BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c5001_g2_i1 len=234 path=[263:0-146 410:147-170 620:171-233]

Length=234
                                                                      Score     E

ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...  67.4    8e-11   
dbj|BAD15107.1|  hypothetical protein                                 66.2    8e-11   Nicotiana tabacum [American tobacco]
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  66.2    1e-10   
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...  66.2    2e-10   
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...  65.9    2e-10   
ref|XP_006359790.1|  PREDICTED: putative late blight resistance p...  65.5    4e-10   
ref|XP_009798793.1|  PREDICTED: putative late blight resistance p...  61.2    8e-09   
ref|XP_009618247.1|  PREDICTED: probable disease resistance prote...  59.3    9e-09   
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg              60.5    1e-08   
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...  60.5    1e-08   
ref|XP_009614965.1|  PREDICTED: putative late blight resistance p...  60.5    2e-08   
ref|XP_009774012.1|  PREDICTED: putative late blight resistance p...  60.5    2e-08   
ref|XP_009614364.1|  PREDICTED: putative late blight resistance p...  60.1    2e-08   
ref|XP_009769019.1|  PREDICTED: putative late blight resistance p...  58.9    6e-08   
ref|XP_009614325.1|  PREDICTED: putative late blight resistance p...  58.5    7e-08   
ref|XP_009596888.1|  PREDICTED: uncharacterized protein LOC104092904  57.0    8e-08   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...  58.2    1e-07   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2              58.2    1e-07   
ref|XP_009625338.1|  PREDICTED: putative late blight resistance p...  57.0    1e-07   
ref|XP_009626721.1|  PREDICTED: putative late blight resistance p...  57.8    1e-07   
ref|XP_009630452.1|  PREDICTED: putative late blight resistance p...  57.8    1e-07   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...  57.4    2e-07   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  57.0    2e-07   
ref|NP_001234202.1|  NRC1                                             56.6    3e-07   
ref|XP_009596917.1|  PREDICTED: disease resistance protein RPP13-...  56.2    5e-07   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  56.2    6e-07   
gb|EYU23536.1|  hypothetical protein MIMGU_mgv1a001875mg              55.8    6e-07   
ref|XP_009757879.1|  PREDICTED: putative late blight resistance p...  55.8    7e-07   
ref|XP_009620237.1|  PREDICTED: putative late blight resistance p...  55.8    8e-07   
emb|CDP00592.1|  unnamed protein product                              55.5    9e-07   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  53.5    1e-06   
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg              55.1    1e-06   
ref|XP_009803158.1|  PREDICTED: putative late blight resistance p...  54.7    1e-06   
ref|XP_009618066.1|  PREDICTED: putative late blight resistance p...  54.7    2e-06   
ref|XP_009620169.1|  PREDICTED: disease resistance protein RPP13-...  54.3    2e-06   
emb|CDP11831.1|  unnamed protein product                              54.3    2e-06   
ref|XP_009620170.1|  PREDICTED: putative late blight resistance p...  53.9    3e-06   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  53.9    3e-06   
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  53.5    4e-06   
ref|XP_004236957.1|  PREDICTED: putative late blight resistance p...  53.5    4e-06   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  53.5    5e-06   
gb|EYU29956.1|  hypothetical protein MIMGU_mgv1a001088mg              53.5    5e-06   
ref|XP_009778215.1|  PREDICTED: putative late blight resistance p...  53.1    6e-06   
ref|XP_009803469.1|  PREDICTED: putative late blight resistance p...  52.0    6e-06   
ref|XP_011072127.1|  PREDICTED: putative late blight resistance p...  52.8    8e-06   
gb|KDO63081.1|  hypothetical protein CISIN_1g037018mg                 52.4    9e-06   
ref|XP_006471178.1|  PREDICTED: probable disease resistance prote...  51.2    9e-06   
ref|XP_009792813.1|  PREDICTED: putative late blight resistance p...  52.0    9e-06   
ref|XP_009594795.1|  PREDICTED: putative late blight resistance p...  52.4    1e-05   
ref|XP_009761103.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_011072124.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_009788462.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
gb|KDO38582.1|  hypothetical protein CISIN_1g036414mg                 50.1    2e-05   
gb|KDO44317.1|  hypothetical protein CISIN_1g044637mg                 50.8    2e-05   
ref|XP_009630520.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
emb|CDP00590.1|  unnamed protein product                              51.2    2e-05   
gb|KDO40277.1|  hypothetical protein CISIN_1g047959mg                 50.8    2e-05   
ref|XP_006367930.1|  PREDICTED: putative late blight resistance p...  51.2    2e-05   
emb|CDP05558.1|  unnamed protein product                              51.2    3e-05   
ref|XP_006367931.1|  PREDICTED: putative late blight resistance p...  51.2    3e-05   
emb|CDP16255.1|  unnamed protein product                              51.2    3e-05   
gb|KDO39041.1|  hypothetical protein CISIN_1g0038902mg                50.8    4e-05   
ref|XP_006471238.1|  PREDICTED: disease resistance protein RPP8-l...  50.4    4e-05   
gb|KDO40278.1|  hypothetical protein CISIN_1g037494mg                 49.7    5e-05   
ref|XP_009793040.1|  PREDICTED: putative late blight resistance p...  50.1    6e-05   
emb|CDP20211.1|  unnamed protein product                              50.1    6e-05   
ref|XP_004236958.1|  PREDICTED: putative late blight resistance p...  50.1    7e-05   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  49.3    1e-04   
ref|XP_009591232.1|  PREDICTED: putative late blight resistance p...  49.3    1e-04   
gb|EYU22232.1|  hypothetical protein MIMGU_mgv1a002671mg              48.9    1e-04   
emb|CDP11611.1|  unnamed protein product                              48.5    2e-04   
ref|XP_004236959.1|  PREDICTED: putative late blight resistance p...  48.5    2e-04   
ref|XP_006471232.1|  PREDICTED: disease resistance protein RPP8-like  47.8    2e-04   
ref|XP_011072005.1|  PREDICTED: putative late blight resistance p...  48.5    2e-04   
ref|XP_006471228.1|  PREDICTED: probable disease resistance prote...  47.4    2e-04   
ref|XP_006495296.1|  PREDICTED: probable disease resistance prote...  48.1    3e-04   
ref|XP_006471237.1|  PREDICTED: probable disease resistance prote...  48.1    3e-04   
ref|XP_006471233.1|  PREDICTED: probable disease resistance prote...  48.1    3e-04   
emb|CDP16256.1|  unnamed protein product                              47.8    3e-04   
ref|XP_006471226.1|  PREDICTED: probable disease resistance RPP8-...  48.1    3e-04   
ref|XP_006471236.1|  PREDICTED: probable disease resistance prote...  48.1    3e-04   
ref|XP_006471223.1|  PREDICTED: probable disease resistance RPP8-...  47.8    3e-04   
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  47.8    4e-04   
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  47.8    4e-04   
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  47.8    4e-04   
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  47.4    4e-04   
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  47.8    4e-04   
gb|KDO35880.1|  hypothetical protein CISIN_1g010381mg                 47.0    5e-04   
ref|XP_006471220.1|  PREDICTED: probable disease resistance prote...  46.2    5e-04   
ref|XP_011072179.1|  PREDICTED: putative late blight resistance p...  47.0    6e-04   
gb|EYU24144.1|  hypothetical protein MIMGU_mgv1a001094mg              47.0    7e-04   
ref|XP_009622940.1|  PREDICTED: putative late blight resistance p...  46.6    8e-04   
gb|KDO39821.1|  hypothetical protein CISIN_1g045386mg                 46.2    0.001   



