BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49785_g1_i1 len=209 path=[187:0-208]

Length=209
                                                                      Score     E

emb|CBI15537.3|  unnamed protein product                              87.8    2e-20   
ref|XP_010663659.1|  PREDICTED: uncharacterized protein LOC100250849  87.4    6e-20   
gb|EYU30626.1|  hypothetical protein MIMGU_mgv1a007496mg              91.3    6e-20   
ref|XP_010658806.1|  PREDICTED: uncharacterized protein LOC100248266  87.4    8e-20   
emb|CBI22368.3|  unnamed protein product                              85.5    1e-19   
gb|EMT02083.1|  hypothetical protein F775_18912                       89.4    2e-19   
gb|AAO33772.1|  unknown                                               88.6    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006653957.1|  PREDICTED: uncharacterized protein LOC102713904  89.0    3e-19   
ref|NP_001054429.1|  Os05g0108100                                     89.0    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KEH20773.1|  lysine ketoglutarate reductase trans-splicing pro...  88.6    4e-19   
ref|XP_008446150.1|  PREDICTED: uncharacterized protein LOC103488962  88.2    6e-19   
emb|CBI16790.3|  unnamed protein product                              87.8    7e-19   
emb|CBI33097.3|  unnamed protein product                              84.3    8e-19   
ref|XP_010650498.1|  PREDICTED: uncharacterized protein LOC100243914  87.8    8e-19   
ref|XP_009620378.1|  PREDICTED: uncharacterized protein LOC104112222  87.8    9e-19   
dbj|BAJ92182.1|  predicted protein                                    87.4    1e-18   
ref|XP_004135276.1|  PREDICTED: uncharacterized protein LOC101222926  87.4    1e-18   
ref|XP_009779721.1|  PREDICTED: uncharacterized protein LOC104228871  87.0    2e-18   
ref|XP_010660206.1|  PREDICTED: uncharacterized protein LOC100254498  85.5    2e-18   
gb|ACF80075.1|  unknown                                               83.2    2e-18   Zea mays [maize]
ref|XP_008458831.1|  PREDICTED: uncharacterized protein LOC103498119  86.7    2e-18   
ref|XP_006357623.1|  PREDICTED: uncharacterized protein LOC102588935  87.4    3e-18   
ref|XP_010044565.1|  PREDICTED: uncharacterized protein LOC104433498  86.3    3e-18   
ref|XP_009382917.1|  PREDICTED: uncharacterized protein LOC103970734  86.3    4e-18   
ref|XP_004504125.1|  PREDICTED: uncharacterized protein LOC101498637  85.9    5e-18   
gb|KHN44372.1|  hypothetical protein glysoja_014413                   85.5    5e-18   
gb|ACU23804.1|  unknown                                               84.7    6e-18   Glycine max [soybeans]
ref|XP_006415818.1|  hypothetical protein EUTSA_v10009392mg           85.5    6e-18   
ref|XP_010320939.1|  PREDICTED: uncharacterized protein LOC101244...  85.1    6e-18   
ref|XP_007163683.1|  hypothetical protein PHAVU_001G255300g           85.5    6e-18   
ref|XP_011086653.1|  PREDICTED: uncharacterized protein LOC105168320  85.5    6e-18   
ref|XP_003538598.1|  PREDICTED: uncharacterized protein LOC100778486  85.5    7e-18   
emb|CDP13233.1|  unnamed protein product                              85.1    7e-18   
ref|XP_010646200.1|  PREDICTED: uncharacterized protein LOC100853772  84.3    8e-18   
ref|XP_004239135.1|  PREDICTED: uncharacterized protein LOC101244...  85.1    8e-18   
ref|XP_009617944.1|  PREDICTED: uncharacterized protein LOC104110...  85.1    9e-18   
ref|XP_008360119.1|  PREDICTED: uncharacterized protein LOC103423...  84.7    1e-17   
ref|XP_008340102.1|  PREDICTED: uncharacterized protein LOC103403...  84.7    1e-17   
ref|XP_004502391.1|  PREDICTED: uncharacterized protein LOC101511...  84.7    1e-17   
ref|XP_009617943.1|  PREDICTED: uncharacterized protein LOC104110...  84.7    1e-17   
ref|XP_009617942.1|  PREDICTED: uncharacterized protein LOC104110...  84.7    1e-17   
ref|XP_004142781.1|  PREDICTED: uncharacterized protein LOC101219968  84.7    1e-17   
ref|XP_008360116.1|  PREDICTED: uncharacterized protein LOC103423...  84.7    1e-17   
ref|XP_009797243.1|  PREDICTED: uncharacterized protein LOC104243...  84.7    1e-17   
ref|XP_010248668.1|  PREDICTED: uncharacterized protein LOC104591513  84.7    1e-17   
ref|XP_008340099.1|  PREDICTED: uncharacterized protein LOC103403...  84.7    1e-17   
ref|XP_009797241.1|  PREDICTED: uncharacterized protein LOC104243...  84.7    1e-17   
ref|XP_010320937.1|  PREDICTED: uncharacterized protein LOC101248010  84.7    1e-17   
ref|NP_001141373.1|  hypothetical protein                             82.8    2e-17   Zea mays [maize]
gb|ACF81291.1|  unknown                                               80.1    2e-17   Zea mays [maize]
ref|XP_006852374.1|  hypothetical protein AMTR_s00049p00225510        84.3    2e-17   
ref|XP_006357597.1|  PREDICTED: uncharacterized protein LOC102579...  84.0    2e-17   
ref|XP_008221901.1|  PREDICTED: uncharacterized protein LOC103321...  84.0    2e-17   
gb|KHG06071.1|  Trimethylguanosine synthase                           83.6    2e-17   
ref|XP_006357596.1|  PREDICTED: uncharacterized protein LOC102579...  84.0    2e-17   
ref|XP_008221898.1|  PREDICTED: uncharacterized protein LOC103321...  84.0    3e-17   
ref|XP_010499155.1|  PREDICTED: uncharacterized protein LOC104776741  83.6    3e-17   
ref|XP_008221900.1|  PREDICTED: uncharacterized protein LOC103321...  84.0    3e-17   
ref|XP_010460435.1|  PREDICTED: uncharacterized protein LOC104741...  83.6    3e-17   
ref|XP_010251037.1|  PREDICTED: uncharacterized protein LOC104593065  84.0    3e-17   
emb|CDP07097.1|  unnamed protein product                              83.6    3e-17   
ref|XP_010460429.1|  PREDICTED: uncharacterized protein LOC104741...  83.6    3e-17   
ref|XP_009359206.1|  PREDICTED: uncharacterized protein LOC103949...  83.6    3e-17   
ref|XP_009359205.1|  PREDICTED: uncharacterized protein LOC103949...  83.6    3e-17   
ref|XP_003551994.1|  PREDICTED: uncharacterized protein LOC100811...  83.6    3e-17   
ref|XP_009359203.1|  PREDICTED: uncharacterized protein LOC103949...  83.6    3e-17   
ref|NP_001141005.1|  lysine ketoglutarate reductase trans-splicing 1  83.6    4e-17   Zea mays [maize]
ref|XP_006601926.1|  PREDICTED: uncharacterized protein LOC100811...  83.6    4e-17   
gb|KDP26690.1|  hypothetical protein JCGZ_17848                       83.2    4e-17   
ref|XP_009402707.1|  PREDICTED: uncharacterized protein LOC103986416  83.6    4e-17   
ref|XP_004231837.1|  PREDICTED: uncharacterized protein LOC101259691  83.2    4e-17   
emb|CDY03878.1|  BnaC07g11030D                                        82.8    4e-17   
ref|XP_003525038.1|  PREDICTED: uncharacterized protein LOC100785...  83.2    4e-17   
ref|XP_006338630.1|  PREDICTED: uncharacterized protein LOC102584113  83.2    5e-17   
ref|XP_003601902.1|  hypothetical protein MTR_3g086610                83.2    5e-17   
ref|XP_007159701.1|  hypothetical protein PHAVU_002G259900g           83.2    5e-17   
emb|CDY68593.1|  BnaCnng59670D                                        82.8    5e-17   
ref|NP_001149970.1|  lysine ketoglutarate reductase trans-splicin...  83.2    5e-17   Zea mays [maize]
ref|XP_006580252.1|  PREDICTED: uncharacterized protein LOC100793...  82.8    5e-17   
ref|XP_007222780.1|  hypothetical protein PRUPE_ppa006602mg           82.8    6e-17   
