BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49809_g1_i1 len=206 path=[184:0-205]

Length=206
                                                                      Score     E

ref|XP_009612837.1|  PREDICTED: putative late blight resistance p...  50.1    5e-05   
ref|XP_009592156.1|  PREDICTED: late blight resistance protein R1...  48.1    2e-04   
emb|CDP16976.1|  unnamed protein product                              47.8    3e-04   
emb|CDP07957.1|  unnamed protein product                              46.6    7e-04   
ref|XP_009780986.1|  PREDICTED: late blight resistance protein R1...  46.2    9e-04   
ref|XP_009769771.1|  PREDICTED: late blight resistance protein R1...  46.2    0.001   



>ref|XP_009612837.1| PREDICTED: putative late blight resistance protein homolog R1A-10, 
partial [Nicotiana tomentosiformis]
Length=845

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -1

Query  206  ITLSVSAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNIS  27
            + +  SA STIA LPNL  LI  GC+FE+   W +  + +FP LKIL+   + +  W++S
Sbjct  640  VNIQASATSTIAALPNLQRLIFEGCRFEQEE-WDV-RDMEFPVLKILKFRSIHLREWHVS  697

Query  26   NVAESFP  6
              + SFP
Sbjct  698  E-SSSFP  703



>ref|XP_009592156.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=888

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -1

Query  206  ITLSVSAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNIS  27
            + +S SA STIA LPNL  LI  GC FE+   W +  + +FP LKIL+   + +  W++S
Sbjct  640  VNISASATSTIAGLPNLQRLIFEGCIFEQDE-WDV-RDMEFPVLKILKFRGVHLRGWHVS  697

Query  26   NVAESFP  6
              + SFP
Sbjct  698  E-STSFP  703



>emb|CDP16976.1| unnamed protein product [Coffea canephora]
Length=1158

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = -1

Query  191   SAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNISNVAES  12
             SAIS+I +LPNL  L LLG K     IW + EE +FPKLK L+L  L +  W  S  ++ 
Sbjct  1035  SAISSIGRLPNLEVLKLLGAKGYRVEIWNM-EEGEFPKLKFLKLEALPVVRWTCS--SDH  1091

Query  11    FPC  3
              PC
Sbjct  1092  LPC  1094



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)
 Frame = -1

Query  191   SAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNISNVAES  12
             SA+S I +LPNL  L LL   F E   W ++EE +F KLK L+L  LDI  WN S   + 
Sbjct  1145  SAVSAIGKLPNLEVLKLLHASF-EGKTWDMKEE-EFLKLKFLKLESLDIAHWNASE--DH  1200

Query  11    FPC  3
              PC
Sbjct  1201  LPC  1203



>ref|XP_009780986.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana sylvestris]
Length=803

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = -1

Query  206  ITLSVSAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNIS  27
            I +  SA STIA LPNL  L+  GC+FE+   W +  + +FP LKIL+   + I  W++ 
Sbjct  654  INILASATSTIAGLPNLQRLVFQGCRFEQEE-WDV-RDMEFPVLKILKFRGVHIREWHVL  711

Query  26   NVAESFP  6
              + SFP
Sbjct  712  E-SSSFP  717



>ref|XP_009769771.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=771

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = -1

Query  206  ITLSVSAISTIAQLPNLGSLILLGCKFEESLIWILEEETKFPKLKILQLVLLDIGIWNIS  27
            + +  SA ST+A LPNL  LI  GC FE+   W +  + +FP LKIL+   + +  W++S
Sbjct  634  VNILASATSTLAALPNLQRLIFQGCTFEQEE-WDV-RDMEFPVLKILKFRSIHLRGWHVS  691

Query  26   NVAESFP  6
              + SFP
Sbjct  692  E-SSSFP  697



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515927033552