>ref|XP_004248798.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=885

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFL-  62
            N+S +LP P  PK S      ++++TLSTI P SCTE++F +TPNL+KL +RG +S  L 
Sbjct  642  NSSAKLPVPVAPKNSKVTLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKISVLLD  701

Query  61   NESKSSCVFFEKLKCLENLK  2
            N+S +S    ++L+ LENLK
Sbjct  702  NKSAASLKNVKRLEYLENLK  721



>dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum]
Length=364

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N+S +LP P  P+ S      ++++TLSTI P SCTE++F +TPNL+KL +RG ++  L 
Sbjct  181  NSSAKLPLPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLE  240

Query  58   ESKSSCVFFEKLKCLENLK  2
             +KS     +KL+ LENLK
Sbjct  241  PNKSLLKNVKKLEYLENLK  259



>ref|XP_009778116.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=490

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            NTS +LP P  PK S   S  + ++TLSTI P SCTE++F + PNL+KL +RG +   L 
Sbjct  247  NTSAKLPTPVAPKSSKVTSVNQCLQTLSTIAPESCTEEVFSRAPNLKKLGIRGKIFMLLE  306

Query  58   ESKSSCV-FFEKLKCLENLK  2
             +KS      +KL+CLENLK
Sbjct  307  PNKSELFNNVKKLQCLENLK  326



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N+S +LP P  P+ S      ++++TLSTI P SCTE++F +TPNL+KL +RG ++  L 
Sbjct  644  NSSAKLPVPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLE  703

Query  58   ESKSSCVFFEKLKCLENLK  2
             +KS     +KL+ LENLK
Sbjct  704  PNKSLLKNVKKLESLENLK  722



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N+S +LP P  P+ S      ++++TLSTI P SCTE++F +TPNL+KL +RG ++  L 
Sbjct  645  NSSAKLPVPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLE  704

Query  58   ESKSSCVFFEKLKCLENLK  2
             +KS     +KL+ LENLK
Sbjct  705  PNKSLLKNVKKLEYLENLK  723



>ref|XP_006359790.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=886

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFL-  62
            N+S +LP P  PK S      ++++TLSTI P SCTE++F +TPNL+KL +RG ++  L 
Sbjct  643  NSSAKLPVPVAPKNSKVTLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLD  702

Query  61   NESKSSCVFFEKLKCLENLK  2
            N+S  S    ++L+ LENLK
Sbjct  703  NKSAVSLKNVKRLEYLENLK  722



>ref|XP_009798793.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=704

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 3/70 (4%)
 Frame = -3

Query  205  PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVF--F  32
            PK S      + ++TLSTI P SCTED+F + PN++KL +RG++   L ES  S +F   
Sbjct  466  PKSSKAALVNQALQTLSTIAPESCTEDVFVRAPNMKKLGIRGNIGMLL-ESNESALFNNV  524

Query  31   EKLKCLENLK  2
            +KL+CLE+LK
Sbjct  525  KKLECLESLK  534



>ref|XP_009618247.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
 ref|XP_009618250.1| PREDICTED: probable disease resistance protein At1g58602 [Nicotiana 
tomentosiformis]
Length=255

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP P  PK S  +   + ++TLSTI P  CT ++F +TPNL+KL VRG +   L 
Sbjct  10   NASATLPSPKRPKSSKDNLVNRCLQTLSTIAPECCTAEVFTRTPNLKKLGVRGKIDALLE  69

Query  58   ESK---SSCVF--FEKLKCLENLK  2
             SK   SS +F    KL CLE LK
Sbjct  70   TSKDESSSGLFSNIGKLDCLEKLK  93



>gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Erythranthe guttata]
Length=643

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  205  PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEK  26
            PKR ++D GG+ ++TL TI P+SC+E +F    NL+KL +RG L+  ++    S     K
Sbjct  413  PKRDSSDKGGQKLQTLDTISPQSCSEQVFDTACNLKKLGIRGPLASLIDGKIGSFGILRK  472

Query  25   LKCLENLK  2
            +  LENLK
Sbjct  473  MDHLENLK  480



>ref|XP_006347943.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=491

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 54/82 (66%), Gaps = 7/82 (9%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            NTS +LP P  PK S T    ++++TLSTI P SCTE +  + PNL+KL +RG +++ + 
Sbjct  244  NTSAKLPTPANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPNLKKLGIRGKIAKLME  303

Query  58   ESKSSCVFF---EKLKCLENLK  2
             S+S  + F   ++L+ LENLK
Sbjct  304  PSRS--ILFNNVKRLQFLENLK  323



>ref|XP_009614965.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
 ref|XP_009614966.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=886

