGNHLSAAAIIGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE G V+RGKKGPGG+ +KKT Q +L G+YDEPMTPGQCN+VVERLGDYL+
Sbjct  68   GGSKYMVIQGESGVVIRGKKGPGGITIKKTGQAILIGIYDEPMTPGQCNLVVERLGDYLI  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>ref|XP_010914952.1| PREDICTED: profilin-1 [Elaeis guineensis]
Length=131

 Score =   209 bits (531),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            +EHLMC+I+G  LTAAAI+GHDGS+WAQS++FP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    EEHLMCEIDGQHLTAAAIVGHDGSVWAQSSSFPQFKPEEITNIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AAQ63002.1| oil palm profilin-like allergen PF2 [Elaeis guineensis]
Length=131

 Score =   209 bits (531),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILG DGS+WAQS++FP F P+EI  I+ DF EPGSLAPTGL L
Sbjct  8    DEHLMCEIDGHHLTAAAILGQDGSVWAQSSSFPPFKPEEITGIMNDFAEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKGPGG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGPGGITVKKTNQALVFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_004251645.1| PREDICTED: profilin-1 [Solanum lycopersicum]
Length=131

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L+AAAI+G DG++WA+S+ FP+F P EI AIL DF+EPGSLAPTGLHL
Sbjct  8    DDHLLCEIEGNHLSAAAIVGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ +KKT Q LL G+YDEPMTPGQCN+VVERLGDYLV
Sbjct  68   GGSKYMVIQGEPGVVIRGKKGPGGITIKKTNQALLIGIYDEPMTPGQCNLVVERLGDYLV  127

Query  301  DQGY  290
            +QGY
Sbjct  128  EQGY  131



>ref|XP_011019559.1| PREDICTED: profilin [Populus euphratica]
Length=131

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+GN LT+AAI+GHDGS+WAQSA FP+F  +E+AAI++DFDEPGSLAPTGL L
Sbjct  8    DEHLMCDIDGNTLTSAAIIGHDGSVWAQSATFPQFTTEEVAAIMKDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+ G+YDEP+ PGQCNM+VERLGDYL 
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGVTIKKTNQALVIGVYDEPLAPGQCNMIVERLGDYLY  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_002308591.1| profilin 2 family protein [Populus trichocarpa]
 ref|XP_006382037.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
 gb|ABK92737.1| unknown [Populus trichocarpa]
 gb|EEE92114.1| profilin 2 family protein [Populus trichocarpa]
 gb|ERP59834.1| hypothetical protein POPTR_0006s25180g [Populus trichocarpa]
Length=131

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+GN LT+AAI+GHDGS+WAQSA FP+F  +E+AAI++DFDEPGSLAPTGL L
Sbjct  8    DEHLMCDIDGNTLTSAAIIGHDGSVWAQSATFPQFTAEEVAAIMKDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+ G+YDEP+ PGQCNM+VERLGDYL 
Sbjct  68   GGAKYMVIQGEAGAVIRGKKGSGGVTIKKTNQALVIGVYDEPLAPGQCNMIVERLGDYLY  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|O65809.1|PROF1_SOYBN RecName: Full=Profilin-1; AltName: Full=GmPRO1; AltName: Allergen=Gly 
m 3.0101 [Glycine max]
 emb|CAA11756.1| profilin [Glycine max]
Length=131

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT AAI+G DGS+WAQS +FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNMVVER GDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERPGDYLI  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>gb|AAX19859.1| profilin 2 [Malus domestica]
 gb|AAX19860.1| profilin 2 [Malus domestica]
Length=131

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  ++ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGVMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_006451338.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 ref|XP_006475346.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64578.1| hypothetical protein CICLE_v10009877mg [Citrus clementina]
 gb|KDO55853.1| hypothetical protein CISIN_1g032871mg [Citrus sinensis]
Length=131

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L+AAAI+GHDGS+WAQS NFP+  P+EI  I+ DF+EPG+LAPTGL+L
Sbjct  8    DDHLLCEIEGNHLSAAAIIGHDGSVWAQSENFPQLKPEEITGIMNDFNEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT+  L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTSAALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_007217879.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
 ref|XP_008228405.1| PREDICTED: profilin [Prunus mume]
 gb|EMJ19078.1| hypothetical protein PRUPE_ppa013277mg [Prunus persica]
Length=131

 Score =   208 bits (530),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G+ L +AAI+GHDGS+WAQS+ FPKF P+EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDIDGHHLASAAIVGHDGSVWAQSSAFPKFKPEEITAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG  G+ VKKT Q L+FG+YDEP+TPGQCN++VERLGDYL+
Sbjct  68   GGTKYMVIQGEGGAVIRGKKGSSGITVKKTGQALVFGIYDEPLTPGQCNIIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|NP_001288607.1| uncharacterized protein LOC103711216 [Phoenix dactylifera]
 emb|CAD10390.1| profilin [Phoenix dactylifera]
Length=131

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILGHDGS+WAQS++FP+F  +EI  I+ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|Q9XF39.1|PROF_PRUAV RecName: Full=Profilin; AltName: Full=Allergen Pru a 3; AltName: 
Allergen=Pru av 4 [Prunus avium]
 gb|AAD29411.1| profilin [Prunus avium]
Length=131

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F P+EIAAIL+D D+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDLDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ACS34771.1| Sal k 4 pollen allergen [Salsola kali]
Length=133

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+IEG  N LTAAAILG DGS+WAQSANFP+F P EI+A++++FDE G+LAPTGL
Sbjct  8    DDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE G V+RGKKGPGG+CVKKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            LV+QG
Sbjct  128  LVEQG  132



>ref|XP_010047663.1| PREDICTED: profilin-1-like [Eucalyptus grandis]
Length=131

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LT+AAI+G DGS+WAQS+ FP+F P+EIAAI++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCEIEGNHLTSAAIIGCDGSVWAQSSAFPQFKPEEIAAIIKDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT+Q L+ G+YDEPM  GQCN++VERLGDYL+
Sbjct  68   GGMKYMVIQGEPGAVIRGKKGPGGVTVKKTSQALIIGIYDEPMNAGQCNVIVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|Q9XF41.1|PROF2_MALDO RecName: Full=Profilin-2; AltName: Full=GD4-2; AltName: Full=Pollen 
allergen Mal d 4.0201; AltName: Allergen=Mal d 4.0201 
[Malus domestica]
 gb|AAD29413.1|AF129427_1 profilin [Malus domestica]
Length=131

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GH+GS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|KHM99817.1| Profilin-1 [Glycine soja]
Length=131

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEGN LT AAI+G DGS+WAQS +FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>pdb|4ESP|A Chain A, Crystal Structure Of Peanut Allergen Ara H 5
Length=130

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L++AAILG DGS+WAQS+NFP+F P+EI AI+ DF EPGSLAPTGL+L
Sbjct  7    DDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYL  66

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VE+LGDYL+
Sbjct  67   GGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLI  126

Query  301  DQG  293
            D G
Sbjct  127  DTG  129



>gb|AGA84056.1| profilin [Arachis hypogaea]
Length=131

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L++AAILG DGS+WAQS+NFP+F P+EI AI+ DF EPGSLAPTGL+L
Sbjct  8    DDHLLCEIEGNHLSSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VE+LGDYL+
Sbjct  68   GGTKYMVIQGEPGTVIRGKKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMIVEKLGDYLI  127

Query  301  DQG  293
            D G
Sbjct  128  DTG  130



>ref|XP_009404548.1| PREDICTED: profilin-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G +LT+AAI+GHDGS+WAQS +FP++ P+EI+AI++DFDEPGSLAPTGL+L
Sbjct  8    DDHLMCDIDGQRLTSAAIVGHDGSVWAQSDSFPRYKPEEISAIMKDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT   L+FG+Y EPMT GQCNMVVERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIFGIYVEPMTAGQCNMVVERLGDYLF  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>emb|CDP08197.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEG  LT+AAI+GHDG++WAQSANFP F P+EIAAI+ DF EPG+LAPTGL+L
Sbjct  8    DDHLMCEIEGTHLTSAAIIGHDGTVWAQSANFPPFKPEEIAAIMNDFSEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKGPGG+ VKKT   L+ G+YDEPMT GQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGESGAVIRGKKGPGGITVKKTNLALIIGIYDEPMTAGQCNMIVERLGDYLI  127

Query  301  DQGY  290
            DQ +
Sbjct  128  DQSF  131



>ref|NP_001056833.1| Os06g0152100 [Oryza sativa Japonica Group]
 sp|Q5VMJ3.1|PROFX_ORYSJ RecName: Full=Profilin LP04 [Oryza sativa Japonica Group]
 sp|P83647.2|PROFX_ORYSI RecName: Full=Profilin LP04 [Oryza sativa Indica Group]
 dbj|BAD69332.1| putative profilin [Oryza sativa Japonica Group]
 dbj|BAD69068.1| putative profilin [Oryza sativa Japonica Group]
 dbj|BAF18747.1| Os06g0152100 [Oryza sativa Japonica Group]
 gb|EAY99721.1| hypothetical protein OsI_21706 [Oryza sativa Indica Group]
 gb|EAZ35855.1| hypothetical protein OsJ_20153 [Oryza sativa Japonica Group]
 dbj|BAG86802.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00531.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+GN LTAAAI+GHDGS+WAQS NFP++ P+EI  I++DFDEPGSLAPTGL L
Sbjct  8    DDHLMCEIDGNHLTAAAIVGHDGSVWAQSPNFPQYKPEEITGIMKDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+CVKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGTGGICVKKTGLSLILGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|KHG15153.1| Profilin [Gossypium arboreum]
Length=132