emb|CDX84961.1|  BnaC05g20940D                                        82.4    6e-17   
emb|CDY27582.1|  BnaA09g28250D                                        82.4    6e-17   
ref|XP_007222781.1|  hypothetical protein PRUPE_ppa006602mg           82.8    6e-17   
ref|XP_003524254.1|  PREDICTED: uncharacterized protein LOC100793...  82.8    7e-17   
ref|XP_009103748.1|  PREDICTED: uncharacterized protein LOC103829800  82.4    7e-17   
gb|KHN06548.1|  hypothetical protein glysoja_010892                   82.4    7e-17   
ref|XP_010477996.1|  PREDICTED: uncharacterized protein LOC104757...  82.4    7e-17   
ref|XP_010477994.1|  PREDICTED: uncharacterized protein LOC104757...  82.4    8e-17   
ref|XP_010912960.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  82.8    8e-17   
gb|AFK47373.1|  unknown                                               82.4    8e-17   
ref|XP_009589970.1|  PREDICTED: uncharacterized protein LOC104087260  82.4    8e-17   
ref|XP_009770312.1|  PREDICTED: uncharacterized protein LOC104221038  82.4    8e-17   
emb|CDY32571.1|  BnaC02g17640D                                        80.1    9e-17   
ref|XP_009763116.1|  PREDICTED: uncharacterized protein LOC104215067  82.4    9e-17   
ref|XP_009113820.1|  PREDICTED: uncharacterized protein LOC103839077  82.4    9e-17   
gb|AAG28913.1|AC008113_29  F12A21.2                                   81.6    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521489.1|  conserved hypothetical protein                   82.0    1e-16   Ricinus communis
gb|KEH22115.1|  lysine ketoglutarate reductase trans-splicing-lik...  82.0    1e-16   
ref|XP_009419384.1|  PREDICTED: uncharacterized protein LOC103999363  82.0    1e-16   
ref|XP_010906956.1|  PREDICTED: uncharacterized protein LOC105033...  82.0    1e-16   
ref|XP_010906954.1|  PREDICTED: uncharacterized protein LOC105033...  82.0    1e-16   
ref|NP_001150432.1|  LOC100284062                                     82.0    1e-16   Zea mays [maize]
gb|AFK41298.1|  unknown                                               79.3    1e-16   
ref|XP_010906955.1|  PREDICTED: uncharacterized protein LOC105033...  82.0    1e-16   
ref|XP_008672947.1|  PREDICTED: LOC100284062 isoform X1               82.0    1e-16   
ref|XP_004145746.1|  PREDICTED: uncharacterized protein LOC101216740  82.0    1e-16   
ref|XP_009804484.1|  PREDICTED: uncharacterized protein LOC104249...  82.4    1e-16   
ref|XP_009804490.1|  PREDICTED: uncharacterized protein LOC104249...  81.6    2e-16   
ref|XP_004971411.1|  PREDICTED: uncharacterized protein LOC101761...  81.6    2e-16   
gb|KHN29027.1|  hypothetical protein glysoja_008362                   81.3    2e-16   
ref|XP_004971415.1|  PREDICTED: uncharacterized protein LOC101761...  81.6    2e-16   
emb|CDX77169.1|  BnaC04g39640D                                        81.3    2e-16   
ref|XP_009804486.1|  PREDICTED: uncharacterized protein LOC104249...  81.6    2e-16   
ref|XP_004960543.1|  PREDICTED: uncharacterized protein LOC101781300  81.6    2e-16   
ref|XP_002456820.1|  hypothetical protein SORBIDRAFT_03g043390        81.6    2e-16   Sorghum bicolor [broomcorn]
ref|XP_002311761.1|  hypothetical protein POPTR_0008s18970g           81.6    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002880936.1|  hypothetical protein ARALYDRAFT_481676           81.3    2e-16   
emb|CDP20564.1|  unnamed protein product                              79.7    2e-16   
ref|XP_002530039.1|  conserved hypothetical protein                   81.3    2e-16   Ricinus communis
ref|XP_006585254.1|  PREDICTED: uncharacterized protein LOC100776631  81.3    2e-16   
emb|CDY70480.1|  BnaAnng33820D                                        81.3    2e-16   
ref|XP_009103671.1|  PREDICTED: uncharacterized protein LOC103829726  81.3    2e-16   
ref|XP_002887149.1|  hypothetical protein ARALYDRAFT_894542           81.3    2e-16   
ref|XP_006303749.1|  hypothetical protein CARUB_v10011910mg           80.9    2e-16   
gb|KHG02361.1|  hypothetical protein F383_25835                       81.6    2e-16   
ref|XP_009105088.1|  PREDICTED: uncharacterized protein LOC103831005  81.3    2e-16   
ref|XP_002459174.1|  hypothetical protein SORBIDRAFT_03g047280        81.3    3e-16   Sorghum bicolor [broomcorn]
ref|NP_564909.1|  uncharacterized protein                             81.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470103.1|  PREDICTED: uncharacterized protein LOC104750070  80.9    3e-16   
gb|AAM15148.1|  unknown protein                                       80.5    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510643.1|  PREDICTED: uncharacterized protein LOC104786889  80.9    3e-16   
gb|AAF97966.1|AC000103_16  F21J9.23                                   80.1    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089275.1|  PREDICTED: uncharacterized protein LOC105170284  80.9    3e-16   
ref|XP_010414551.1|  PREDICTED: uncharacterized protein LOC104700705  80.9    3e-16   
ref|XP_006340181.1|  PREDICTED: uncharacterized protein LOC102584998  80.9    3e-16   
ref|XP_011034057.1|  PREDICTED: uncharacterized protein LOC105132327  80.9    3e-16   
ref|XP_010689522.1|  PREDICTED: uncharacterized protein LOC104903222  80.9    3e-16   
gb|KDP44036.1|  hypothetical protein JCGZ_05503                       80.5    3e-16   
ref|XP_009784116.1|  PREDICTED: uncharacterized protein LOC104232580  80.5    3e-16   
ref|XP_011042401.1|  PREDICTED: uncharacterized protein LOC105138...  80.9    4e-16   
ref|XP_009617481.1|  PREDICTED: uncharacterized protein LOC104109818  80.5    4e-16   
ref|XP_011042400.1|  PREDICTED: uncharacterized protein LOC105138...  80.9    4e-16   
ref|XP_009140891.1|  PREDICTED: uncharacterized protein LOC103864879  80.5    4e-16   
ref|XP_009618474.1|  PREDICTED: uncharacterized protein LOC104110619  80.5    4e-16   
ref|XP_002314593.1|  hypothetical protein POPTR_0010s05730g           80.9    4e-16   Populus trichocarpa [western balsam poplar]
emb|CDY56527.1|  BnaA07g38670D                                        81.3    4e-16   
ref|XP_010696376.1|  PREDICTED: uncharacterized protein LOC104908903  79.3    4e-16   
ref|XP_010108849.1|  hypothetical protein L484_020585                 81.6    4e-16   
ref|NP_683328.6|  uncharacterized protein                             80.5    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004971002.1|  PREDICTED: uncharacterized protein LOC101768...  80.5    4e-16   
ref|XP_003565154.1|  PREDICTED: uncharacterized protein LOC100832535  80.5    4e-16   
gb|EEE56778.1|  hypothetical protein OsJ_06354                        80.5    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72958.1|  hypothetical protein OsI_06843                        80.5    5e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001046611.1|  Os02g0297600                                     80.5    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_850118.1|  uncharacterized protein                             80.1    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647190.1|  PREDICTED: uncharacterized protein LOC102709338  80.5    5e-16   
emb|CDM80653.1|  unnamed protein product                              80.5    6e-16   
ref|XP_004971001.1|  PREDICTED: uncharacterized protein LOC101768...  80.5    6e-16   
ref|XP_006438248.1|  hypothetical protein CICLE_v10031670mg           80.5    6e-16   