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = -3

Query  208  PPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVF--  35
             PK S      + ++TLSTI P SCTED+F + PN++KL +RG +   L ES  S +F  
Sbjct  647  APKSSKAALVNQALQTLSTIAPESCTEDVFVRAPNMKKLGIRGKIGMLL-ESNESALFNN  705

Query  34   FEKLKCLENLK  2
             +KL+CLE+LK
Sbjct  706  VKKLECLESLK  716



>ref|XP_009774012.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=887

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 5/82 (6%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  LP P    +       ++TLSTI P  CT +IF +TPNL+KL VRG ++  L  S
Sbjct  639  NASAILPSPKHPKSRKGVNHYLQTLSTIAPECCTAEIFTRTPNLKKLGVRGKIAALLEAS  698

Query  52   K---SSCVF--FEKLKCLENLK  2
            K    S +F    KL+CLENLK
Sbjct  699  KGGSGSGLFSNIGKLECLENLK  720



>ref|XP_009614364.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=887

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 5/82 (6%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  LP P    +       ++TLSTI P  CT +IF +TPNL+KL VRG ++  L  S
Sbjct  639  NASAILPSPKHSKSRKEVNHYLQTLSTIAPECCTAEIFTRTPNLKKLGVRGKIAALLETS  698

Query  52   K---SSCVF--FEKLKCLENLK  2
            K    S +F    KL CLENLK
Sbjct  699  KDGSGSGLFGNIGKLDCLENLK  720



>ref|XP_009769019.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=884

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP P  PK S  +   + ++TLSTI P  CT ++F +TPNL+KL VRG +   L 
Sbjct  639  NASATLPSPKRPKSSKENLVNRCLQTLSTIAPECCTAEVFTRTPNLKKLGVRGKIDALLE  698

Query  58   ESK---SSCVF--FEKLKCLENLK  2
             SK   SS +F    KL CLE LK
Sbjct  699  TSKDGSSSGLFSNIGKLDCLEKLK  722



>ref|XP_009614325.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009614326.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=806

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P  ++T +S    ++TLS + P SCTED+  +  NL+K+ ++G ++EF   +
Sbjct  646  NVPAKLPSPATQTTDESS--RLQTLSKVAPESCTEDVLARACNLRKVSIQGQMAEFFEAN  703

Query  52   KSSCVFFEKLKCLENLK  2
            K     F+KLK LE LK
Sbjct  704  KGGFNNFQKLKSLEQLK  720



>ref|XP_009596888.1| PREDICTED: uncharacterized protein LOC104092904 [Nicotiana tomentosiformis]
Length=267

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++    PP   TTD     ++TLS + P SC ED+  +  NL+K+ ++G++++FL  +
Sbjct  8    HTNVPAKLPPGTQTTDES-LCLQTLSKVAPGSCREDVLVRACNLRKVSIQGEMADFLEIN  66

Query  52   KSSCVFFEKLKCLENLK  2
            K     F+KLKCLE LK
Sbjct  67   KGGFNNFQKLKCLEQLK  83



>ref|XP_011070823.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=892

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGK----NIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEF  65
            N S  LP P  +S           +++TLST+ P SCTED+F + PNL+ L +RG L++ 
Sbjct  640  NASTALPGPLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKL  699

Query  64   LNESKSSCVFFE---KLKCLENLK  2
            L E+KS  + F+   KL  LENLK
Sbjct  700  L-ENKSGSMLFDSLGKLSHLENLK  722



>gb|AGX27500.1| NBS-LRR class resistance protein Fy2-Ry2 [Sesamum indicum]
Length=892

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGK----NIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEF  65
            N S  LP P  +S           +++TLST+ P SCTED+F + PNL+ L +RG L++ 
Sbjct  640  NASTALPGPLSKSRKSKDDALMIGSLQTLSTVSPESCTEDVFARAPNLKVLGIRGQLAKL  699

Query  64   LNESKSSCVFFE---KLKCLENLK  2
            L E+KS  + F+   KL  LENLK
Sbjct  700  L-ENKSGSMLFDSLGKLSHLENLK  722



>ref|XP_009625338.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=337

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP P  PK S  +   + ++TLST  P  CT ++F +TPNL+KL VRG L+  L 
Sbjct  92   NASATLPSPKRPKSSKDNLVNRCLQTLSTKAPECCTAEVFTRTPNLKKLGVRGKLNALLE  151

Query  58   ESK---SSCVF--FEKLKCLENLK  2
             SK   SS +F    KL CLE LK
Sbjct  152  TSKDGSSSGLFSNIGKLDCLEKLK  175



>ref|XP_009626721.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009626722.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=903

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++    PP   +       ++TLS + P SCT+DI  K  NL+KL ++G + +FL  S
Sbjct  662  HTNIPAKLPPPPHSPKGKASCLQTLSVVSPESCTKDILAKACNLKKLSIQGRMIDFLGTS  721

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LKCLE+LK
Sbjct  722  KGGWCNLEELKCLEHLK  738



>ref|XP_009630452.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=902

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++    PP   TTD     ++TLS + P SC ED+  +  NL+K+ ++G++++FL  +
Sbjct  642  HTNVPAKLPPATQTTDESS-CLQTLSKVAPGSCREDVLARACNLRKVSIQGEMADFLEIN  700

Query  52   KSSCVFFEKLKCLENLK  2
            K     F KLKCLE LK
Sbjct  701  KGGFNNFRKLKCLEQLK  717



>ref|XP_006347944.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006347945.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347946.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X3 [Solanum tuberosum]
Length=703

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 7/82 (9%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            NTS +LP P  P+ S T    ++++TLSTI P SCTE +  + P L+KL +RG +++ L 
Sbjct  456  NTSAKLPTPANPRTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPKLKKLGIRGKIAKLLE  515

Query  58   ESKSSCVFF---EKLKCLENLK  2
             S    V F   + L+CLENLK
Sbjct  516  PSLP--VLFNNVKMLQCLENLK  535



>ref|XP_009629405.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009629406.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=701