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 1/124 (1%)
 Frame = -2

Query  661  DEHLMCDIE-GNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLH  485
            D+HLMC+IE G+ L++AAILG DGS+WAQS+ FP F P+EI AI++DFDEPGSLAPTGLH
Sbjct  8    DDHLMCEIENGHHLSSAAILGLDGSVWAQSSAFPTFKPEEITAIMKDFDEPGSLAPTGLH  67

Query  484  LGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYL  305
            LGG KYMVIQGEPGAVVRGKKG GG+ VKKT Q L+FG+YDEP+TPGQCNMVVERLGDYL
Sbjct  68   LGGAKYMVIQGEPGAVVRGKKGTGGVTVKKTGQALIFGIYDEPVTPGQCNMVVERLGDYL  127

Query  304  VDQG  293
            VDQG
Sbjct  128  VDQG  131



>ref|NP_001237519.1| profilin [Glycine max]
 gb|ABU97472.1| profilin [Glycine max]
 gb|ACU15549.1| unknown [Glycine max]
 gb|KHN16654.1| Profilin-1 [Glycine soja]
Length=131

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT AAI+G DGS+WAQS NFP+F P+EI AI  DF+EPGSLAPTGL++
Sbjct  8    DDHLLCEIEGNHLTHAAIIGQDGSVWAQSTNFPQFKPEEITAINNDFNEPGSLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>emb|CAD46560.1| profilin [Malus domestica]
Length=131

 Score =   207 bits (526),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T   L G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMASLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009120170.1| PREDICTED: profilin-5 [Brassica rapa]
Length=155

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LTAAAILG DGS+WAQSANFP+  P+EI+ I +DF+EPG+LAPTGL +
Sbjct  32   DDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFNEPGTLAPTGLFI  91

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKG GG+ +KKTTQ ++FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  92   GGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTPGQCNMVVERLGDYLI  151

Query  301  DQG  293
            + G
Sbjct  152  ESG  154



>emb|CAD92666.1| profilin [Cucumis melo]
Length=131

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F  +EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_003564682.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+CDI+G +LTAAAILGHDGS+WAQS +FP+  P+E+ A++ DF+EPGSLAPTGL+L
Sbjct  8    DEHLLCDIDGQRLTAAAILGHDGSVWAQSESFPQVKPEEVTAVMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKGPGG+ +KKTT  ++ G+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   AGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTLAIIIGIYEEPMTPGQCNMVVERLGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>sp|P84177.2|PROF1_CITSI RecName: Full=Profilin; AltName: Allergen=Cit s 2 [Citrus sinensis]
 emb|CAI23765.1| profilin [Citrus sinensis]
Length=131

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN+LTAAAILG DGS+W+QSA FP F  +EIAAIL+DFD+PG+LAPTGL L
Sbjct  8    DDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAILKDFDQPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009602785.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=131

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L +AAI+G DG++WAQSANFP+F P+EI  I+ DF EPG+LAPTGL+L
Sbjct  8    DDHLLCEIEGNHLISAAIIGQDGTVWAQSANFPQFKPEEITGIMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+ G+YDEPMTPGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGITIKKTNQALIIGIYDEPMTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_007012985.1| Profilin 5 [Theobroma cacao]
 gb|EOY30604.1| Profilin 5 [Theobroma cacao]
Length=133

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI  +G  LTAAAI+GHDGS+WAQS+ FP+F P EI  I++DFDEPG LAPTGL
Sbjct  8    DEHLMCDIDGQGQHLTAAAIIGHDGSVWAQSSTFPQFKPNEITDIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FGLY+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVFGLYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L DQG
Sbjct  128  LADQG  132



>sp|Q64LH2.1|PROF2_AMBAR RecName: Full=Profilin-2; AltName: Full=Pollen allergen A0418; 
AltName: Allergen=Amb a 8 [Ambrosia artemisiifolia]
 gb|AAP15201.1| profilin-like protein [Ambrosia artemisiifolia]
Length=131

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDG +WAQSA FP+  P+EI  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKTT  L+ G+YDEPM PGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMALIIGIYDEPMAPGQCNMIVERLGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_010924449.1| PREDICTED: profilin-1-like [Elaeis guineensis]
Length=131

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILG DGS+WAQS++FP F P+EI  I+ DF EPGSLAPTGL L
Sbjct  8    DEHLMCEIDGHHLTAAAILGQDGSVWAQSSSFPPFKPEEITGIMNDFAEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALVFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AAP15200.1| profilin-like protein [Humulus scandens]
Length=131

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+GN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPG+LAPTGL+L
Sbjct  8    DDHLMCEIDGNHLSAAAIIGHDGSVWAQSAAFPQLKPEEVTGIMNDFNEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGVTIKKTSQALIIGVYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AAQ63003.1| oil palm profilin-like allergen PF3 [Elaeis guineensis]
 gb|AAQ63004.1| oil palm profilin-like allergen PF4 [Elaeis guineensis]
Length=131

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILG DGS+WAQS++FP F P+EI  I+ DF EPGSLAPTGL L
Sbjct  8    DEHLMCEIDGHHLTAAAILGQDGSVWAQSSSFPPFKPEEITGIMNDFAEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALVFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010925517.1| PREDICTED: profilin-1-like [Elaeis guineensis]
Length=175

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN+L+AAAI+GHDG +WAQS  FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  52   DDHLMCEIEGNRLSAAAIVGHDGFVWAQSDTFPQFKPEEIVAIMNDFNEPGSLAPTGLYL  111

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ +KKT Q L+ G+YDEP+TPG CNM+VERLGDYLV
Sbjct  112  GGTKYMVIQGEPGFVIRGKKGPGGVTIKKTNQALIIGIYDEPLTPGLCNMIVERLGDYLV  171

Query  301  DQGY  290
            DQG+
Sbjct  172  DQGF  175



>ref|XP_009389903.1| PREDICTED: profilin-like isoform X4 [Musa acuminata subsp. malaccensis]
Length=131

 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G  LTAAAILGHDGS+WAQSA+FP+F P+EI AI+ DFDEPGSLAPTGL+L
Sbjct  8    DDHLMCEIDGQHLTAAAILGHDGSVWAQSASFPQFKPEEITAIMTDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L+ G+YDEPMT GQCNMVVERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGTGGVTVKKTNLALIIGIYDEPMTGGQCNMVVERLGDYLY  127

Query  301  DQGY  290
            DQ +
Sbjct  128  DQAF  131



>gb|ACV66156.2| profilin [Akebia trifoliata]
Length=131

 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG +L+AAAI+GHDGS+WAQS  FP+  P EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DEHLMCDIEGQRLSAAAIIGHDGSVWAQSEPFPQLKPAEITGIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+YDEP+TPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGVYDEPLTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|NP_001236192.1| profilin-2 [Glycine max]
 sp|O65810.1|PROF2_SOYBN RecName: Full=Profilin-2; AltName: Full=GmPRO2; AltName: Allergen=Gly 
m 3.0102 [Glycine max]
 emb|CAA11755.1| profilin [Glycine max]
Length=131

 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C IEGN LT AAI+G DGS+W QS +FP+F P+EI AI+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>emb|CDY32870.1| BnaC09g33170D [Brassica napus]
Length=131

 Score =   206 bits (524),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LTAAAILG DGS+WAQSANFP+  P+EI  I +DF+EPG+LAPTGL +
Sbjct  8    DDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEINGINKDFNEPGTLAPTGLFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKG GG+ +KKTTQ ++FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>sp|Q9SNW7.1|PROF1_LILLO RecName: Full=Profilin-1 [Lilium longiflorum]
 gb|AAF08302.1|AF200184_1 profilin 1 [Lilium longiflorum]
Length=131

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD++G  LTA+AI+GHDGS+WAQSA FP+F P+EI  I+ DF EPGSLAPTGL+L
Sbjct  8    DDHLMCDVDGQHLTASAIVGHDGSIWAQSAGFPQFKPEEITGIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EPMTPGQCNMVVER+GDYLV
Sbjct  68   AGMKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPMTPGQCNMVVERMGDYLV  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010548681.1| PREDICTED: profilin [Tarenaya hassleriana]
Length=131