ref|XP_004970998.1|  PREDICTED: uncharacterized protein LOC101768...  80.5    6e-16   
ref|XP_010232719.1|  PREDICTED: uncharacterized protein LOC100831...  80.1    6e-16   
ref|XP_003564891.1|  PREDICTED: uncharacterized protein LOC100831...  80.1    6e-16   
ref|XP_006300986.1|  hypothetical protein CARUB_v10021375mg           80.1    7e-16   
ref|XP_008676605.1|  PREDICTED: uncharacterized protein LOC100193...  80.1    7e-16   
gb|AFW62453.1|  hypothetical protein ZEAMMB73_667064                  80.1    7e-16   
gb|AFW62455.1|  hypothetical protein ZEAMMB73_667064                  80.1    7e-16   
ref|XP_004952281.1|  PREDICTED: uncharacterized protein LOC101755...  80.1    7e-16   
ref|NP_001132425.1|  uncharacterized protein LOC100193875             80.1    7e-16   Zea mays [maize]
ref|XP_004952283.1|  PREDICTED: uncharacterized protein LOC101755...  80.1    7e-16   
ref|XP_008804224.1|  PREDICTED: uncharacterized protein LOC103717...  80.1    7e-16   
emb|CDY28844.1|  BnaC06g26320D                                        80.5    7e-16   
ref|XP_006424551.1|  hypothetical protein CICLE_v10028654mg           79.7    8e-16   
ref|XP_006645331.1|  PREDICTED: uncharacterized protein LOC102709326  80.1    8e-16   
ref|NP_001045532.1|  Os01g0971200                                     80.1    8e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KDO82211.1|  hypothetical protein CISIN_1g013577mg                 80.1    8e-16   
ref|XP_008804220.1|  PREDICTED: uncharacterized protein LOC103717...  79.7    8e-16   
ref|XP_008804222.1|  PREDICTED: uncharacterized protein LOC103717...  79.7    8e-16   
ref|XP_006409854.1|  hypothetical protein EUTSA_v10016806mg           79.7    8e-16   
ref|XP_006357566.1|  PREDICTED: uncharacterized protein LOC102597248  79.7    8e-16   
ref|XP_006424550.1|  hypothetical protein CICLE_v10028654mg           79.7    8e-16   
gb|KDO73331.1|  hypothetical protein CISIN_1g017018mg                 79.3    9e-16   
ref|XP_006858380.1|  hypothetical protein AMTR_s00064p00205830        80.1    9e-16   
ref|XP_009771349.1|  PREDICTED: uncharacterized protein LOC104221902  79.7    9e-16   
ref|XP_008362120.1|  PREDICTED: uncharacterized protein LOC103425...  79.7    9e-16   
ref|XP_008362122.1|  PREDICTED: uncharacterized protein LOC103425...  79.7    9e-16   
gb|EEC72250.1|  hypothetical protein OsI_05383                        79.7    9e-16   Oryza sativa Indica Group [Indian rice]
gb|EMT33056.1|  hypothetical protein F775_17511                       80.5    1e-15   
emb|CDY12672.1|  BnaA02g13400D                                        80.1    1e-15   
ref|XP_006470471.1|  PREDICTED: uncharacterized protein LOC102609262  79.3    1e-15   
gb|KDO49037.1|  hypothetical protein CISIN_1g015489mg                 79.7    1e-15   
ref|XP_010415381.1|  PREDICTED: uncharacterized protein LOC104701401  79.3    1e-15   
emb|CDP16614.1|  unnamed protein product                              79.3    1e-15   
ref|XP_003531333.1|  PREDICTED: uncharacterized protein LOC100805311  79.3    1e-15   
gb|KHN29026.1|  hypothetical protein glysoja_008361                   79.3    1e-15   
ref|XP_004304668.1|  PREDICTED: uncharacterized protein LOC101309467  79.3    1e-15   
ref|XP_010470715.1|  PREDICTED: uncharacterized protein LOC104750595  79.3    1e-15   
ref|XP_009617945.1|  PREDICTED: uncharacterized protein LOC104110200  79.3    1e-15   
ref|XP_010542587.1|  PREDICTED: uncharacterized protein LOC104815743  79.0    1e-15   
ref|XP_011101801.1|  PREDICTED: uncharacterized protein LOC105179...  79.0    2e-15   
ref|XP_006391211.1|  hypothetical protein EUTSA_v10018653mg           79.0    2e-15   
ref|XP_008379197.1|  PREDICTED: uncharacterized protein LOC103442207  79.0    2e-15   
ref|XP_004977866.1|  PREDICTED: uncharacterized protein LOC101753754  79.0    2e-15   
gb|EYU44800.1|  hypothetical protein MIMGU_mgv1a007501mg              79.0    2e-15   
ref|XP_006391212.1|  hypothetical protein EUTSA_v10018653mg           79.0    2e-15   
ref|XP_010557340.1|  PREDICTED: uncharacterized protein LOC104826374  78.6    2e-15   
gb|KDP46396.1|  hypothetical protein JCGZ_10236                       79.0    2e-15   
ref|XP_011101803.1|  PREDICTED: uncharacterized protein LOC105179...  79.0    2e-15   
ref|XP_011101800.1|  PREDICTED: uncharacterized protein LOC105179...  79.0    2e-15   
emb|CDM85600.1|  unnamed protein product                              79.0    2e-15   
ref|XP_009127584.1|  PREDICTED: uncharacterized protein LOC103852432  78.6    2e-15   
ref|XP_007031624.1|  Uncharacterized protein isoform 7                78.6    2e-15   
ref|XP_004251145.1|  PREDICTED: uncharacterized protein LOC101261883  78.6    2e-15   
emb|CDY30497.1|  BnaA04g16360D                                        78.2    2e-15   
ref|XP_007159700.1|  hypothetical protein PHAVU_002G259800g           78.6    3e-15   
gb|EMT06881.1|  hypothetical protein F775_28460                       79.0    3e-15   
ref|XP_010511750.1|  PREDICTED: uncharacterized protein LOC104787807  78.6    3e-15   
ref|XP_007031618.1|  Uncharacterized protein isoform 1                78.6    3e-15   
emb|CBI34843.3|  unnamed protein product                              78.2    3e-15   
ref|XP_007031620.1|  Uncharacterized protein isoform 3                78.6    3e-15   
ref|XP_011089930.1|  PREDICTED: uncharacterized protein LOC105170731  78.2    3e-15   
ref|XP_002529935.1|  conserved hypothetical protein                   77.8    3e-15   Ricinus communis
ref|XP_010253713.1|  PREDICTED: uncharacterized protein LOC104594...  77.8    3e-15   
ref|XP_002272341.1|  PREDICTED: uncharacterized protein LOC100264636  78.2    3e-15   Vitis vinifera
ref|XP_008463954.1|  PREDICTED: uncharacterized protein LOC103501955  78.2    3e-15   
dbj|BAD82423.1|  putative lysine ketoglutarate reductase trans-sp...  78.2    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253712.1|  PREDICTED: uncharacterized protein LOC104594...  77.8    3e-15   
ref|XP_011097376.1|  PREDICTED: uncharacterized protein LOC105176...  77.8    3e-15   
ref|XP_007031622.1|  Uncharacterized protein isoform 5                78.6    3e-15   
ref|XP_009370346.1|  PREDICTED: uncharacterized protein LOC103959709  78.2    4e-15   
ref|XP_002893440.1|  hypothetical protein ARALYDRAFT_313424           77.4    4e-15   
ref|XP_009371751.1|  PREDICTED: uncharacterized protein LOC103960971  78.2    4e-15   
ref|XP_011044400.1|  PREDICTED: uncharacterized protein LOC105139...  77.4    4e-15   
ref|XP_010029096.1|  PREDICTED: uncharacterized protein LOC104419...  77.8    4e-15   
ref|XP_011044399.1|  PREDICTED: uncharacterized protein LOC105139...  77.4    4e-15   
ref|XP_002314280.2|  hypothetical protein POPTR_0009s01620g           77.8    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006645202.1|  PREDICTED: uncharacterized protein LOC102718787  77.8    4e-15   
ref|XP_010029094.1|  PREDICTED: uncharacterized protein LOC104419...  77.8    4e-15   
ref|XP_011014025.1|  PREDICTED: uncharacterized protein LOC105117916  77.8    4e-15   
gb|KHG25698.1|  hypothetical protein F383_04429                       77.8    4e-15   
ref|XP_007044821.1|  Uncharacterized protein isoform 1                77.8    4e-15   
gb|KHG21523.1|  copii coat assembly sec16                             77.4    5e-15   
ref|XP_011097369.1|  PREDICTED: uncharacterized protein LOC105176...  77.8    5e-15   