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSG--GKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N+S +LP P  R ++      ++++TLSTI P SCTE++F + PNL+KL +RG ++  L 
Sbjct  458  NSSAKLPVPIARKSSKVTLVNQSLQTLSTIAPESCTEEVFARAPNLKKLGIRGKIAVLLE  517

Query  58   ESKSSCV-FFEKLKCLENLK  2
             + S+ +   +KL+ LE+LK
Sbjct  518  PNTSTSLKNVKKLEYLESLK  537



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPF--PPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            NTS +LP    PK S T    ++++TLSTI P SCTE +  + PNL+KL +RG +++ + 
Sbjct  641  NTSAKLPALANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPNLKKLGIRGKIAKLME  700

Query  58   ESKSSCV-FFEKLKCLENLK  2
             S+S  +   ++L+ LENLK
Sbjct  701  PSQSVLLNNVKRLQFLENLK  720



>ref|XP_009596917.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=896

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP PP  +   S    ++TLS I P+SCT+D F K  NL+KL +RG++  FL  S
Sbjct  665  NVPAELPLPPIPTGEASC---LQTLSLITPKSCTKDAFAKACNLKKLGIRGNMEAFLETS  721

Query  52   KSSCVFFEKLKCLENL  5
            K      ++L CLE L
Sbjct  722  KGGWQNLKELWCLERL  737



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP    PK S  +   + ++TLSTI P  CT ++F +TPNL+KL VRG +   L 
Sbjct  641  NASATLPSTKRPKSSKGNLVNRCLQTLSTIAPECCTAEVFTRTPNLKKLGVRGKIDALLE  700

Query  58   ESK--SSCVFFE---KLKCLENLK  2
             SK  S  V F    KL CLE LK
Sbjct  701  TSKDGSGSVLFSNIGKLACLEYLK  724



>gb|EYU23536.1| hypothetical protein MIMGU_mgv1a001875mg [Erythranthe guttata]
Length=745

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -3

Query  181  GGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            GG+NI+TLST+ P SCTE + +K  N+++L VRG+LS   + + +   F EKL+ LE LK
Sbjct  528  GGQNIQTLSTLSPESCTETVAKKARNMKELRVRGNLSTLFDGNNN---FLEKLRSLEKLK  584



>ref|XP_009757879.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=917

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++    PP   TT+     ++TLS + P SC ED+  +  NL+K+ ++G++++FL  +
Sbjct  657  HTNVPAKLPPATQTTEESS-CLQTLSKVAPGSCREDVLARACNLRKVSIQGEMADFLEIN  715

Query  52   KSSCVFFEKLKCLENLK  2
            K     F KLKCLE LK
Sbjct  716  KGGFNNFRKLKCLEQLK  732



>ref|XP_009620237.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=928

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            ++TLS + P SCT+D+     NL+KL +RG+L EFL  +      FE+LKCLE+LK
Sbjct  712  LQTLSVVAPESCTKDVISIACNLKKLSIRGNLVEFLEINGGGWRNFEELKCLEHLK  767



>emb|CDP00592.1| unnamed protein product [Coffea canephora]
Length=933

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 4/81 (5%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTD--SGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            NTS  LP P  +      S   N++TLS+I P SC  D+F + P L+KL + G L+ F+ 
Sbjct  685  NTSACLPLPLAKIHKGEPSISANLQTLSSISPESCKRDVFERVPKLKKLGICGRLASFMQ  744

Query  58   ESKSSCVF--FEKLKCLENLK  2
             +  S +F  F KL+ LENLK
Sbjct  745  GNNESSLFDSFSKLEFLENLK  765



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESK--SSCVFFE---KLKCLENL  5
            ++TLSTI P  CT ++F +TPNL+KL VRG +   L  SK  S  V F    KL CLE L
Sbjct  12   LQTLSTIAPECCTAEVFTRTPNLKKLGVRGKIDALLETSKDGSGSVLFSNIGKLACLEYL  71

Query  4    K  2
            K
Sbjct  72   K  72



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -3

Query  229  TSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESK  50
            T+     P + + +D GG+ ++TL TI P SC+E +F    NL+KL +RG L+  ++   
Sbjct  521  TNASASLPKRDNNSDKGGQKLQTLDTISPESCSEQVFDTACNLKKLGIRGPLASLIDGKI  580

Query  49   SSCVFFEKLKCLENLK  2
             S     KL  LENLK
Sbjct  581  GSFGSLRKLDHLENLK  596



>ref|XP_009803158.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=895

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENL  5
            ++TLS I P+SCT+D+F K  NL+KL +RG++  FL  SK       +LKCLE L
Sbjct  680  LQTLSLITPKSCTKDVFAKACNLKKLGIRGNMEAFLETSKGGWRNLGELKCLERL  734



>ref|XP_009618066.1| PREDICTED: putative late blight resistance protein homolog R1B-23, 
partial [Nicotiana tomentosiformis]
Length=738

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   + T      ++TLS + P SC +D+  K  +L+KL +RG ++ FL+  
Sbjct  505  NIPAKLPSP---AITTGKASFLQTLSLVAPESCKKDVLAKACHLRKLNIRGQMAAFLDTQ  561

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LKCLE+LK
Sbjct  562  KGGINNLEELKCLEHLK  578



>ref|XP_009620169.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Nicotiana 
tomentosiformis]
Length=838

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +    G  +++TLS + P SC + + R   NL+KL +RG + +FL  +
Sbjct  643  NKPAKLPLPS--TQKGEGRSSLQTLSIVAPESCNKVVLRNARNLKKLSMRGRIEDFLQTN  700

Query  52   KSSCVFFEKLKCLENLK  2
            K     FE   CLENLK
Sbjct  701  KDGFSTFEGFNCLENLK  717



>emb|CDP11831.1| unnamed protein product [Coffea canephora]
Length=898

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            NTS  LP  P +S    GG+N++TLST+ P S T+++F++  NL+KL +RG L   + E 
Sbjct  616  NTSTTLPKCPDQS---PGGENLQTLSTVSPESLTKEVFKRAKNLKKLGIRGKLHNLV-EG  671