 Score =   206 bits (523),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LT+AAI+G DGS+WAQS+ FP+F  +EI AI++DF EPG+LAPTGL L
Sbjct  8    DDHLMCDVEGNRLTSAAIIGQDGSVWAQSSTFPQFKAEEITAIMKDFAEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKGPGG+ +KKT+Q L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPEAVIRGKKGPGGVTIKKTSQALVIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>ref|XP_002283490.1| PREDICTED: profilin-1 [Vitis vinifera]
 emb|CAN80411.1| hypothetical protein VITISV_018934 [Vitis vinifera]
 emb|CBI36040.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   206 bits (523),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+GN LT+AAI+GHDGS+WAQS  FP+F P+EI  I+ DF+EPG LAPTGL+L
Sbjct  8    DDHLMCDIDGNHLTSAAIIGHDGSVWAQSETFPQFKPEEITGIMNDFNEPGFLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNM+VER+GDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALIFGIYEEPLTPGQCNMIVERMGDYLV  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>emb|CDY64971.1| BnaAnng19920D [Brassica napus]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LTAAAILG DGS+WAQSANFP+  P+EI+ I +DF+EPG+LAPTGL +
Sbjct  8    DDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFNEPGTLAPTGLFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP  V+RGKKG GG+ +KKTTQ ++FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPNTVIRGKKGAGGVTIKKTTQAMVFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>gb|AFK47485.1| unknown [Medicago truncatula]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEG+ LT AAILG DGS+WAQSANFP+F P+EI AI +DFDEPG+LAPTGLH+
Sbjct  8    DDHLLCDIEGDHLTHAAILGVDGSVWAQSANFPQFKPEEINAINKDFDEPGTLAPTGLHI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L  G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALDIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010249472.1| PREDICTED: profilin-1-like [Nelumbo nucifera]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN L +AAI+G DGS+WAQS+ FP+F P+EI AI+ DF EPGSLAPTGLH 
Sbjct  8    DDHLMCDIEGNHLASAAIIGQDGSVWAQSSTFPQFKPEEITAIMNDFSEPGSLAPTGLHF  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+T GQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIVGVYDEPLTAGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_002515952.1| profilin, putative [Ricinus communis]
 gb|EEF46372.1| profilin, putative [Ricinus communis]
Length=132

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -2

Query  661  DEHLMCDI-EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLH  485
            D+HLMCD+ +G+ LTAAAI+GHDGS+WAQSA FP+  P+E+ AI++DFDEPGSLAPTGLH
Sbjct  8    DDHLMCDVGDGHTLTAAAIIGHDGSVWAQSATFPQLKPEEVTAIMKDFDEPGSLAPTGLH  67

Query  484  LGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYL  305
            LGG KYMVIQGEPGAV+RGKKG GG  +KKT Q ++ G+YDEP+TPGQCNMVVERLGDYL
Sbjct  68   LGGTKYMVIQGEPGAVIRGKKGSGGATLKKTGQAIVIGIYDEPLTPGQCNMVVERLGDYL  127

Query  304  VDQG  293
            +DQG
Sbjct  128  IDQG  131



>ref|XP_010249471.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LTAAAI+GHDGS+WAQS++FPKF  +EI +I++DF EPG LAPTGL L
Sbjct  8    DDHLMCDIEGNHLTAAAIIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEQGAVIRGKKGSGGITIKKTNQALIFGVYEEPVTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004964829.1| PREDICTED: profilin LP04-like [Setaria italica]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+I+G  LTAAAI+GHDGS+WAQS  FP++ P+EI AI++DFDEPG+LAPTGL L
Sbjct  8    DDHLLCEIDGQHLTAAAIIGHDGSVWAQSPTFPQYKPEEIVAIMKDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKTT  L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGTGGITVKKTTLALIIGIYDEPMTPGQCNMVVERLGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_006853720.1| hypothetical protein AMTR_s00056p00160320 [Amborella trichopoda]
 gb|ERN15187.1| hypothetical protein AMTR_s00056p00160320 [Amborella trichopoda]
Length=131

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G +L+AAAI+G DGS+WAQS NFP+F P EI  I+ DF+EPGSLAPTGL+L
Sbjct  8    DEHLMCEIDGQRLSAAAIIGQDGSVWAQSDNFPQFKPDEINGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALILGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AET05174.2| profilin [Medicago truncatula]
Length=133

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI+G  + L+AAAI+GHDGS+WAQS++FP+F P+EI AI +DFDEPG+LAPTGL
Sbjct  8    DEHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSSFPQFKPEEINAINKDFDEPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            H+GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L+ G+YDEPMTPGQCNMVVERLGDY
Sbjct  68   HIGGTKYMVIQGEPGAVIRGKKGAGGVTVKKTNMALVIGIYDEPMTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            LV+QG
Sbjct  128  LVEQG  132



>gb|AAU81921.1| profilin [Arachis hypogaea]
Length=128

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHL+CDIEGN+LT+AAILG DGS+WAQS+NFP+F P+EI AI+ DF EPG+LAPTGL+L
Sbjct  8    DEHLICDIEGNQLTSAAILGQDGSVWAQSSNFPQFKPEEITAIMNDFAEPGTLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV++  KGPGG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIQXXKGPGGVTIKKTNQALIIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  D  299
            +
Sbjct  128  E  128



>gb|AHY24177.1| profilin, partial [Prosopis juliflora]
Length=133

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+IEG  N L+AAAILG DGS+WAQSA+FP+F P EI+A+++DFD PG+LAPTGL
Sbjct  8    DDHLMCEIEGTNNHLSAAAILGVDGSVWAQSASFPQFKPDEISAVVKDFDGPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPG V+RGKKGPGG+CVKKT Q L+ G+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEPGQVIRGKKGPGGICVKKTGQALIIGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            LV+QG
Sbjct  128  LVEQG  132



>ref|XP_006451339.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 ref|XP_006475347.1| PREDICTED: profilin-like [Citrus sinensis]
 gb|ESR64579.1| hypothetical protein CICLE_v10009871mg [Citrus clementina]
 gb|KDO55855.1| hypothetical protein CISIN_1g032811mg [Citrus sinensis]
Length=133

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI  +G  L+A+AI+GHDGS+WAQSANFPKF P+EIA I++DFD+PG LAPTGL
Sbjct  8    DDHLMCDIDGQGQHLSASAIVGHDGSVWAQSANFPKFKPEEIAGIMKDFDQPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEAGAVIRGKKGSGGVTIKKTGQALVFGIYEEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>ref|XP_009352571.1| PREDICTED: profilin-2 [Pyrus x bretschneideri]
Length=131

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN L+AAAI+GHDGS+WAQSA FP+  P+E+  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLLCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKGPGG+ VKK+T  LL G+YDEPMT GQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMALLIGIYDEPMTAGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009405220.1| PREDICTED: profilin-1 [Musa acuminata subsp. malaccensis]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+G DGS+WAQSA+FP+F P+EI  I+ DF+EPG+LAP GL L
Sbjct  8    DEHLMCEIEGHHLTSAAIMGQDGSVWAQSASFPQFKPEEITNIINDFNEPGTLAPIGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   ASTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_009400573.1| PREDICTED: profilin-A [Musa acuminata subsp. malaccensis]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LTAAAI+GHDGS+WAQSA+FPKF P+E   I+ DF+EPG+LAP GL +
Sbjct  8    DEHLMCEIEGHHLTAAAIIGHDGSVWAQSASFPKFKPEEFTNIMNDFNEPGTLAPVGLFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ GLYDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALIVGLYDEPMTPGQCNMVVERLGDYLL  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|ABU95412.1| Sin a 4 allergen [Sinapis alba]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LTAAAILG DGS+WAQSANFP+  P+EI  I  DF EPG+LAPTGL +
Sbjct  8    DDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTLAPTGLFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKG GG+ +KKTTQ  +FG+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_010254422.1| PREDICTED: profilin-like [Nelumbo nucifera]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LTAAAI+GHDGS+WAQS++FPKF  +EI +I++DF EPG LAPTGL L
Sbjct  8    DDHLMCDIEGNHLTAAAIIGHDGSVWAQSSSFPKFETEEINSIMKDFAEPGYLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEHGAVIRGKKGSGGITIKKTNQALIFGVYEEPVTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AHL24658.1| Sal k 4.03 allergen [Salsola kali]
Length=133

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+IEG  N LTAAAILG DGS+WAQSANFP+F P EI+A++++FDE G+LAPTGL
Sbjct  8    DDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEISAVVKEFDEAGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQ E G V+RGKKGPGG+CVKKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQSEAGQVIRGKKGPGGICVKKTGQALIFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L++QG
Sbjct  128  LIEQG  132



>gb|KHG22026.1| Profilin [Gossypium arboreum]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+GN L++AAI+GHDGS+WAQS+NFP+F  +EI AI+ DF EPGSLAPTGL+L
Sbjct  8    DEHLMCEIDGNHLSSAAIVGHDGSIWAQSSNFPQFKQEEINAIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+ +KK+   LL G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGYVIRGKKGSGGITIKKSNMALLIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>dbj|BAJ86041.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP F P+E+  I++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GSAKYMVIQGEPGAVIRGKKGSGGITLKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CAB61833.1| profilin [Nicotiana tabacum]
Length=134

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = -2

Query  661  DEHLMCDIEGNK---LTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            DEHLM DIEG +   L AAAILGHDGS+WAQS+ FPKF P+EI  I++DFDEPG LAPTG
Sbjct  8    DEHLMADIEGQQGHHLAAAAILGHDGSVWAQSSAFPKFKPEEITNIMKDFDEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            L LGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GD
Sbjct  68   LFLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGD  127