ref|XP_004299222.1|  PREDICTED: uncharacterized protein LOC101313310  77.8    5e-15   
gb|EYU36175.1|  hypothetical protein MIMGU_mgv1a0248541mg             74.3    5e-15   
gb|EEC72009.1|  hypothetical protein OsI_04874                        77.4    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010556216.1|  PREDICTED: uncharacterized protein LOC104825...  77.4    6e-15   
ref|XP_010556214.1|  PREDICTED: uncharacterized protein LOC104825...  77.4    6e-15   
ref|XP_004504126.1|  PREDICTED: uncharacterized protein LOC101498964  77.4    6e-15   
ref|XP_006365731.1|  PREDICTED: uncharacterized protein LOC102598936  77.4    6e-15   
ref|XP_006338796.1|  PREDICTED: uncharacterized protein LOC102581795  77.0    8e-15   
ref|XP_007215510.1|  hypothetical protein PRUPE_ppa006988mg           77.0    8e-15   
ref|XP_006846795.1|  hypothetical protein AMTR_s00148p00059020        76.6    1e-14   
gb|KEH30023.1|  lysine ketoglutarate reductase trans-splicing-lik...  76.3    1e-14   
ref|XP_007016772.1|  T6D22.12 isoform 1                               76.3    1e-14   
ref|XP_010321885.1|  PREDICTED: uncharacterized protein LOC101246...  76.3    1e-14   
emb|CDX95100.1|  BnaC05g05710D                                        76.6    1e-14   
gb|ABR16453.1|  unknown                                               76.3    1e-14   Picea sitchensis
gb|KEH20772.1|  lysine ketoglutarate reductase trans-splicing pro...  76.3    1e-14   
ref|XP_010043761.1|  PREDICTED: uncharacterized protein LOC104432886  76.3    2e-14   
gb|AAD31054.1|AC007357_3  F3F19.3                                     75.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010321883.1|  PREDICTED: uncharacterized protein LOC101246...  76.3    2e-14   
ref|XP_006417167.1|  hypothetical protein EUTSA_v10007793mg           76.3    2e-14   
ref|XP_008230511.1|  PREDICTED: uncharacterized protein LOC103329778  76.3    2e-14   
ref|XP_006395436.1|  hypothetical protein EUTSA_v10004352mg           76.3    2e-14   
ref|XP_010682025.1|  PREDICTED: uncharacterized protein LOC104896...  75.9    2e-14   
ref|XP_010682024.1|  PREDICTED: uncharacterized protein LOC104896...  76.3    2e-14   
ref|XP_002323994.1|  hypothetical protein POPTR_0017s10560g           75.9    2e-14   Populus trichocarpa [western balsam poplar]
ref|NP_172760.2|  uncharacterized protein                             75.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148057.1|  PREDICTED: uncharacterized protein LOC103871548  75.5    2e-14   
emb|CDP13232.1|  unnamed protein product                              75.5    2e-14   
ref|XP_010264658.1|  PREDICTED: uncharacterized protein LOC104602608  75.5    3e-14   
emb|CDX93598.1|  BnaA06g04500D                                        75.5    3e-14   
ref|XP_006303581.1|  hypothetical protein CARUB_v10011103mg           75.5    3e-14   
ref|XP_010501366.1|  PREDICTED: uncharacterized protein LOC104778611  73.9    3e-14   
ref|XP_004231836.1|  PREDICTED: uncharacterized protein LOC101259...  75.5    3e-14   
ref|XP_010315956.1|  PREDICTED: uncharacterized protein LOC101259...  75.5    3e-14   
ref|XP_010528212.1|  PREDICTED: uncharacterized protein LOC104805...  75.1    4e-14   
ref|XP_006417735.1|  hypothetical protein EUTSA_v10007913mg           75.1    4e-14   
ref|XP_004241278.1|  PREDICTED: uncharacterized protein LOC101263523  75.1    4e-14   
gb|EPS70966.1|  hypothetical protein M569_03794                       74.7    4e-14   
ref|XP_010528098.1|  PREDICTED: uncharacterized protein LOC104805281  75.1    4e-14   
ref|XP_002892430.1|  hypothetical protein ARALYDRAFT_888027           74.7    5e-14   
emb|CDY27580.1|  BnaA09g28270D                                        74.3    6e-14   
dbj|BAA95722.1|  unnamed protein product                              74.3    6e-14   
emb|CBI16327.3|  unnamed protein product                              74.3    6e-14   
ref|XP_010651181.1|  PREDICTED: uncharacterized protein LOC100267...  74.3    6e-14   
ref|XP_010458026.1|  PREDICTED: uncharacterized protein LOC104739...  74.3    6e-14   
ref|XP_010494848.1|  PREDICTED: uncharacterized protein LOC104771923  74.7    6e-14   
ref|XP_010458741.1|  PREDICTED: uncharacterized protein LOC104739957  74.7    6e-14   
ref|NP_189383.2|  uncharacterized protein                             74.7    7e-14   
ref|NP_563805.1|  uncharacterized protein                             74.3    7e-14   
ref|XP_002285240.2|  PREDICTED: uncharacterized protein LOC100267...  74.3    7e-14   
ref|XP_004515512.1|  PREDICTED: uncharacterized protein LOC101505531  74.3    8e-14   
ref|XP_010475592.1|  PREDICTED: uncharacterized protein LOC104754984  74.3    8e-14   
ref|XP_010458024.1|  PREDICTED: uncharacterized protein LOC104739...  74.3    8e-14   
gb|AAF79841.1|AC026875_21  T6D22.12                                   74.7    1e-13   
ref|XP_002892723.1|  hypothetical protein ARALYDRAFT_888652           73.9    1e-13   
ref|XP_007150189.1|  hypothetical protein PHAVU_005G134100g           73.9    1e-13   
ref|XP_010476287.1|  PREDICTED: uncharacterized protein LOC104755...  73.9    1e-13   
ref|XP_010514453.1|  PREDICTED: uncharacterized protein LOC104790402  73.9    1e-13   
ref|XP_010476284.1|  PREDICTED: uncharacterized protein LOC104755...  73.9    1e-13   
ref|XP_010476286.1|  PREDICTED: uncharacterized protein LOC104755...  73.9    1e-13   
gb|KHG01210.1|  hypothetical protein F383_22893                       73.9    1e-13   
gb|EYU18817.1|  hypothetical protein MIMGU_mgv1a008100mg              73.6    1e-13   
ref|XP_007031621.1|  Uncharacterized protein isoform 4                73.9    1e-13   
ref|XP_010023459.1|  PREDICTED: uncharacterized protein LOC104414...  72.8    1e-13   
emb|CDY00154.1|  BnaC09g01470D                                        73.6    2e-13   
ref|XP_009152053.1|  PREDICTED: uncharacterized protein LOC103875...  73.6    2e-13   
ref|XP_009598212.1|  PREDICTED: uncharacterized protein LOC104094058  73.6    2e-13   
ref|XP_007044822.1|  Uncharacterized protein isoform 2                73.2    2e-13   
emb|CDX83619.1|  BnaC07g23590D                                        73.6    2e-13   
emb|CDY13634.1|  BnaA06g32890D                                        73.6    2e-13   
ref|XP_003539418.1|  PREDICTED: uncharacterized protein LOC100785818  73.2    2e-13   
gb|KHN11221.1|  hypothetical protein glysoja_034450                   72.8    2e-13   
ref|XP_010023456.1|  PREDICTED: uncharacterized protein LOC104414...  73.2    2e-13   
ref|XP_010502749.1|  PREDICTED: uncharacterized protein LOC104779987  73.2    3e-13   
ref|XP_002875389.1|  hypothetical protein ARALYDRAFT_904991           72.8    3e-13   
emb|CDX98020.1|  BnaA06g07710D                                        72.8    3e-13   
ref|XP_009148552.1|  PREDICTED: uncharacterized protein LOC103871966  72.8    3e-13   
ref|XP_010425515.1|  PREDICTED: uncharacterized protein LOC104710581  72.8    3e-13   
ref|XP_009379954.1|  PREDICTED: uncharacterized protein LOC103968...  72.4    3e-13   
ref|XP_009111574.1|  PREDICTED: uncharacterized protein LOC103836996  72.8    3e-13   
ref|XP_009379952.1|  PREDICTED: uncharacterized protein LOC103968...  72.4    3e-13   
ref|XP_009113818.1|  PREDICTED: uncharacterized protein LOC103839...  72.4    4e-13   