Query  52   KSSCVFFEKL---KCLENLK  2
                 FF+ L     LENLK
Sbjct  672  NGESSFFDSLCEVDSLENLK  691



>ref|XP_009620170.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
isoform X2 [Nicotiana tomentosiformis]
Length=693

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +    G  +++TLS + P SC + + R   NL+KL +RG + +FL  +
Sbjct  498  NKPAKLPLPS--TQKGEGRSSLQTLSIVAPESCNKVVLRNARNLKKLSMRGRIEDFLQTN  555

Query  52   KSSCVFFEKLKCLENLK  2
            K     FE   CLENLK
Sbjct  556  KDGFSTFEGFNCLENLK  572



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP    PK S  +   + ++TLSTI P  CT ++F +TPNL+KL VRG +   L 
Sbjct  641  NASATLPSTKRPKSSKDNLVNRCLQTLSTIAPECCTAEVFTRTPNLKKLGVRGKIDALLE  700

Query  58   ESK---SSCVF--FEKLKCLENLK  2
             SK    S +F    KL CLE LK
Sbjct  701  SSKDGSGSGLFSNIGKLGCLEYLK  724



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSG--GKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N+S +L  P  R ++      ++++TLSTI P SCTE++F + PNL+KL +RG +S  L 
Sbjct  637  NSSAKLSVPIARKSSKVTLVNQSLQTLSTIAPESCTEEVFARAPNLKKLGIRGKISVLLE  696

Query  58   ESKSSCV-FFEKLKCLENLK  2
             + S+ +   +K++ LE+LK
Sbjct  697  PNTSTSLKNVKKVEYLESLK  716



>ref|XP_004236957.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010319428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = -3

Query  205  PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEK  26
            P  + T     +++TLS + P SC +D+  K  +L+KL +RG ++ FL ES+      E+
Sbjct  649  PSPTVTKGKSSSLQTLSMVAPESCKKDVLAKACHLKKLGIRGQMASFL-ESRGGISNLEE  707

Query  25   LKCLENLK  2
            LKCLE+LK
Sbjct  708  LKCLEHLK  715



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = -3

Query  175  KNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVF--FEKLKCLENLK  2
            +NI T+STI P SCTE+I  +TPNL+KL +RG L   + E   S +F    KL  LE+LK
Sbjct  663  RNILTISTISPDSCTENILARTPNLRKLGIRGKLITLVEEKGGSTMFDILAKLDRLESLK  722



>gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata]
Length=893

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 6/83 (7%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSG----GKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEF  65
            N S  LP P  RS            ++TLST+ P SCTE++F + PNL+ L +RG L + 
Sbjct  640  NASTVLPGPLSRSRKSKDEVLMSGTLQTLSTVSPESCTEEVFARAPNLKVLGIRGQLGKL  699

Query  64   LNESKSSCVF--FEKLKCLENLK  2
            L     S +F    +L  LENLK
Sbjct  700  LEIKNGSMLFDSLGRLSHLENLK  722



>ref|XP_009778215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=899

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +L  P  ++T   G   ++TLS + P SC ED+  +  NL+K+ ++G+++EFL  +
Sbjct  640  NVPAKLTSPATQTTY--GSSCLQTLSKVAPGSCGEDVLVRACNLKKVSIQGEMAEFLETN  697

Query  52   KSSCVFFEKLKCLENLK  2
            K     F KLK LE+LK
Sbjct  698  KGGFRNFAKLKFLEHLK  714



>ref|XP_009803469.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=297

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 3/69 (4%)
 Frame = -3

Query  211  FPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFF  32
            FPP  ++T S    ++TLS + P SC ED+  K  NL+KL +RG+++ FL  SK     F
Sbjct  73   FPPPTTSTSSC---LQTLSLVAPESCKEDVLAKASNLKKLSIRGNMATFLETSKGEFSNF  129

Query  31   EKLKCLENL  5
              L+ LE+L
Sbjct  130  RVLERLESL  138



>ref|XP_011072127.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=885

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  LP P K S     G+ +RTL TI P+SCT+++F +  NL+KL +RG L+  ++  
Sbjct  645  NASSTLPNPGKSSKE---GEKLRTLGTISPQSCTDEVFERARNLKKLGIRGRLALLIDGK  701

Query  52   KSSCVFFEKLKCLENLK  2
              S     KL+ +E LK
Sbjct  702  SGSFDSLGKLENVEKLK  718



>gb|KDO63081.1| hypothetical protein CISIN_1g037018mg, partial [Citrus sinensis]
Length=663

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S++ P SCT DI  + PN+Q L + GDLS + +    
Sbjct  450  SINLPAPPKNYS--SSLKNLIFISSLNPSSCTPDILGRLPNVQTLRISGDLSHYHSGVSK  507

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  508  SLCELHKLECLQ  519



>ref|XP_006471178.1| PREDICTED: probable disease resistance protein RDL5-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471179.1| PREDICTED: probable disease resistance protein RDL5-like isoform 
X2 [Citrus sinensis]
Length=252

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK ++  S  KN+  +S + P SCT DI  + PN+Q L + GDLS + +    
Sbjct  26   SITLPAPPKNNS--SPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSK  83

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  84   SLCQLHKLECLK  95



>ref|XP_009792813.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=421

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +L  P  ++T   G   ++TLS + P SC ED+  +  NL+K+ ++G+++EFL  +
Sbjct  162  NVPAKLTSPATQTTY--GSSCLQTLSKVAPGSCGEDVLLRACNLKKVSIQGEMAEFLETN  219

Query  52   KSSCVFFEKLKCLENLK  2
            K     F KLK LE+LK
Sbjct  220  KGGFRNFAKLKFLEHLK  236



>ref|XP_009594795.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=882

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++     P  +TT      ++TL  + P SC +++  K  +L+KL +RG ++ FL   
Sbjct  642  HTNIPAKLQPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAY  701

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LKCLE LK
Sbjct  702  KGGINNLEELKCLEQLK  718