Query  310  YLVDQGY  290
            YLVDQGY
Sbjct  128  YLVDQGY  134



>ref|XP_008458981.1| PREDICTED: profilin-4 [Cucumis melo]
Length=133

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI  +G  LTAAAI+GHDGS+WAQSA+FP+F  +EI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIDGQGQHLTAAAIVGHDGSVWAQSASFPQFKSEEINGIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            LVDQG
Sbjct  128  LVDQG  132



>ref|NP_001105450.1| profilin-1 [Zea mays]
 sp|P35081.1|PROF1_MAIZE RecName: Full=Profilin-1; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=ZmPRO1; AltName: Allergen=Zea m 12 [Zea mays]
 emb|CAA51718.1| profilin 1 [Zea mays]
Length=131

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG+ WAQS  FP+F P+E+AAI++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHLAPTGLIL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004241753.1| PREDICTED: profilin-1-like [Solanum lycopersicum]
Length=131

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EG++LT+AAILG DGS+WAQS+ FPKF  +EI  I++DFDEPG LAPTGL L
Sbjct  8    DDHLMCDLEGHRLTSAAILGFDGSVWAQSSAFPKFKQEEIINIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GDYL+
Sbjct  68   GGAKYMVIQGEPGAVIRGKKGAGGITIKKTVQALIFGIYEEPVTPGQCNMVVEKIGDYLI  127

Query  301  DQGY  290
            DQGY
Sbjct  128  DQGY  131



>ref|XP_006853719.1| hypothetical protein AMTR_s00056p00159630 [Amborella trichopoda]
 gb|ERN15186.1| hypothetical protein AMTR_s00056p00159630 [Amborella trichopoda]
Length=131

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G++LTAAAILG DG++WAQS +FP+  P EI  I+ DFDEPGSLAPTGL+L
Sbjct  8    DDHLMCDIDGHRLTAAAILGLDGNVWAQSQSFPELKPDEIKGIINDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKTTQ L+ G+YDEP+TPGQCNMVVERLGDYLV
Sbjct  68   GAAKYMVIQGEPGAVIRGKKGSGGVTIKKTTQALIIGIYDEPLTPGQCNMVVERLGDYLV  127

Query  301  DQGY  290
            DQ Y
Sbjct  128  DQSY  131



>sp|Q5EF31.1|PROF_CROSA RecName: Full=Profilin; AltName: Full=Pollen allergen Cro s 1; 
AltName: Allergen=Cro s 1 [Crocus sativus]
 gb|AAW81034.1| profilin [Crocus sativus]
Length=131

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCD++G+ LT+AAILGHDGS+WAQSA FP+  P EI AIL DF+EPGSLAPTG+++
Sbjct  8    DEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAILNDFNEPGSLAPTGMYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPG V+RGKKG GG+ +KK+   L+FGLYDEPMTPGQCN+VVERLGDYL+
Sbjct  68   NGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMALIFGLYDEPMTPGQCNLVVERLGDYLI  127

Query  301  DQGY  290
            +QGY
Sbjct  128  EQGY  131



>ref|XP_009405712.1| PREDICTED: profilin-1-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEG  LTA+AI+G DGS+WAQSA+FP+F P+E+  I+ DF+EPG+LAP GL L
Sbjct  8    DDHLMCEIEGRHLTASAIVGQDGSVWAQSASFPQFKPEEVTNIINDFNEPGTLAPIGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|Q64LH1.1|PROF1_AMBAR RecName: Full=Profilin-1; AltName: Full=Pollen allergen Amb a 
8; AltName: Allergen=Amb a 8 [Ambrosia artemisiifolia]
 gb|AAP15202.1| profilin-like protein [Ambrosia artemisiifolia]
Length=131

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDG +WAQSA FP+  P+EI  I+ DF+EPGSLAPTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGVVWAQSATFPQVKPEEITGIMNDFNEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ +KKTT  L+ G+YDEPMTPGQCNM+VER GDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTIKKTTMSLIIGIYDEPMTPGQCNMLVERPGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>gb|ABC61055.1| profilin-like protein [Cinnamomum camphora]
Length=131

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G  LTAAAI+GHDGS+WAQS +FP+F P+EI  I+ DF+EPG LAPTGL+L
Sbjct  8    DDHLMCDIDGQHLTAAAIVGHDGSVWAQSDSFPQFKPEEINGIMNDFNEPGYLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALIFGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009789538.1| PREDICTED: profilin-1 [Nicotiana sylvestris]
Length=134

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = -2

Query  661  DEHLMCDIEGNK---LTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLM DIEG +   L AAAILGHDGS+WAQS+ FPKF P+EI  I++DFDEPG LAPTG
Sbjct  8    DDHLMADIEGQQGHHLAAAAILGHDGSVWAQSSTFPKFKPEEITNIMKDFDEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            L LGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GD
Sbjct  68   LFLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGD  127

Query  310  YLVDQGY  290
            YLVDQGY
Sbjct  128  YLVDQGY  134



>gb|ABW37744.1| Ama v 1.01 allergen [Amaranthus viridis]
Length=133

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 115/125 (92%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+I+G  N+L+AAAI+G DGS+WAQSA+FP+F   EIAAI++DF++PG+LAPTGL
Sbjct  8    DDHLMCEIDGSENRLSAAAIIGVDGSVWAQSASFPQFKEDEIAAIVKDFEDPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            +LGG KYMVIQGEPGAV+RGKKGPGG+CVKKT Q L+ G+YDEP+TPGQCNM+VERLGDY
Sbjct  68   YLGGTKYMVIQGEPGAVIRGKKGPGGICVKKTNQALVIGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L++QG
Sbjct  128  LIEQG  132



>ref|XP_010095450.1| hypothetical protein L484_005874 [Morus notabilis]
 gb|EXB60276.1| hypothetical protein L484_005874 [Morus notabilis]
Length=131

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+I+GN+L+AAAI+G DGS+WAQS NFP+F P+EIAAI +DF+EPG+LAPTGL L
Sbjct  8    DDHLLCEIDGNRLSAAAIIGQDGSVWAQSENFPQFKPEEIAAINKDFEEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+Y+EPM PGQCNM+VERLGDYLV
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNQALIIGIYEEPMAPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004969894.1| PREDICTED: profilin-A-like [Setaria italica]
Length=131

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG++WAQSA FP F P+E+A I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPSFKPEEMANIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|KHN16653.1| Profilin-1 [Glycine soja]
Length=131

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT AAI+GHDGS+WAQSANFP+F  +EI AI+ DF+EPGSLAPTGL L
Sbjct  8    DDHLLCEIEGNHLTHAAIIGHDGSVWAQSANFPQFKAEEITAIMNDFNEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPM PGQCNMVVERLGDYLV
Sbjct  68   AATKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMAPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_003569765.1| PREDICTED: profilin-2 [Brachypodium distachyon]
Length=131

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP F P+E+  I++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCDIEGHHLVSAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   ASAKYMVIQGEPGAVIRGKKGSGGITLKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|AIV43662.1| profilin, partial [Vachellia farnesiana]
Length=133

 Score =   204 bits (518),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMC+IEG  N L+ AAILG DGS+WAQSA+FP+F P EIAA+++DFD PG+LAPTGL
Sbjct  8    DDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIAAVVKDFDGPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPG  +RGKKGPGG+CVKKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTGQALVFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            LV+QG
Sbjct  128  LVEQG  132



>gb|AAU43733.1| profilin, partial [Citrullus lanatus]
Length=131

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LT+AAI+G DGS+WA+S NFP+  P+EI  IL DF+EPG+LAPTGL++
Sbjct  8    DDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGILNDFNEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|O24650.1|PROF2_PHLPR RecName: Full=Profilin-2; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Full=Profilin 
4; AltName: Allergen=Phl p 12 [Phleum pratense]
 emb|CAA70608.1| profilin 2 [Phleum pratense]
 emb|CAA70610.1| profilin 4 [Phleum pratense]
Length=131

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ L +AAILGHDG++WAQSA+FP+F P+EI  I++DFDEPG LAPTG+ +
Sbjct  8    DEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   AGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_008458990.1| PREDICTED: profilin [Cucumis melo]
 gb|AAP13533.2| profilin [Cucumis melo var. cantalupo]
 gb|AAP42150.3| profilin [Cucumis melo var. cantalupo]
 gb|AAP44395.2| profilin [Cucumis melo var. cantalupo]
Length=131

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LT+AAI+G DGS+WAQS NFP+  P+E+A I+ DF +PG+LAPTGL++
Sbjct  8    DEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_006298806.1| hypothetical protein CARUB_v10014910mg [Capsella rubella]
 gb|EOA31704.1| hypothetical protein CARUB_v10014910mg [Capsella rubella]
Length=131