ref|XP_009113814.1|  PREDICTED: uncharacterized protein LOC103839...  72.4    4e-13   
dbj|BAB02205.1|  unnamed protein product                              71.6    5e-13   
gb|AFW75010.1|  hypothetical protein ZEAMMB73_885657                  72.0    5e-13   
ref|XP_002875321.1|  hypothetical protein ARALYDRAFT_322779           72.0    5e-13   
ref|XP_007016774.1|  T6D22.12 isoform 3                               72.0    6e-13   
ref|XP_006291262.1|  hypothetical protein CARUB_v10017393mg           71.6    7e-13   
emb|CDY19405.1|  BnaC05g09140D                                        73.2    7e-13   
ref|XP_010531567.1|  PREDICTED: uncharacterized protein LOC104807...  71.6    7e-13   
ref|XP_004499399.1|  PREDICTED: uncharacterized protein LOC101509620  71.6    7e-13   
ref|XP_010531554.1|  PREDICTED: uncharacterized protein LOC104807...  71.6    7e-13   
ref|XP_006604010.1|  PREDICTED: uncharacterized protein LOC100776...  70.9    7e-13   
ref|NP_001189981.1|  uncharacterized protein                          71.2    8e-13   
gb|AAL27511.1|AF439843_1  AT3g26440/F20C19_16                         71.2    9e-13   
ref|XP_006604009.1|  PREDICTED: uncharacterized protein LOC100776...  70.9    9e-13   
ref|NP_566793.1|  uncharacterized protein                             71.2    1e-12   
ref|XP_010556403.1|  PREDICTED: uncharacterized protein LOC104825730  71.2    1e-12   
ref|XP_006604007.1|  PREDICTED: uncharacterized protein LOC100776...  70.9    1e-12   
emb|CDX84963.1|  BnaC05g20920D                                        70.5    1e-12   
gb|KHN35448.1|  hypothetical protein glysoja_047673                   70.9    1e-12   
ref|XP_006395555.1|  hypothetical protein EUTSA_v10004356mg           70.9    1e-12   
ref|XP_006604008.1|  PREDICTED: uncharacterized protein LOC100776...  70.5    2e-12   
gb|EMS46005.1|  hypothetical protein TRIUR3_21403                     70.5    2e-12   
ref|XP_004142963.1|  PREDICTED: uncharacterized protein LOC101206771  70.5    2e-12   
ref|XP_008444374.1|  PREDICTED: uncharacterized protein LOC103487723  70.5    2e-12   
ref|XP_004173014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.5    2e-12   
ref|XP_010555939.1|  PREDICTED: uncharacterized protein LOC104825...  70.1    3e-12   
ref|XP_008807810.1|  PREDICTED: uncharacterized protein LOC103720060  69.7    3e-12   
ref|XP_010555936.1|  PREDICTED: uncharacterized protein LOC104825...  70.1    3e-12   
ref|XP_003597263.1|  Lysine ketoglutarate reductase trans-splicin...  69.3    3e-12   
gb|AES67514.2|  lysine ketoglutarate reductase trans-splicing-lik...  69.7    3e-12   
gb|KEH39336.1|  lysine ketoglutarate reductase trans-splicing-lik...  69.7    4e-12   
ref|XP_008225894.1|  PREDICTED: uncharacterized protein LOC103325...  68.9    6e-12   
ref|XP_010682268.1|  PREDICTED: uncharacterized protein LOC104897...  68.9    7e-12   
ref|XP_010502568.1|  PREDICTED: uncharacterized protein LOC104779855  68.9    7e-12   
ref|XP_010682266.1|  PREDICTED: uncharacterized protein LOC104897...  68.9    8e-12   
ref|XP_004291706.1|  PREDICTED: uncharacterized protein LOC101295012  68.6    1e-11   
ref|XP_006291140.1|  hypothetical protein CARUB_v10017256mg           68.6    1e-11   
ref|XP_003543467.1|  PREDICTED: uncharacterized protein LOC100806338  68.2    1e-11   
gb|KHN21509.1|  hypothetical protein glysoja_021089                   68.2    1e-11   
ref|XP_008359351.1|  PREDICTED: uncharacterized protein LOC103423...  68.2    1e-11   
ref|XP_009367056.1|  PREDICTED: uncharacterized protein LOC103956...  68.2    1e-11   
ref|XP_010514274.1|  PREDICTED: uncharacterized protein LOC104790263  68.2    1e-11   
ref|XP_010425333.1|  PREDICTED: uncharacterized protein LOC104710425  67.8    2e-11   
ref|XP_004487097.1|  PREDICTED: uncharacterized protein LOC101508904  67.4    3e-11   
ref|XP_010646531.1|  PREDICTED: uncharacterized protein LOC100264208  66.2    4e-11   
ref|XP_002991965.1|  hypothetical protein SELMODRAFT_162056           65.5    1e-10   
ref|XP_002989880.1|  hypothetical protein SELMODRAFT_45528            64.3    1e-10   
ref|XP_008225886.1|  PREDICTED: uncharacterized protein LOC103325...  64.3    3e-10   
ref|XP_010089968.1|  hypothetical protein L484_008046                 64.7    3e-10   
ref|XP_008225901.1|  PREDICTED: uncharacterized protein LOC103325...  64.3    3e-10   
ref|XP_008344893.1|  PREDICTED: uncharacterized protein LOC103407794  63.2    4e-10   
ref|XP_008385408.1|  PREDICTED: uncharacterized protein LOC103447963  63.9    5e-10   
ref|XP_008359345.1|  PREDICTED: uncharacterized protein LOC103423...  63.2    7e-10   
ref|XP_009367055.1|  PREDICTED: uncharacterized protein LOC103956...  63.2    7e-10   
ref|XP_010100413.1|  hypothetical protein L484_027724                 63.2    7e-10   
ref|XP_002966121.1|  hypothetical protein SELMODRAFT_85805            62.4    1e-09   
gb|ACJ83515.1|  unknown                                               58.2    4e-09   
ref|XP_002994664.1|  hypothetical protein SELMODRAFT_138968           60.1    5e-09   
ref|XP_006446632.1|  hypothetical protein CICLE_v10015612mg           60.8    6e-09   
emb|CAN78233.1|  hypothetical protein VITISV_027466                   60.5    1e-08   
gb|ABR25916.1|  lysine ketoglutarate reductase trans-splicing rel...  55.1    3e-08   
ref|XP_008811738.1|  PREDICTED: uncharacterized protein LOC103722823  57.8    8e-08   
ref|XP_009416743.1|  PREDICTED: uncharacterized protein LOC103997302  57.4    8e-08   
emb|CDP11760.1|  unnamed protein product                              54.7    1e-07   
ref|XP_006303545.1|  hypothetical protein CARUB_v10010995mg           54.3    1e-06   
ref|XP_001764755.1|  predicted protein                                53.5    2e-06   
ref|XP_010531572.1|  PREDICTED: uncharacterized protein LOC104807...  53.1    3e-06   
gb|EPS63684.1|  hypothetical protein M569_11100                       52.4    4e-06   
emb|CBI35247.3|  unnamed protein product                              51.2    4e-06   
gb|EYU21382.1|  hypothetical protein MIMGU_mgv1a0196832mg             49.3    6e-06   
gb|EYU22537.1|  hypothetical protein MIMGU_mgv1a026907mg              51.6    7e-06   
gb|AFW62454.1|  hypothetical protein ZEAMMB73_667064                  51.6    9e-06   
ref|XP_001770756.1|  predicted protein                                51.2    1e-05   
gb|KEH35290.1|  lysine ketoglutarate reductase trans-splicing pro...  51.2    1e-05   
ref|XP_004971417.1|  PREDICTED: uncharacterized protein LOC101761...  51.2    1e-05   
gb|KGN51347.1|  hypothetical protein Csa_5G522930                     51.6    1e-05   
ref|XP_001785179.1|  predicted protein                                50.4    2e-05   
ref|NP_001045154.2|  Os01g0910400                                     50.4    2e-05   
ref|XP_009405503.1|  PREDICTED: uncharacterized protein LOC103988...  47.8    2e-04   
ref|XP_009405504.1|  PREDICTED: uncharacterized protein LOC103988...  47.8    2e-04   
ref|XP_009405502.1|  PREDICTED: uncharacterized protein LOC103988...  48.1    2e-04   
gb|KCW55940.1|  hypothetical protein EUGRSUZ_I01729                   47.4    2e-04   
ref|XP_009349737.1|  PREDICTED: uncharacterized protein LOC103941267  47.4    2e-04   
gb|EMS54590.1|  hypothetical protein TRIUR3_08027                     44.7    3e-04   
gb|EEE55862.1|  hypothetical protein OsJ_04495                        46.6    5e-04   