>ref|XP_009761103.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++     P  +T+      ++TLS + P SC +++  K  +L+KL +RG ++ FL   
Sbjct  640  HTNIPAKLQPPAATSSGKASCLQTLSMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAY  699

Query  52   KSSCVFFEKLKCLENL  5
            K      E+LKCLE L
Sbjct  700  KGGINNLEELKCLEQL  715



>ref|XP_011072124.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=636

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  LP    +  +   G+ +RTL TI P+SCT+++F +  NL+KL +RG L+  ++  
Sbjct  558  NASTTLP----KVKSSKEGEKLRTLGTISPQSCTDEVFERARNLKKLGIRGRLALLIDGK  613

Query  52   KSSCVFFEKLKCLENLK  2
              S     KL+ LE LK
Sbjct  614  SGSFDSLGKLENLEKLK  630



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = -3

Query  208  PPKRSTTDSGG----KNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSC  41
            PP ++  D+      +NI+T+ST+LP  C E+I  +TP L+KL +RG L+  +  +  S 
Sbjct  647  PPAKTRKDNADPFVRRNIQTISTVLPDCCKENILARTPGLRKLGIRGKLATLVATNGDSS  706

Query  40   VF--FEKLKCLENLK  2
            +F    KL  LE LK
Sbjct  707  LFDNLAKLDNLETLK  721



>ref|XP_009788462.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=877

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   ST  S    ++TLS + P SC +D+  +  NL+KL ++G +  F   S
Sbjct  637  NVPAKLPSPS--STPTSKHSCLQTLSKVAPESCRKDVLARACNLRKLCIQGQMVSFFETS  694

Query  52   KSSCVFFEKLKCLENLK  2
            K     F +LKCLE+LK
Sbjct  695  KGGFSNFGELKCLEHLK  711



>gb|KDO38582.1| hypothetical protein CISIN_1g036414mg [Citrus sinensis]
Length=252

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P +Q L + GDLS + +    
Sbjct  26   SITLPAPPKNYS--SSLKNLIFISALHPSSCTPDILSRLPTVQTLRISGDLSHYHSGVSK  83

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  84   SLCELHKLECLK  95



>gb|KDO44317.1| hypothetical protein CISIN_1g044637mg, partial [Citrus sinensis]
Length=370

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK ++  S  KN+  +S + P SCT DI  + PN+Q L + GDLS + +    
Sbjct  144  SITLPAPPKNNS--STLKNLIFISALHPGSCTPDILGRLPNVQTLRISGDLSYYHSGVSK  201

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  202  SLCQLHKLECLK  213



>ref|XP_009630520.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=889

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   ST  S    ++TLS + P SC +D+  +  NL+KL ++G +  F   S
Sbjct  649  NVPAKLPSPS--STPTSKHSCLQTLSKVAPESCRKDVLARACNLRKLCIQGQMVSFFETS  706

Query  52   KSSCVFFEKLKCLENLK  2
            K     F +LKCLE+LK
Sbjct  707  KGGFSNFGELKCLEHLK  723



>emb|CDP00590.1| unnamed protein product [Coffea canephora]
Length=899

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = -3

Query  232  NTSMQLPFPP---KRSTTDS-GGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEF  65
            N S  LP P    +RS  ++  G+N+ TL T+ P SC E++F +T  L+KL +RG L++ 
Sbjct  648  NASTLLPCPDNKNQRSKEEALIGENLLTLHTVSPESCKEEVFERTTRLKKLGIRGKLAKL  707

Query  64   LNESKSSCVF--FEKLKCLENLK  2
               +  S +F    KL  LENLK
Sbjct  708  FEITGESSLFGYLRKLDSLENLK  730



>gb|KDO40277.1| hypothetical protein CISIN_1g047959mg, partial [Citrus sinensis]
Length=478

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK ++  S  KN+  +S + P SCT DI  + PN+Q L + GDLS + +    
Sbjct  212  SITLPAPPKNNS--SPLKNLIFISALHPSSCTPDILGRLPNVQTLRISGDLSYYHSGVSK  269

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  270  SLCQLHKLECLK  281



>ref|XP_006367930.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X1 [Solanum tuberosum]
Length=932

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +TT      ++TLS + P SC +D+  K   L+KL +RG ++ FL E 
Sbjct  643  NIPAKLPAP---ATTTGKTSCLQTLSMVAPESCKKDVLAKACLLKKLSIRGQMASFL-EP  698

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LKCLE+LK
Sbjct  699  KGGISNLEELKCLEHLK  715



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = -3

Query  175  KNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVF--FEKLKCLENLK  2
            +NI+T+ TI+P  CTE+I  +TPNL+KL +RG L   + E     +F    KL  LE LK
Sbjct  662  RNIQTICTIVPECCTENILSRTPNLKKLGIRGKLVMLVQERGGMSLFDNLAKLDHLETLK  721



>ref|XP_006367931.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X2 [Solanum tuberosum]
Length=932

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +TT      ++TLS + P SC +D+  K   L+KL +RG ++ FL E 
Sbjct  643  NIPAKLPAP---ATTTGKTSCLQTLSMVAPESCKKDVLAKACLLKKLSIRGQMASFL-EP  698

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LKCLE+LK
Sbjct  699  KGGISNLEELKCLEHLK  715



>emb|CDP16255.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -3

Query  232  NTSMQLPFP--PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN  59
            N S  LP P  PK     S   N++TLS+I P+SCT+++F + P L+KL + G L+  L 
Sbjct  642  NASTSLPCPTTPKGKEEASVNANLQTLSSISPKSCTKELFERAPKLKKLAICGRLA-ILI  700

Query  58   ESKSSCVFFEK---LKCLENLK  2
            E+      FE    L+ LENLK
Sbjct  701  EANGQSRLFESLCTLQFLENLK  722



>gb|KDO39041.1| hypothetical protein CISIN_1g0038902mg, partial [Citrus sinensis]
Length=714

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +ST+ P SCT DI  + PN+Q L + GDLS + +    
Sbjct  626  SITLPAPPKNYS--SSLKNLIFISTLNPSSCTPDILGRLPNVQTLRISGDLSCYHSGVSK  683