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+LT+AAILG DGS+WAQS  FP+  PQEI  I++DFDEPG LAPTGL L
Sbjct  8    DDHLMCDVEGNQLTSAAILGQDGSVWAQSTKFPQLKPQEITGIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG+KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+FG+YDEPMT GQCN+VVERLGDYL+
Sbjct  68   GGEKYMVIQGEPGAVIRGKKGPGGVTIKKTNQALVFGIYDEPMTGGQCNLVVERLGDYLM  127

Query  301  D  299
            +
Sbjct  128  E  128



>emb|CCP19647.1| profilin allergen [Parietaria judaica]
Length=131

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN LTAAAILG DGS+WAQSA+FP+F P+EIAAI++DF+EPG+LAPTGL L
Sbjct  8    DDHLMCEIEGNHLTAAAILGQDGSVWAQSASFPQFKPEEIAAIVKDFEEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE G V+RGKKG GG+ VKKT Q L+ G+YDEPM PGQCNM+VERLGDYL+
Sbjct  68   GGAKYMVIQGEAGVVIRGKKGSGGVTVKKTGQALVIGIYDEPMAPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ETG  130



>ref|XP_003525290.1| PREDICTED: profilin-like [Glycine max]
Length=133

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI+G  + LTAAAI+GHDGS+WAQS++FP+  PQEI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIDGTGHHLTAAAIIGHDGSVWAQSSSFPQIRPQEITDIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HL G KYMVIQGE GAV+RGKKGPGG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLAGTKYMVIQGESGAVIRGKKGPGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>ref|XP_006661690.1| PREDICTED: profilin-A-like [Oryza brachyantha]
Length=131

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG++WAQSA FP+F P+E+A I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIVGHDGAVWAQSAAFPQFKPEEMANIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009415731.1| PREDICTED: profilin-3 [Musa acuminata subsp. malaccensis]
Length=131

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LTAAAI+G DGS+WAQSA+FP+  P+E+  I+ DF+EPG+LAP GL L
Sbjct  8    DEHLMCEIEGHHLTAAAIVGQDGSVWAQSASFPQVKPEEMTNIINDFNEPGTLAPIGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALIFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010267105.1| PREDICTED: profilin-2 [Nelumbo nucifera]
Length=131

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG++L+AAAI+GHDGS+WAQS +FP+F  +EI  I++DF EPG LAPTGL L
Sbjct  8    DEHLMCDIEGHRLSAAAIIGHDGSVWAQSESFPQFKSEEINGIMQDFAEPGHLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE G+V+RGKKG GG+ +KKT Q L+FGLY+EPMTPGQCNMVVERLGDYLV
Sbjct  68   GGTKYMVIQGEQGSVIRGKKGTGGITIKKTNQALIFGLYEEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|KDP33777.1| hypothetical protein JCGZ_07348 [Jatropha curcas]
Length=133

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI  +G  LTAAAI+GHDGS+WAQS +FP+F P+E+  I++DF+EPG LAPTGL
Sbjct  8    DEHLMCDIDGQGQHLTAAAIIGHDGSVWAQSTSFPQFKPEEVTDIMKDFEEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>gb|EMT25354.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP+F P EI AI++DFDEPG LAPTG+ +
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITAIMKDFDEPGHLAPTGMFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G Y+EPMTPGQCNMVVERLGDYLV
Sbjct  68   AGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGAYEEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|NP_001235025.1| uncharacterized protein LOC100499717 [Glycine max]
 gb|ACU13355.1| unknown [Glycine max]
Length=131

 Score =   203 bits (517),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT AAI+GHDGS+WAQSANFP+F  +EI AI+ DF+EPGSLAPTGL L
Sbjct  8    DDHLLCEIEGNHLTHAAIIGHDGSVWAQSANFPQFKAEEITAIMNDFNEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPM PGQCNMVVERLGDYL+
Sbjct  68   AATKYMVIQGEPGAVIRGKKGPGGVTVKKTGAALIIGIYDEPMAPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_009409369.1| PREDICTED: profilin-like [Musa acuminata subsp. malaccensis]
Length=131

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+  +LTAAAILGHDGS+WAQS +FP+F P+EI AI+ DFDEPGSLAPTGL L
Sbjct  8    DDHLMCDIDDQRLTAAAILGHDGSVWAQSDSFPQFKPEEITAIMTDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KK+   L+ G+YDEPMT GQCNMVVERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGTGGVTIKKSNLALIIGIYDEPMTGGQCNMVVERLGDYLY  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>gb|AAP15198.1| profilin-like protein [Humulus scandens]
 gb|AAP15199.1| profilin-like protein [Humulus scandens]
Length=131

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G  LTAAAI+GHDGS+WAQS+ FP+F P+EIAAI++DF+EPGSLAPTGLHL
Sbjct  8    DDHLMCEIDGQHLTAAAIIGHDGSVWAQSSTFPQFKPEEIAAIMKDFEEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVI GE GAV+RGKKG GG+ VKKT   ++ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGIKYMVIMGEQGAVIRGKKGAGGITVKKTGAAMIIGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQ  296
            DQ
Sbjct  128  DQ  129



>dbj|BAJ34266.1| unnamed protein product [Thellungiella halophila]
Length=131

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN LTAAAILG DGS+WAQSANFP+  P+EI+ I +DF EPG+LAPTGL +
Sbjct  8    DDHLMCDVEGNHLTAAAILGQDGSVWAQSANFPQLKPEEISGINKDFAEPGTLAPTGLFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKG GG+ +KKTTQ L+FG+Y+EPM PGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQALVFGIYEEPMAPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>emb|CDM84005.1| unnamed protein product [Triticum aestivum]
Length=131

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP F P+E+  I++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCN+VVERLGDYLV
Sbjct  68   GAAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_002441408.1| hypothetical protein SORBIDRAFT_09g026120 [Sorghum bicolor]
 gb|EES19838.1| hypothetical protein SORBIDRAFT_09g026120 [Sorghum bicolor]
Length=131

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI GHDG++WAQSA FP+F P+++  I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIAGHDGAVWAQSATFPEFKPEDMTNIMKDFDEPGHLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GATKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004503499.1| PREDICTED: profilin-like [Cicer arietinum]
Length=133

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI+G  + L+AAAI+GHDGS+WAQS++FP+   QEI  I++DFDEPG+LAPTGL
Sbjct  8    DEHLMCDIDGTGHHLSAAAIIGHDGSVWAQSSSFPQIKSQEITGIMKDFDEPGTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HL G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLAGVKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            LVDQG
Sbjct  128  LVDQG  132



>emb|CDP03236.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDIEG  + LTAAAILGHDG++WAQS+NFP+  P EI  I+ DFDEPG LAPTGL
Sbjct  8    DDHLMCDIEGTGHHLTAAAILGHDGAVWAQSSNFPQIKPDEIKGIMTDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+FG+Y+EP+TPGQCN+VVERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGPGGVTIKKTGQALVFGIYEEPVTPGQCNLVVERLGDY  127

Query  307  LVDQG  293
            L +QG
Sbjct  128  LAEQG  132



>ref|NP_001284474.1| profilin [Cucumis melo]
 sp|Q5FX67.1|PROF_CUCME RecName: Full=Profilin; AltName: Full=Pollen allergen Cuc m 2; 
AltName: Allergen=Cuc m 2 [Cucumis melo]
 gb|AAW69549.1| profilin [Cucumis melo]
Length=131

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LT+AAI+G DGS+WAQS NFP+  P+E+A I+ DF +PG+LAPTGL++
Sbjct  8    DEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDFADPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG  VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGATVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|NP_001104885.1| profilin-4 [Zea mays]
 sp|O22655.1|PROF4_MAIZE RecName: Full=Profilin-4; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=ZmPRO4; AltName: Allergen=Zea m 12 [Zea mays]
 gb|AAB86960.1| profilin [Zea mays]
 gb|ACF85566.1| unknown [Zea mays]
 gb|AFW75545.1| profilin-4 [Zea mays]
Length=131

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG  L+AAAI+GHDGS+WAQS +FP+  P+E+A I++DFDEPG+LAPTGL +
Sbjct  8    DEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGIIKDFDEPGTLAPTGLFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>sp|Q9ST99.1|PROF2_TOBAC RecName: Full=Profilin-2; AltName: Full=Pollen allergen Nic t 
8; AltName: Allergen=Nic t 8 [Nicotiana tabacum]
 emb|CAA63751.1| profilin [Nicotiana tabacum]
Length=134

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 3/127 (2%)
 Frame = -2

Query  661  DEHLMCDIEG---NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLM DIEG   N L AAAILG+DGS+WAQS  FPKF P+EI  I++DFDEPG LAPTG
Sbjct  8    DDHLMADIEGQQGNHLAAAAILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            L LGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GD
Sbjct  68   LFLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGD  127

Query  310  YLVDQGY  290
            YLVDQGY
Sbjct  128  YLVDQGY  134



>ref|XP_010541006.1| PREDICTED: profilin-4 [Tarenaya hassleriana]
Length=134

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 110/125 (88%), Gaps = 3/125 (2%)
 Frame = -2