>emb|CBI15537.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V ERC  EW MFR R+ NAEK Y
Sbjct  14   PAHEKIGVVDSQWIVHQTVPSLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAEKTY  73

Query  182  NKSIGI  199
             K +GI
Sbjct  74   YKEMGI  79



>ref|XP_010663659.1| PREDICTED: uncharacterized protein LOC100250849 [Vitis vinifera]
Length=128

 Score = 87.4 bits (215),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V ERC  EW MFR R+ NAEK Y
Sbjct  55   PAHEKIGVVDSQWIVHQTVPSLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAEKTY  114

Query  182  NKSIGI  199
             K +GI
Sbjct  115  YKEMGI  120



>gb|EYU30626.1| hypothetical protein MIMGU_mgv1a007496mg [Erythranthe guttata]
Length=405

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHE+IGVVDAQ + HQ   +LG+ GKSENG+  W+ V +RC  EW +FR R+E+AEK Y
Sbjct  330  PAHERIGVVDAQWIVHQTVPSLGNQGKSENGEAPWQGVRQRCRREWELFRVRMEDAEKSY  389

Query  182  NKSIGIKSS  208
             KSIGI  S
Sbjct  390  YKSIGIDPS  398



>ref|XP_010658806.1| PREDICTED: uncharacterized protein LOC100248266 [Vitis vinifera]
Length=143

 Score = 87.4 bits (215),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V ERC  EW MFR R+ NAEK Y
Sbjct  70   PAHEKIGVVDSQGIVHQTVPSLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAEKAY  129

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  130  YKEMGINPT  138



>emb|CBI22368.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 85.5 bits (210),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ    LG+ G++ENGK  W+ V ERC  EW MFR R+ NA+K Y
Sbjct  14   PAHEKIGVVDSQWIVHQTVPLLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAKKAY  73

Query  182  NKSIGI  199
             K +GI
Sbjct  74   YKDMGI  79



>gb|EMT02083.1| hypothetical protein F775_18912 [Aegilops tauschii]
Length=369

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+E GKP+W+ V  RC  EW MF+TRL +AEK Y
Sbjct  296  PAHEKIGVVDSQWIVHQVVPSLGNQGKAEGGKPAWEGVRARCRKEWGMFQTRLADAEKAY  355

Query  182  NKSIGI  199
             K +GI
Sbjct  356  YKMMGI  361



>gb|AAO33772.1| unknown [Oryza sativa Indica Group]
Length=281

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GKSENG+P+W+ V  RC  EW MF+TR+  AEK Y
Sbjct  208  PAHEKIGVVDSQWIVHQVVPSLGNQGKSENGRPAWEGVRARCRKEWGMFQTRMAEAEKAY  267

Query  182  NKSIGI  199
             K +GI
Sbjct  268  YKMMGI  273



>ref|XP_006653957.1| PREDICTED: uncharacterized protein LOC102713904 [Oryza brachyantha]
Length=401

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GKSENG+P+W+ V  RC  EW MF+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGKSENGRPAWEGVRARCRKEWGMFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             K +GI
Sbjct  388  YKMMGI  393



>ref|NP_001054429.1| Os05g0108100 [Oryza sativa Japonica Group]
 gb|AAK73132.1|AC079022_5 putative protein [Oryza sativa]
 gb|AAU44134.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16343.1| Os05g0108100 [Oryza sativa Japonica Group]
 gb|EEC78374.1| hypothetical protein OsI_18144 [Oryza sativa Indica Group]
 gb|EEE62051.1| hypothetical protein OsJ_16835 [Oryza sativa Japonica Group]
Length=401

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GKSENG+P+W+ V  RC  EW MF+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGKSENGRPAWEGVRARCRKEWGMFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             K +GI
Sbjct  388  YKMMGI  393



>gb|KEH20773.1| lysine ketoglutarate reductase trans-splicing protein [Medicago 
truncatula]
Length=390

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LGD G+++ GKP+W+AV ERC  EW MF+ RL NAE+ Y
Sbjct  316  PAHEKIGVVDAQWIVHQGIPSLGDQGEAQTGKPAWRAVKERCGMEWRMFQGRLTNAERGY  375

Query  182  NKSIGIKSS  208
             KS GI  S
Sbjct  376  YKSKGIDFS  384



>ref|XP_008446150.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446151.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446153.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446154.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
 ref|XP_008446155.1| PREDICTED: uncharacterized protein LOC103488962 [Cucumis melo]
Length=403

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  G+++NGK  W+ V ERC  EW MF++RL NAEK Y
Sbjct  330  PAHEKIGVVDAQWIVHQGLPSLGSQGETQNGKAPWQGVRERCRKEWTMFQSRLANAEKAY  389

Query  182  NKSIGIKSS  208
             KS+GI  S
Sbjct  390  FKSMGIDPS  398



>emb|CBI16790.3| unnamed protein product [Vitis vinifera]
Length=385

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V ERC  EW MFR R+ NAEK Y
Sbjct  312  PAHEKIGVVDSQWIVHQTVPSLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAEKAY  371

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  372  YKEMGINPT  380



>emb|CBI33097.3| unnamed protein product [Vitis vinifera]
Length=124

 Score = 84.3 bits (207),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V E+C  EW MFR R+ NA+K Y
Sbjct  47   PAHEKIGVVDSQWIIHQTFPSLGNQGQAENGKAPWQGVREKCKKEWTMFRVRMTNAKKAY  106

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  107  YKEMGINPT  115



>ref|XP_010650498.1| PREDICTED: uncharacterized protein LOC100243914 [Vitis vinifera]
 ref|XP_010650503.1| PREDICTED: uncharacterized protein LOC100243914 [Vitis vinifera]
Length=401