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  684  SLCELHKLECL  694



>ref|XP_006471238.1| PREDICTED: disease resistance protein RPP8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471239.1| PREDICTED: disease resistance protein RPP8-like isoform X2 [Citrus 
sinensis]
Length=849

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +ST+ P SCT DI  + PN+Q L + GDLS + +    
Sbjct  626  SITLPAPPKNYS--SSLKNLIFISTLNPSSCTPDILGRLPNVQTLRISGDLSCYHSGVSK  683

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  684  SLCELHKLECL  694



>gb|KDO40278.1| hypothetical protein CISIN_1g037494mg, partial [Citrus sinensis]
Length=394

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P +Q L + GDLS + +    
Sbjct  250  SITLPAPPKNYS--SSLKNLIFISALHPSSCTPDILSRLPTVQTLRISGDLSHYHSGVSK  307

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  308  SLCELHKLECLK  319



>ref|XP_009793040.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=881

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++     P  +TT      ++TL  + P SC +++  K  +L+KL +RG ++ FL   
Sbjct  641  HTNIPAKLQPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAY  700

Query  52   KSSCVFFEKLKCLENLK  2
            K       +LKCLE LK
Sbjct  701  KGGINNLAELKCLEQLK  717



>emb|CDP20211.1| unnamed protein product [Coffea canephora]
Length=694

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 5/79 (6%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            NTS  LP   ++S    GG+N++TLST+ P S T+D+F++T NL+KL + G L+  +  +
Sbjct  453  NTSTILPKCLEQS---PGGENLQTLSTVSPESLTKDVFKRTRNLKKLGICGKLNNIVEAN  509

Query  52   KSSCVF--FEKLKCLENLK  2
              S +F    +L  LENLK
Sbjct  510  GESSLFDCLCELNSLENLK  528



>ref|XP_004236958.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 44/77 (57%), Gaps = 3/77 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +TT      ++TLS + P SC +++  K  N++KL +RG ++ FL   
Sbjct  638  NIPAKLPSP---TTTTGKPSCLQTLSMVTPESCEKEVLAKACNVKKLSIRGQMAAFLGAY  694

Query  52   KSSCVFFEKLKCLENLK  2
            K      ++L+CLE+LK
Sbjct  695  KGGINNLKELQCLEHLK  711



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = -3

Query  208  PPKRSTTDSGG----KNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSC  41
            PP ++  D+      +NI+T+ST+LP  C E+I  +TP L+KL +RG ++  +  +  S 
Sbjct  647  PPAKTRKDNEDPFVRRNIQTISTVLPDCCKENILARTPGLRKLGIRGKVATLVATNGDSS  706

Query  40   VF--FEKLKCLENLK  2
            +F    KL  LE LK
Sbjct  707  LFDNLAKLDNLETLK  721



>ref|XP_009591232.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=743

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 41/76 (54%), Gaps = 0/76 (0%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            +T++     P  +TT     +++TL  + P SC +++  K  +L+KL +RG ++ FL   
Sbjct  503  HTNIPAKLQPPTATTSGKASSLQTLCMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAY  562

Query  52   KSSCVFFEKLKCLENL  5
            K       +LKCLE L
Sbjct  563  KGGINNLVELKCLEQL  578



>gb|EYU22232.1| hypothetical protein MIMGU_mgv1a002671mg [Erythranthe guttata]
Length=648

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  205  PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEK  26
            PK   +   G+ ++TL TI P+SCTE++F +  NL++L +RG L+  +     S     K
Sbjct  411  PKTGKSSKEGEKLQTLGTISPQSCTEEVFDRARNLKRLGIRGRLASLIEGKVGSFDSLGK  470

Query  25   LKCLENLK  2
            L  LE LK
Sbjct  471  LGNLEKLK  478



>emb|CDP11611.1| unnamed protein product [Coffea canephora]
Length=921

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  172  NIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCV  38
            N++TLSTI P SCT D+F++TP L+KL +RG++   +  S+ S +
Sbjct  698  NLQTLSTISPESCTTDVFKRTPKLKKLGIRGNIGLLVQPSRESSL  742



>ref|XP_004236959.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=884

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 41/77 (53%), Gaps = 3/77 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N   +LP P   +TT      ++TLS + P SC E +  K  N++KL +RG +  FL   
Sbjct  641  NIPAKLPSP---TTTTGKPSCLQTLSMVAPESCEEQVLAKACNVKKLSIRGQMEAFLGAY  697

Query  52   KSSCVFFEKLKCLENLK  2
            K      E+LK LE+LK
Sbjct  698  KGGINNLEELKRLEHLK  714



>ref|XP_006471232.1| PREDICTED: disease resistance protein RPP8-like [Citrus sinensis]
Length=360

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  137  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  194

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  195  SLCELHKLECLK  206



>ref|XP_011072005.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=886

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  205  PKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSS  44
            PK   +   G+ +RTL TI P+SCTE++F +  NL+KL +RG L+  ++    S
Sbjct  651  PKTGKSSKEGERLRTLGTISPQSCTEEVFERARNLKKLGIRGRLAMLIDGKSGS  704



>ref|XP_006471228.1| PREDICTED: probable disease resistance protein RF9-like [Citrus 
sinensis]
Length=249

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNE-SK  50
            S+ LP PP  +   S  KN+  +S + P SCT DI  + PN+Q L + GDLS + +  SK
Sbjct  26   SITLPAPP--TNYSSSLKNLIFVSALHPISCTPDILGRLPNIQTLRISGDLSYYQSRVSK  83

Query  49   SSCVFFEKLKCLENLK  2
            S C    KL+ LE LK
Sbjct  84   SLC----KLQKLEWLK  95



>ref|XP_006495296.1| PREDICTED: probable disease resistance protein RF9-like [Citrus 
sinensis]
Length=727

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  504  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  561

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  562  SLCELHKLECLK  573



>ref|XP_006471237.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X5 [Citrus sinensis]
Length=849

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  626  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  683

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  684  SLCELHKLECL  694



>ref|XP_006471233.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471234.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X2 [Citrus sinensis]
 ref|XP_006471235.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X3 [Citrus sinensis]
Length=891