Query  661  DEHLMCDI---EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            DEHLMCD+   +G+ LTAAAI+GHDGS+WAQSANFP+  P EI  I++DFDEPG LAPTG
Sbjct  8    DEHLMCDVGDGQGHHLTAAAIVGHDGSVWAQSANFPQLKPDEITGIMKDFDEPGYLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            LHLGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGD
Sbjct  68   LHLGGAKYMVIQGEPGAVIRGKKGSGGVTIKKTGQALVFGIYEEPVTPGQCNMVVERLGD  127

Query  310  YLVDQ  296
            YL++Q
Sbjct  128  YLIEQ  132



>gb|AAQ63001.1| oil palm profilin-like allergen PF1 [Elaeis guineensis]
Length=131

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+I+G+ LTAAAILG DGS+WAQS++FP F P+EI  I+ DF EPGSLAPTGL L
Sbjct  8    DEHLMCEIDGHHLTAAAILGQDGSVWAQSSSFPPFKPEEITGIMNDFAEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+FG+YDEPMTP QCNMVVERLGDYL+
Sbjct  68   GSTKYMVIQGEPGAVIRGKKGSGGITVKKTNQALVFGIYDEPMTPCQCNMVVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>gb|AHL24660.1| Fra e 2.01 allergen [Fraxinus excelsior]
Length=134

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = -2

Query  661  DEHLMCDIEGN---KLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLMCDIEG+   +LTAAAI+GHDGS+WAQSA FP+F P+EI  I  DF+EPG LAPTG
Sbjct  8    DDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEINGITTDFNEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            LHLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGD
Sbjct  68   LHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPITPGQCNMVVERLGD  127

Query  310  YLVDQG  293
            YL+DQG
Sbjct  128  YLIDQG  133



>ref|XP_008795503.1| PREDICTED: profilin-2-like [Phoenix dactylifera]
Length=131

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDI+G +LTAAAILGHDGS+WAQS  FP+  P+EI+ I+ DF EPG LAPTGL+L
Sbjct  8    DDHLMCDIDGQRLTAAAILGHDGSVWAQSETFPQVKPEEISGIMNDFAEPGHLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT   L+ G+YDEPMTPGQCNM++ERLGDYLV
Sbjct  68   GNTKYMVIQGEPGAVIRGKKGSGGVTIKKTNMALIIGIYDEPMTPGQCNMIIERLGDYLV  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>gb|ADK22841.1| Sal k 4.02 [Salsola kali]
Length=133

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIE--GNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMC+IE  GN LT++AI+G DGS+WAQS+NFP+  PQEI AI ++FD P +LAPTGL
Sbjct  8    DEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIEAINKEFDGPNTLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
             LGG+KYMVIQGEPGAV+RGKKGPGG+C+KKTTQ L+FG+YDEP+ PGQCNMVVERLGDY
Sbjct  68   FLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTTQALIFGIYDEPVAPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L++QG
Sbjct  128  LIEQG  132



>gb|EMS66850.1| Profilin-2/4 [Triticum urartu]
Length=167

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP+F P EI AI++DFDEPG LAPTG+ +
Sbjct  44   DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITAIMKDFDEPGHLAPTGMFV  103

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G Y+EPMTPGQCNMVVERLGDYLV
Sbjct  104  AGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGAYEEPMTPGQCNMVVERLGDYLV  163

Query  301  DQG  293
            +QG
Sbjct  164  EQG  166



>gb|AFK47381.1| unknown [Lotus japonicus]
Length=133

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIE--GNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI+  G+ L++AAI+GHDGS+WAQSANFP+F   EI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIDATGHFLSSAAIVGHDGSIWAQSANFPQFKAGEIPGIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+YDEP+TPGQCNM+VERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYDEPVTPGQCNMIVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>ref|NP_001064348.1| Os10g0323600 [Oryza sativa Japonica Group]
 ref|NP_001064349.1| Os10g0323900 [Oryza sativa Japonica Group]
 sp|Q9FUD1.1|PROFA_ORYSJ RecName: Full=Profilin-A [Oryza sativa Japonica Group]
 gb|AAG32056.1|AF310253_1 profilin A [Oryza sativa]
 gb|AAK92577.1|AC074354_11 Profilin A [Oryza sativa Japonica Group]
 gb|AAK92580.1|AC074354_14 Profilin A [Oryza sativa Japonica Group]
 gb|AAP52954.1| Profilin A, putative, expressed [Oryza sativa Japonica Group]
 gb|AAP52957.1| Profilin A, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26262.1| Os10g0323600 [Oryza sativa Japonica Group]
 dbj|BAF26263.1| Os10g0323900 [Oryza sativa Japonica Group]
 gb|EAY78023.1| hypothetical protein OsI_33063 [Oryza sativa Indica Group]
 gb|EAZ15648.1| hypothetical protein OsJ_31061 [Oryza sativa Japonica Group]
 gb|EAZ15650.1| hypothetical protein OsJ_31062 [Oryza sativa Japonica Group]
 dbj|BAG94438.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71845.1| profilin A protein [Oryza sativa]
Length=131

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG++WAQSA FP+F P+E+  I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>gb|ACN36779.1| unknown [Zea mays]
 gb|AFW78818.1| profilin-like protein [Zea mays]
Length=131

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG+ WAQS  FP+F  +E+AAI++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKAEEMAAIMKDFDEPGHLAPTGLIL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCN+VVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVERLGDYLL  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>sp|A4K9Z8.1|PROF2_BETPN RecName: Full=Profilin-2; AltName: Full=Allergen Bet v II; AltName: 
Full=Pollen allergen Bet v 2; AltName: Allergen=Bet v 
2 [Betula pendula]
 gb|ABG48509.1| pollen profilin [Betula pendula]
Length=133

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI  +G +L A+AI+GHDGS+WAQS++FP+F PQEI  I++DF+EPG LAPTGL
Sbjct  8    DEHLMCDIDGQGQQLAASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>sp|Q94JN3.1|PROF_MUSAC RecName: Full=Profilin; AltName: Full=Minor fruit allergen Mus 
xp 1; AltName: Allergen=Mus xp 1 [Musa acuminata]
 gb|AAK54834.1| profilin [Musa acuminata]
Length=131

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDI+G  LTAAAI+GHDGS+WAQS  FP+  P+EIAAI++DFDEPGSLAPTGL+L
Sbjct  8    DDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAIMKDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT   L+ G+Y+EPMTPGQCNMVVERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVERLGDYLF  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>gb|EMT00312.1| Profilin-2/4 [Aegilops tauschii]
Length=131

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP F P+E+  I++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPEEMTNIMKDFDEPGTLAPTGLLL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCN+VVERLGDYLV
Sbjct  68   GDAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>pdb|1CQA|A Chain A, Birch Pollen Profilin
Length=133

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI  +G +L A+AI+GHDGS+WAQS++FP+F PQEI  I++DF+EPG LAPTGL
Sbjct  8    DEHLMCDIDGQGEELAASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>ref|XP_006661691.1| PREDICTED: profilin-A-like [Oryza brachyantha]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG++WAQSA FP+F P+E+  I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>emb|CDM81724.1| unnamed protein product [Triticum aestivum]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DE L+CDI+G +LTAAAILGHDG++WA+S +FPK  P+EI A++ DFDEPGSLAPTGL L
Sbjct  8    DEQLLCDIDGQRLTAAAILGHDGAVWAESESFPKVKPEEITAVINDFDEPGSLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT+  ++ G+Y+EPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTSLAIIIGIYEEPMTPGQCNMVVERLGDYLL  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_004149180.1| PREDICTED: profilin-like [Cucumis sativus]
 ref|XP_004158480.1| PREDICTED: profilin-like [Cucumis sativus]
 gb|KGN58022.1| hypothetical protein Csa_3G435030 [Cucumis sativus]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+ LM +++G  L AAAI+G+DGS+WAQS+ FP++ P+EI+AI++DFDEPGSLAPTGLHL
Sbjct  8    DDQLMYEVDGQHLKAAAIIGNDGSVWAQSSAFPQYKPEEISAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG  G+ VKKTTQ L+FGLYDEPMTPGQCN++VE+LGDYL+
Sbjct  68   GGSKYMVIQGESGAVIRGKKGTSGITVKKTTQALIFGLYDEPMTPGQCNVIVEKLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_010098156.1| hypothetical protein L484_026290 [Morus notabilis]
 gb|EXB74593.1| hypothetical protein L484_026290 [Morus notabilis]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G+ LT+AAI+G DGS+WAQS++FP+F P+EI AI +DF EPGSLAPTGLHL
Sbjct  8    DDHLMCEIDGHHLTSAAIIGLDGSVWAQSSSFPQFKPEEIDAIKKDFGEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ VKKT   L+FG+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGITVKKTDLALVFGIYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQGY  290
            DQ +
Sbjct  128  DQNF  131



>gb|AEW90957.1| pollen profilin 3R4-2 [Secale cereale x Triticum turgidum subsp. 
durum]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP+F P EI  I++DFDEPG LAPTG+ +
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFAPAEITGIMKDFDEPGHLAPTGMFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+Y+EPMTPGQCNMVVERLGDYLV
Sbjct  68   AGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGVYEEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004141027.1| PREDICTED: profilin-like [Cucumis sativus]
 ref|XP_004157896.1| PREDICTED: profilin-like [Cucumis sativus]
 gb|KGN60568.1| hypothetical protein Csa_2G000760 [Cucumis sativus]
Length=133