 Score = 87.8 bits (216),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V ERC  EW MFR R+ NAEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQTVPSLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAEKAY  387

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  388  YKEMGINPT  396



>ref|XP_009620378.1| PREDICTED: uncharacterized protein LOC104112222 [Nicotiana tomentosiformis]
Length=394

 Score = 87.8 bits (216),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+S++GK +WK V ERC  EWAMF++R+ NAEK Y
Sbjct  311  PAHEKIGVVDAQWIVHQSVPSLGNQGQSKDGKAAWKGVRERCENEWAMFQSRVANAEKAY  370

Query  182  NKSIGIKSS  208
             KS GI  S
Sbjct  371  FKSKGIDPS  379



>dbj|BAJ92182.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+E GKP+W+ V  RC  EW MF+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGKAERGKPAWEGVRARCRKEWGMFKTRMAEAEKAY  387

Query  182  NKSIGI  199
             K++GI
Sbjct  388  YKTMGI  393



>ref|XP_004135276.1| PREDICTED: uncharacterized protein LOC101222926 [Cucumis sativus]
 ref|XP_004166255.1| PREDICTED: uncharacterized LOC101222926 [Cucumis sativus]
 gb|KGN51746.1| hypothetical protein Csa_5G598050 [Cucumis sativus]
Length=403

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+++NGK  W+ V ERC  EW MF++RL NAEK Y
Sbjct  330  PAHEKIGVVDSQWIVHQGLPSLGSQGETQNGKAPWQGVRERCRKEWTMFQSRLANAEKAY  389

Query  182  NKSIGIKSS  208
             KS+GI  S
Sbjct  390  FKSLGIDPS  398



>ref|XP_009779721.1| PREDICTED: uncharacterized protein LOC104228871 [Nicotiana sylvestris]
Length=394

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+S++GK +WK V ERC  EWAMF+ R+ NAEK Y
Sbjct  311  PAHEKIGVVDAQWIVHQSVPSLGNQGQSKDGKAAWKGVRERCENEWAMFQLRVANAEKAY  370

Query  182  NKSIGIKSS  208
             KS GI  S
Sbjct  371  FKSKGIDPS  379



>ref|XP_010660206.1| PREDICTED: uncharacterized protein LOC100254498 [Vitis vinifera]
Length=230

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ    LG+ G++ENGK  W+ V ERC  EW MFR R+ NA+K Y
Sbjct  157  PAHEKIGVVDSQWIVHQTVPLLGNQGQAENGKAPWQGVRERCKKEWTMFRVRMTNAKKAY  216

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  217  YKDMGINPT  225



>gb|ACF80075.1| unknown [Zea mays]
Length=110

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+P W+ V  RC  EW +F+TRL +AEK Y
Sbjct  37   PAHEKIGVVDAQWIVHQSVPSLGNQGKSDNGRPPWEGVRARCRKEWGIFQTRLADAEKAY  96

Query  182  NKSIGI  199
                GI
Sbjct  97   YLERGI  102



>ref|XP_008458831.1| PREDICTED: uncharacterized protein LOC103498119 [Cucumis melo]
 ref|XP_008458832.1| PREDICTED: uncharacterized protein LOC103498119 [Cucumis melo]
Length=402

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+ENG+  W+ V ERC  EW +FR+RL +AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQSVPSLGNQGKAENGRAPWEGVRERCRKEWEIFRSRLADAEKAY  388

Query  182  NKSIGI  199
             K +GI
Sbjct  389  YKGVGI  394



>ref|XP_006357623.1| PREDICTED: uncharacterized protein LOC102588935 [Solanum tuberosum]
Length=516

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G++++GK +W+ V ERC  EW+MF++R+ENAEK+Y
Sbjct  431  PAHEKIGVVDAQWILHQSVPSLGNEGQAKDGKAAWRGVRERCEKEWSMFQSRVENAEKDY  490

Query  182  NKSIGIKSS  208
              S GI +S
Sbjct  491  YISKGIDTS  499



>ref|XP_010044565.1| PREDICTED: uncharacterized protein LOC104433498 [Eucalyptus grandis]
 gb|KCW86652.1| hypothetical protein EUGRSUZ_B03278 [Eucalyptus grandis]
Length=401

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ V HQ   +LG+ G+ ++GKP W  V ERC  EW MF+ R+++AEK Y
Sbjct  328  PAHQKIGVVDAQWVVHQGIPSLGNQGRLQDGKPPWHGVRERCRREWGMFQRRMDDAEKAY  387

Query  182  NKSIGIKSS  208
             +SIGI  S
Sbjct  388  FRSIGIDPS  396



>ref|XP_009382917.1| PREDICTED: uncharacterized protein LOC103970734 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ+  +LG+ G++E GK  W+ V ERC  EWA+F+TR+ +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQVVPSLGNQGQAEKGKAPWEGVRERCRKEWAIFQTRMSDAEKAY  387

Query  182  NKSIGI  199
              SIGI
Sbjct  388  YLSIGI  393



>ref|XP_004504125.1| PREDICTED: uncharacterized protein LOC101498637 [Cicer arietinum]
Length=390

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LGD G+++ GK +W+AV ERC  EW MF+ RL NAEK Y
Sbjct  316  PAHEKIGVVDAQWIVHQGIPSLGDQGEAQTGKTAWRAVKERCGMEWRMFQGRLTNAEKGY  375

Query  182  NKSIGIKSS  208
             KS GI  S
Sbjct  376  YKSKGIDFS  384



>gb|KHN44372.1| hypothetical protein glysoja_014413 [Glycine soja]
Length=383

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  310  PAHEKIGVVDSQWIVHQGIPSLGNQGESQTGKAPWQGVRERCRKEWTMFQSRLANAEYAY  369

Query  182  NKSIGIKSS  208
            + SIGI +S
Sbjct  370  HNSIGIDTS  378



>gb|ACU23804.1| unknown [Glycine max]
Length=341

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  268  PAHEKIGVVDSQWIVHQGIPSLGNQGESQTGKAPWQGVRERCRKEWIMFQSRLANAEYAY  327

Query  182  NKSIGIKSS  208
            + SIGI +S
Sbjct  328  HNSIGIDTS  336



>ref|XP_006415818.1| hypothetical protein EUTSA_v10009392mg [Eutrema salsugineum]
 gb|ESQ34171.1| hypothetical protein EUTSA_v10009392mg [Eutrema salsugineum]
Length=381

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIG+VD+Q + HQ   +LG  GK E GK  W+ V +RCH EW +F +R+ENAEK+Y
Sbjct  306  PAHEKIGIVDSQWIVHQFIPSLGSQGKEEKGKSPWQGVRDRCHLEWKLFSSRVENAEKDY  365

Query  182  NKSIGIKS  205
             K++ ++S
Sbjct  366  FKTLQVQS  373



>ref|XP_010320939.1| PREDICTED: uncharacterized protein LOC101244185 isoform X2 [Solanum 
lycopersicum]
Length=376

 Score = 85.1 bits (209),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ G++++GK  W+ V +RC  EW MF+TR+ NAEK Y
Sbjct  303  PAHKKIGVVDAQWIVHQALPSLGNEGEAKDGKAPWRGVRDRCRKEWTMFQTRVANAEKAY  362

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  363  FKSIGVDPS  371



>ref|XP_007163683.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 ref|XP_007163684.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 gb|ESW35677.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
 gb|ESW35678.1| hypothetical protein PHAVU_001G255300g [Phaseolus vulgaris]
Length=399

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+++ GK  W+ V ERC  EW MF+TRL +AE  Y
Sbjct  326  PAHEKIGVVDSQWIVHQGLPSLGNQGETQTGKAPWQGVRERCRKEWTMFQTRLASAEDAY  385

Query  182  NKSIGIKSS  208
             KSIGI +S
Sbjct  386  YKSIGIDTS  394



>ref|XP_011086653.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086655.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086656.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086657.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086658.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086659.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086660.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086661.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086662.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086663.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
 ref|XP_011086664.1| PREDICTED: uncharacterized protein LOC105168320 [Sesamum indicum]
Length=400