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  668  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  725

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  726  SLCELHKLECL  736



>emb|CDP16256.1| unnamed protein product [Coffea canephora]
Length=702

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  LP P           N++TLS+I P+SCT+++F +TP L+KL + G L+     +
Sbjct  457  NASTSLPCPTTPRCETLVNANLQTLSSISPQSCTKELFERTPKLKKLAICGKLAVLFRAN  516

Query  52   KSSCVF--FEKLKCLENLK  2
              S VF     L  LENLK
Sbjct  517  GRSNVFESLCALDFLENLK  535



>ref|XP_006471226.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X4 [Citrus sinensis]
Length=813

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  590  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  647

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  648  SLCELHKLECL  658



>ref|XP_006471236.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X4 [Citrus sinensis]
Length=854

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  631  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  688

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  689  SLCELHKLECL  699



>ref|XP_006471223.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471224.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X2 [Citrus sinensis]
 ref|XP_006471225.1| PREDICTED: probable disease resistance RPP8-like protein 2-like 
isoform X3 [Citrus sinensis]
Length=850

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  627  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  684

Query  46   SCVFFEKLKCL  14
            S     KL+CL
Sbjct  685  SLCELHKLECL  695



>ref|XP_009796668.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009796669.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
Length=898

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            +RTLS + P SC   +  K  NL+KL ++G+++ FL  +K       +LKCLENLK
Sbjct  665  LRTLSMVAPESCNSCVLAKVGNLKKLSIKGNMAPFLEINKDGFSNHGELKCLENLK  720



>ref|XP_009796670.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X4 [Nicotiana sylvestris]
Length=887

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            +RTLS + P SC   +  K  NL+KL ++G+++ FL  +K       +LKCLENLK
Sbjct  665  LRTLSMVAPESCNSCVLAKVGNLKKLSIKGNMAPFLEINKDGFSNHGELKCLENLK  720



>ref|XP_009796664.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=916

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            +RTLS + P SC   +  K  NL+KL ++G+++ FL  +K       +LKCLENLK
Sbjct  665  LRTLSMVAPESCNSCVLAKVGNLKKLSIKGNMAPFLEINKDGFSNHGELKCLENLK  720



>ref|XP_009796671.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
 ref|XP_009796672.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
Length=776

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            +RTLS + P SC   +  K  NL+KL ++G+++ FL  +K       +LKCLENLK
Sbjct  525  LRTLSMVAPESCNSCVLAKVGNLKKLSIKGNMAPFLEINKDGFSNHGELKCLENLK  580



>ref|XP_009796665.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009796666.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=906

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -3

Query  169  IRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVFFEKLKCLENLK  2
            +RTLS + P SC   +  K  NL+KL ++G+++ FL  +K       +LKCLENLK
Sbjct  665  LRTLSMVAPESCNSCVLAKVGNLKKLSIKGNMAPFLEINKDGFSNHGELKCLENLK  720



>gb|KDO35880.1| hypothetical protein CISIN_1g010381mg [Citrus sinensis]
Length=512

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNE-SK  50
            S+ LP PP  +   S  KN+  +S + P SCT DI  + PN+Q L + GDLS + +  SK
Sbjct  289  SITLPAPP--TNYSSSLKNLIFVSALHPISCTPDILGRLPNIQTLRISGDLSYYQSRVSK  346

Query  49   SSCVFFEKLKCLENLK  2
            S C    KL+ LE LK
Sbjct  347  SLC----KLQKLEWLK  358



>ref|XP_006471220.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471221.1| PREDICTED: probable disease resistance protein RF9-like isoform 
X2 [Citrus sinensis]
Length=249

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  K++  +S + P SCT DI  + P++Q L + GDLS + +    
Sbjct  26   SITLPAPPKNYS--SSLKSLIFISALNPSSCTPDILGRLPSVQTLRISGDLSYYQSGVSK  83

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  84   SLCELHKLECLK  95



>ref|XP_011072179.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=787

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  199  RSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKSSCVF  35
            ++     G+ I+TL  I P+SCT+D+F +  NL+KL +RG L+  L++   S  F
Sbjct  627  KAGAGGNGEKIQTLLNISPQSCTDDLFERAINLKKLGIRGQLTMLLDDKGGSTTF  681



>gb|EYU24144.1| hypothetical protein MIMGU_mgv1a001094mg [Erythranthe guttata]
Length=891

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNES  53
            N S  L  P K S     G  ++TL TI   SCTE +  K  NL+KL VRG+L+  ++  
Sbjct  655  NASATLIKPGKASKE---GDMLQTLGTISTESCTEALIVKARNLKKLGVRGNLALLMDPK  711

Query  52   KSSCVFFEKLKCLENLK  2
              S     KL  LENLK
Sbjct  712  SGSFDSLRKLGSLENLK  728



>ref|XP_009622940.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana tomentosiformis]
Length=890

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 10/78 (13%)
 Frame = -3

Query  232  NTSMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLN-E  56
            N  ++LP P   S   S    ++TLS I P SCT ++  K  NL+KL + G L   L  E
Sbjct  658  NKPVKLPLP---SNPISKSSCLQTLSKIAPESCTRNVLAKVCNLKKLGIEGKLEALLGFE  714

Query  55   SKSSCVFFEKLKCLENLK  2
            S      FE+LKCLE LK
Sbjct  715  S------FEELKCLERLK  726



>gb|KDO39821.1| hypothetical protein CISIN_1g045386mg [Citrus sinensis]
Length=706

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -3

Query  226  SMQLPFPPKRSTTDSGGKNIRTLSTILPRSCTEDIFRKTPNLQKLYVRGDLSEFLNESKS  47
            S+ LP PPK  +  S  KN+  +S + P SCT DI  + P+++ L + GDLS + +    
Sbjct  606  SITLPAPPKNYS--SSLKNLIFISALNPSSCTPDILDRLPSVRTLRISGDLSYYQSGVSK  663

Query  46   SCVFFEKLKCLE  11
            S     KL+CL+
Sbjct  664  SLCELHKLECLK  675



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519253874986