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI  +G  L AAAI+GHDGS+WAQSA+FP+F   EI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIDGQGQHLAAAAIVGHDGSVWAQSASFPQFKSDEINGIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            LVDQG
Sbjct  128  LVDQG  132



>gb|AEC10960.1| profilin 2 [Camellia sinensis]
Length=131

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCDIEGN LT+AAI+GHDGS+WAQS++FP+  P+EI  +++DF EPG LAPTGL+L
Sbjct  8    DDHLMCDIEGNTLTSAAIIGHDGSVWAQSSSFPQLKPEEITGMMKDFAEPGYLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPM PGQCNM+VERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNLALIIGIYDEPMPPGQCNMIVERLGDYLN  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_007012197.1| Profilin 5 isoform 2, partial [Theobroma cacao]
 gb|EOY29816.1| Profilin 5 isoform 2, partial [Theobroma cacao]
Length=159

 Score =   203 bits (516),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEGN--KLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCD+EG    LTAAAI+G DGS+WAQSA FP F P+EI AI+ DF EPGSLAPTGL
Sbjct  34   DEHLMCDVEGQGIHLTAAAIIGQDGSVWAQSAPFPAFTPEEITAIMNDFAEPGSLAPTGL  93

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
             +GG KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEP+TPGQCNM+VERLGDY
Sbjct  94   FIGGVKYMVIQGEPGAVIRGKKGSGGVTVKKTNQALIIGIYDEPLTPGQCNMIVERLGDY  153

Query  307  LVDQG  293
            L+DQG
Sbjct  154  LIDQG  158



>gb|ABO43717.1| profilin [Gossypium hirsutum]
 gb|ABO43718.1| profilin [Gossypium hirsutum]
 gb|ABO43719.1| profilin [Gossypium hirsutum]
 gb|ACX53268.1| profilin [Gossypium raimondii]
 gb|ACX53269.1| profilin [Gossypium arboreum]
Length=133

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI+G  + L+AAAI+GHDGS+WAQS+NFPK  P+EI  I++DFDEPG LAPTGL
Sbjct  8    DEHLMCDIDGTGHHLSAAAIVGHDGSIWAQSSNFPKCQPKEITDIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG K+MVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGAKFMVIQGEPGAVIRGKKGSGGVTIKKTAQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L +QG
Sbjct  128  LAEQG  132



>ref|XP_010483134.1| PREDICTED: profilin-5 [Camelina sativa]
Length=131

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD+EGN+L AAAILG DGS+WAQS +FP+  P+EI  I +DF EPG+LAPTGL L
Sbjct  8    DDHLMCDVEGNRLIAAAILGQDGSVWAQSTSFPQLKPEEIEGINKDFAEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEP AV+RGKKG GG+ +KKTTQ ++FG+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGNKYMVIQGEPNAVIRGKKGTGGVTIKKTTQAMVFGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQG  293
            + G
Sbjct  128  ESG  130



>ref|XP_008447563.1| PREDICTED: profilin-like [Cucumis melo]
Length=131

 Score =   202 bits (513),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+ LM +++G  L AAAI+G+DGS+WAQS+ FP++ P+EI+AI++DFDEPGSLAPTGLHL
Sbjct  8    DDQLMYEVDGQHLKAAAIIGNDGSVWAQSSGFPQYKPEEISAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG  G+ VKKTTQ L+FGLYDEPMTPGQCN++VE+LGDYL+
Sbjct  68   GGSKYMVIQGESGAVIRGKKGTSGITVKKTTQALIFGLYDEPMTPGQCNVIVEKLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_007160275.1| hypothetical protein PHAVU_002G307600g [Phaseolus vulgaris]
 sp|P49231.1|PROF1_PHAVU RecName: Full=Profilin-1 [Phaseolus vulgaris]
 emb|CAA57508.1| profilin [Phaseolus vulgaris]
 gb|ESW32269.1| hypothetical protein PHAVU_002G307600g [Phaseolus vulgaris]
Length=131

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT AAILG DGS+WA+SA+FP+F P+EI  I+ DF+EPG+LAPTGL++
Sbjct  8    DDHLLCEIEGNHLTHAAILGQDGSVWAKSASFPQFKPEEITGIMNDFNEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG+V+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGSVIRGKKGPGGVTVKKTNLALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|NP_001105622.1| profilin-5 [Zea mays]
 sp|Q9FR39.1|PROF5_MAIZE RecName: Full=Profilin-5; AltName: Full=Pollen allergen Zea m 
12; AltName: Full=ZmPRO5; AltName: Allergen=Zea m 12 [Zea mays]
 gb|AAG35601.1|AF201459_1 profilin 5 [Zea mays]
 gb|ACF86011.1| unknown [Zea mays]
 gb|ACG24542.1| profilin-2 [Zea mays]
 gb|ACG30909.1| profilin-2 [Zea mays]
 gb|ACG31198.1| profilin-2 [Zea mays]
 gb|ACG32313.1| profilin-2 [Zea mays]
 gb|ACG39357.1| profilin-2 [Zea mays]
 gb|AFW85823.1| profilin-5 [Zea mays]
Length=131

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDIEG  L+AAAI+GHDGS+WAQS NFP+  P+E+A +++DFDEPG+LAPTGL +
Sbjct  8    DDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGMIKDFDEPGTLAPTGLFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGIYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>gb|ACG33212.1| profilin-2 [Zea mays]
 gb|ACG37293.1| profilin-2 [Zea mays]
Length=131

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG  L+AAAI+GHDGS WAQS +FP+  P+E+A I++DFDEPG+LAPTGL +
Sbjct  8    DEHLMCEIEGQHLSAAAIVGHDGSAWAQSESFPELKPEEVAGIIKDFDEPGTLAPTGLFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPG V+RGKKG GG+ +KKT   L+ G+YDEPMTPGQCNMVVERLGDYL+
Sbjct  68   GGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMSLIIGVYDEPMTPGQCNMVVERLGDYLI  127

Query  301  DQGY  290
            +QG+
Sbjct  128  EQGF  131



>ref|XP_009392682.1| PREDICTED: profilin [Musa acuminata subsp. malaccensis]
Length=131

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+CDI+G  LTAAAI+GHDGS+WAQS  FP+  P+EIAAI++DFDEPGSLAPTGL+L
Sbjct  8    DDHLLCDIDGQCLTAAAIVGHDGSVWAQSDVFPQCKPEEIAAIMKDFDEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT   L+ G+Y+EPMTPGQCNMVVERLGDYL 
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLALIIGIYNEPMTPGQCNMVVERLGDYLF  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>dbj|BAK07752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP+F P EI  I++DFDEPG LAPTG+ +
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPQFGPNEITGIMKDFDEPGYLAPTGMFI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   ATAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|NP_001233869.1| profilin-1 [Solanum lycopersicum]
 sp|Q41344.1|PROF1_SOLLC RecName: Full=Profilin-1 [Solanum lycopersicum]
 gb|AAB03271.1| profilin [Solanum lycopersicum]
Length=133

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDIEG  + L++AAILG DGS+WAQS NFPKF  +EI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIEGTGHHLSSAAILGFDGSVWAQSPNFPKFKAEEITNIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
             L G KYMVIQGEPGAV+RGKKGPGG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GDY
Sbjct  68   FLAGTKYMVIQGEPGAVIRGKKGPGGITIKKTAQALIFGVYEEPVTPGQCNMVVEKIGDY  127

Query  307  LVDQGY  290
            LVDQGY
Sbjct  128  LVDQGY  133



>sp|P41372.1|PROF1_TOBAC RecName: Full=Profilin-1 [Nicotiana tabacum]
 emb|CAA57632.1| profilin [Nicotiana tabacum]
Length=134

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 109/127 (86%), Gaps = 3/127 (2%)
 Frame = -2

Query  661  DEHLMCDIEGNK---LTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLM DIEG +   L AAAILGHDGS+WAQS+ FPKF P+EI  I++DFDEPG LAPTG
Sbjct  8    DDHLMADIEGQQGHHLAAAAILGHDGSVWAQSSTFPKFKPEEITNIMKDFDEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            L LGG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++ D
Sbjct  68   LFLGGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIRD  127

Query  310  YLVDQGY  290
            YLVDQGY
Sbjct  128  YLVDQGY  134



>sp|P35079.1|PROF1_PHLPR RecName: Full=Profilin-1; AltName: Full=Allergen Phl p 11; AltName: 
Full=Pollen allergen Phl p 12; AltName: Allergen=Phl 
p 12 [Phleum pratense]
 emb|CAA54686.1| profilin [Phleum pratense]
Length=131

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ L +AAILGHDG++WAQSA+FP+F P+EI  I++DFDEPG LAPTG+ +
Sbjct  8    DEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFV  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
             G KYMVIQGEPG V+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   AGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_002456332.1| hypothetical protein SORBIDRAFT_03g034110 [Sorghum bicolor]
 gb|EES01452.1| hypothetical protein SORBIDRAFT_03g034110 [Sorghum bicolor]
 gb|AGN33439.1| profilin [Sorghum bicolor]
Length=131

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEG+ LT+AAI+GHDG++WAQS  FP+F P+E+  I++DFDEPG LAPTGL L
Sbjct  8    DEHLMCEIEGHHLTSAAIIGHDGTVWAQSTAFPQFKPEEMTNIMKDFDEPGFLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKT Q L+ G+YDEPMTPGQCNMVVERLGDYLV
Sbjct  68   GPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004513067.1| PREDICTED: profilin-like [Cicer arietinum]
Length=133

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDIEG  ++L+AAAI+GHDGS+WAQS +FP+F   EI  I++DFDEPG LAPTGL
Sbjct  8    DEHLMCDIEGTGHQLSAAAIVGHDGSVWAQSNSFPQFKSNEINGIMKDFDEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            ++GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   YIGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGVYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            LVDQG
Sbjct  128  LVDQG  132



>gb|ACA49387.1| putative actin- and phospholipid-binding protein [Gerbera hybrid 
cultivar]
Length=131

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+IEGN L+AAAI+GHDGS+WAQS  FP+  P+EI  I+ DF+EPGS APTGL+L
Sbjct  8    DDHLMCEIEGNHLSAAAIIGHDGSVWAQSTTFPQVKPEEITGIMNDFNEPGSPAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGE GAV+RGKKG GG+ +KKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEAGAVIRGKKGSGGVTIKKTAMALIIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>ref|XP_003546590.1| PREDICTED: profilin-4-like [Glycine max]
Length=131

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMCD +G+ L AAAI+GHDG++WAQS+ FP+F  +EI AI++DFDEPGSLAPTGLHL
Sbjct  8    DDHLMCDFDGHALAAAAIIGHDGTVWAQSSKFPQFKGEEIVAIMKDFDEPGSLAPTGLHL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG GG+ VKKTTQ L+ G+Y+EP+TPGQCNM+VERLGDYLV
Sbjct  68   GDTKYMVIQGEPGAVIRGKKGAGGVTVKKTTQALVIGIYEEPLTPGQCNMIVERLGDYLV  127

Query  301  DQG  293
            + G
Sbjct  128  ELG  130



>ref|XP_008799779.1| PREDICTED: profilin-2 [Phoenix dactylifera]
Length=131

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HLMC+I+G +LTAAAILGHDGS+WAQS  FP+  P+EI+ I+ DF EPGSLAPTGL+L
Sbjct  8    DDHLMCEIDGQRLTAAAILGHDGSVWAQSETFPQVKPEEISGIMNDFAEPGSLAPTGLYL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            G  KYMVIQGEPGAV+RGKKG  G+ +KKT   L+ G+YDEPMTPGQCNM++ERLGDYL+
Sbjct  68   GSAKYMVIQGEPGAVIRGKKGSAGVTIKKTNMALIIGIYDEPMTPGQCNMIIERLGDYLI  127

Query  301  DQGY  290
            DQG+
Sbjct  128  DQGF  131



>gb|AAP42151.3| profilin [Cucumis melo var. cantalupo]
Length=131

 Score =   201 bits (511),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LT+AAI+G DGS+WAQS NFP+  P+E+A I+ D  +PG+LAPTGL++
Sbjct  8    DEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGIVGDLADPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>sp|O24169.1|PROFA_OLEEU RecName: Full=Profilin-1; AltName: Full=Pollen allergen Ole e 
2; AltName: Allergen=Ole e 2 [Olea europaea]
 emb|CAA73035.1| profilin 1 [Olea europaea]
Length=134

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = -2

Query  661  DEHLMCDIEGN---KLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLMCDIEG+   +LTAAAI+GHDGS+WAQSA FP+F P+E+  I+ DF+EPG LAPTG
Sbjct  8    DDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            LHLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGD
Sbjct  68   LHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGD  127

Query  310  YLVDQG  293
            YLV+QG
Sbjct  128  YLVEQG  133



>ref|XP_002514198.1| profilin, putative [Ricinus communis]
 gb|EEF48152.1| profilin, putative [Ricinus communis]
Length=133

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = -2

Query  661  DEHLMCDI--EGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            DEHLMCDI  +G  LTAA+I+GHDGS+WAQS++FP+  P+EI  I++DF+EPG LAPTGL
Sbjct  8    DEHLMCDIDGQGQHLTAASIVGHDGSIWAQSSSFPQLKPEEITGIMKDFEEPGHLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            H+GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HIGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQ  296
            L+DQ
Sbjct  128  LIDQ  131



>gb|AFK33983.1| unknown [Lotus japonicus]
Length=133

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -2

Query  661  DEHLMCDIEG--NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGL  488
            D+HLMCDI+G  + LTA+AI+GHDGS+WAQS +FP+  PQEI  I++DFDEPG LAPTGL
Sbjct  8    DDHLMCDIDGTGHHLTASAIVGHDGSVWAQSTSFPQLKPQEITGIMKDFDEPGFLAPTGL  67

Query  487  HLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDY  308
            HLGG KYMVIQGE GAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVERLGDY
Sbjct  68   HLGGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDY  127

Query  307  LVDQG  293
            L+DQG
Sbjct  128  LIDQG  132



>gb|ACV50427.1| profilin-like protein [Jatropha curcas]
 gb|KDP34181.1| hypothetical protein JCGZ_07752 [Jatropha curcas]
Length=131

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDI+GN LT+AAI+G DG++WAQS+ FP+F  +E+  I+ DF EPG+LAPTGL L
Sbjct  8    DEHLMCDIDGNHLTSAAIIGQDGTVWAQSSTFPQFTAEEVTGIMNDFAEPGTLAPTGLFL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEP+TPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNQALIIGVYDEPLTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_009591293.1| PREDICTED: profilin-2 [Nicotiana tomentosiformis]
Length=134

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = -2

Query  661  DEHLMCDIEG---NKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTG  491
            D+HLM DIEG   N L AAAILG+DGS+WAQS  FPKF P+EI  I++DFDEPG LAPTG
Sbjct  8    DDHLMADIEGQQGNHLAAAAILGNDGSVWAQSTTFPKFKPEEITNIMKDFDEPGHLAPTG  67

Query  490  LHLGGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGD  311
            L L G KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+FG+Y+EP+TPGQCNMVVE++GD
Sbjct  68   LFLAGAKYMVIQGEPGAVIRGKKGSGGITIKKTNQALIFGIYEEPVTPGQCNMVVEKIGD  127

Query  310  YLVDQGY  290
            YLVDQGY
Sbjct  128  YLVDQGY  134



>gb|EMS49855.1| Profilin-2/4 [Triticum urartu]
Length=131

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMCDIEG+ L +AAILGHDG++WAQSA+FP F P E+A I++DFDEPG+LAPTGL L
Sbjct  8    DEHLMCDIEGHHLASAAILGHDGTVWAQSADFPSFKPAEMANIMKDFDEPGTLAPTGLLL  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
               KYMVIQGEPGAV+RGKKG GG+ +KKT Q L+ G+YDEPMTPGQCN+VVERLGDYLV
Sbjct  68   ADAKYMVIQGEPGAVIRGKKGAGGITLKKTGQALVVGIYDEPMTPGQCNLVVERLGDYLV  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



>ref|XP_004157894.1| PREDICTED: profilin-like [Cucumis sativus]
Length=131

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            DEHLMC+IEGN LT+AAI+G DGS+WAQS  FP+  P+E++ I+ DFD PG+LAPTGL++
Sbjct  8    DEHLMCEIEGNHLTSAAIIGQDGSVWAQSQAFPQLKPEEVSGIVGDFDNPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG+ VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGLALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            DQG
Sbjct  128  DQG  130



>ref|XP_007160276.1| hypothetical protein PHAVU_002G307700g [Phaseolus vulgaris]
 gb|AGV54702.1| profilin [Phaseolus vulgaris]
 gb|ESW32270.1| hypothetical protein PHAVU_002G307700g [Phaseolus vulgaris]
Length=131

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  661  DEHLMCDIEGNKLTAAAILGHDGSLWAQSANFPKFNPQEIAAILRDFDEPGSLAPTGLHL  482
            D+HL+C+IEGN LT AAI+GHDGS+WAQS+ FP+F  +EI  I+ DF+EPG+LAPTGL++
Sbjct  8    DDHLLCEIEGNHLTHAAIIGHDGSVWAQSSQFPQFKAEEITGIMNDFNEPGTLAPTGLYI  67

Query  481  GGQKYMVIQGEPGAVVRGKKGPGGLCVKKTTQCLLFGLYDEPMTPGQCNMVVERLGDYLV  302
            GG KYMVIQGEPGAV+RGKKGPGG  VKKT   L+ G+YDEPMTPGQCNM+VERLGDYL+
Sbjct  68   GGTKYMVIQGEPGAVIRGKKGPGGATVKKTNLALVIGIYDEPMTPGQCNMIVERLGDYLI  127

Query  301  DQG  293
            +QG
Sbjct  128  EQG  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718