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G+ E GK  W+ V  RC  EW MF+ RLENAEK Y
Sbjct  327  PPHEKIGVVDAQWIVHQTVPSLGNQGQVEEGKAPWQGVRLRCRREWNMFKARLENAEKSY  386

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  387  YKSIGVDPS  395



>ref|XP_003538598.1| PREDICTED: uncharacterized protein LOC100778486 [Glycine max]
Length=399

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  326  PAHEKIGVVDSQWIVHQGIPSLGNQGESQTGKAPWQGVRERCRKEWTMFQSRLANAEYAY  385

Query  182  NKSIGIKSS  208
            + SIGI +S
Sbjct  386  HNSIGIDTS  394



>emb|CDP13233.1| unnamed protein product [Coffea canephora]
Length=387

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  G+SENGK  W+ V ERC  EWAMF+ R+ NAEK Y
Sbjct  314  PAHEKIGVVDAQWIVHQSIPSLGSQGQSENGKAPWQGVRERCRKEWAMFQNRMSNAEKAY  373

Query  182  NKSIGIKSS  208
                GI  S
Sbjct  374  YLGKGIDPS  382



>ref|XP_010646200.1| PREDICTED: uncharacterized protein LOC100853772 [Vitis vinifera]
Length=320

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++ENGK  W+ V E+C  EW MFR R+ NA+K Y
Sbjct  243  PAHEKIGVVDSQWIIHQTFPSLGNQGQAENGKAPWQGVREKCKKEWTMFRVRMTNAKKAY  302

Query  182  NKSIGIKSS  208
             K +GI  +
Sbjct  303  YKEMGINPT  311



>ref|XP_004239135.1| PREDICTED: uncharacterized protein LOC101244185 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010320938.1| PREDICTED: uncharacterized protein LOC101244185 isoform X1 [Solanum 
lycopersicum]
Length=392

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ G++++GK  W+ V +RC  EW MF+TR+ NAEK Y
Sbjct  319  PAHKKIGVVDAQWIVHQALPSLGNEGEAKDGKAPWRGVRDRCRKEWTMFQTRVANAEKAY  378

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  379  FKSIGVDPS  387



>ref|XP_009617944.1| PREDICTED: uncharacterized protein LOC104110199 isoform X3 [Nicotiana 
tomentosiformis]
Length=384

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ V HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  311  PAHEKIGVVDAQWVVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  370

Query  182  NKSIGI  199
             K++GI
Sbjct  371  YKAMGI  376



>ref|XP_008360119.1| PREDICTED: uncharacterized protein LOC103423810 isoform X2 [Malus 
domestica]
Length=387

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+S+NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  314  PAHEKIGVVDSQWIVHQTVPSLGSQGESQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  373

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  374  FKAIGVDPS  382



>ref|XP_008340102.1| PREDICTED: uncharacterized protein LOC103403062 isoform X2 [Malus 
domestica]
Length=387

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVD+Q + HQ   +LG  G+SENGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  314  PAHDKIGVVDSQWIVHQTVPSLGSQGESENGKAPWQGVRERCRKEWTMFQKRVSNAENAY  373

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  374  FKAIGVDPS  382



>ref|XP_004502391.1| PREDICTED: uncharacterized protein LOC101511137 isoform X1 [Cicer 
arietinum]
 ref|XP_004502392.1| PREDICTED: uncharacterized protein LOC101511137 isoform X2 [Cicer 
arietinum]
Length=398

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   TLG+ G +E GK  W+ V ERC  EW MF++RL NAE EY
Sbjct  325  PAHEKIGVVDAQWIVHQGVPTLGNQGVTETGKAPWQGVRERCRKEWTMFQSRLANAENEY  384

Query  182  NKSIGIKSS  208
             KS  I  S
Sbjct  385  FKSASIDMS  393



>ref|XP_009617943.1| PREDICTED: uncharacterized protein LOC104110199 isoform X2 [Nicotiana 
tomentosiformis]
Length=400

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ V HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  327  PAHEKIGVVDAQWVVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  386

Query  182  NKSIGI  199
             K++GI
Sbjct  387  YKAMGI  392



>ref|XP_009617942.1| PREDICTED: uncharacterized protein LOC104110199 isoform X1 [Nicotiana 
tomentosiformis]
Length=401

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ V HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  328  PAHEKIGVVDAQWVVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  387

Query  182  NKSIGI  199
             K++GI
Sbjct  388  YKAMGI  393



>ref|XP_004142781.1| PREDICTED: uncharacterized protein LOC101219968 [Cucumis sativus]
 ref|XP_004156693.1| PREDICTED: uncharacterized LOC101219968 [Cucumis sativus]
Length=402

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+ENG+  W+ V ERC  EW +FR+RL +AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQSVPSLGNQGKAENGRAPWEGVRERCRKEWEIFRSRLADAEKAY  388

Query  182  NKSIGI  199
               +GI
Sbjct  389  YNGVGI  394



>ref|XP_008360116.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
 ref|XP_008360117.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
 ref|XP_008360118.1| PREDICTED: uncharacterized protein LOC103423810 isoform X1 [Malus 
domestica]
Length=403

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+S+NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGSQGESQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  389

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  390  FKAIGVDPS  398



>ref|XP_009797243.1| PREDICTED: uncharacterized protein LOC104243699 isoform X2 [Nicotiana 
sylvestris]
Length=383

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  310  PAHEKIGVVDAQWIVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  369

Query  182  NKSIGI  199
             K++GI
Sbjct  370  YKAMGI  375



>ref|XP_010248668.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248669.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248670.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
 ref|XP_010248671.1| PREDICTED: uncharacterized protein LOC104591513 [Nelumbo nucifera]
Length=408

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+++NGK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  335  PAHEKIGVVDAQWIVHQTVPSLGNQGQAQNGKAPWEGVRERCRKEWTMFQGRMANAEKAY  394

Query  182  NKSIGI  199
             K +GI
Sbjct  395  YKEMGI  400



>ref|XP_008340099.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
 ref|XP_008340100.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
 ref|XP_008340101.1| PREDICTED: uncharacterized protein LOC103403062 isoform X1 [Malus 
domestica]
Length=412

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVD+Q + HQ   +LG  G+SENGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  339  PAHDKIGVVDSQWIVHQTVPSLGSQGESENGKAPWQGVRERCRKEWTMFQKRVSNAENAY  398

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  399  FKAIGVDPS  407



>ref|XP_009797241.1| PREDICTED: uncharacterized protein LOC104243699 isoform X1 [Nicotiana 
sylvestris]
Length=400

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  327  PAHEKIGVVDAQWIVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  386

Query  182  NKSIGI  199
             K++GI
Sbjct  387  YKAMGI  392



>ref|XP_010320937.1| PREDICTED: uncharacterized protein LOC101248010 [Solanum lycopersicum]
Length=404

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G++++GK +W+ V ERC  EW+MF++R ENAE++Y
Sbjct  319  PAHEKIGVVDAQWILHQSVPSLGNEGQAKDGKAAWRGVRERCEKEWSMFQSRAENAERDY  378

Query  182  NKSIGIKSS  208
              S GI ++
Sbjct  379  YISKGIDTT  387



>ref|NP_001141373.1| hypothetical protein [Zea mays]
 gb|ACF86195.1| unknown [Zea mays]
 gb|AFW70893.1| hypothetical protein ZEAMMB73_267727 [Zea mays]
Length=237

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+P W+ V  RC  EW +F+TRL +AEK Y
Sbjct  164  PAHEKIGVVDAQWIVHQSVPSLGNQGKSDNGRPPWEGVRARCRKEWGIFQTRLADAEKAY  223

Query  182  NKSIGI  199
                GI
Sbjct  224  YLERGI  229



>gb|ACF81291.1| unknown [Zea mays]
Length=95

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  22   PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  81

Query  182  NKSIGI  199
                GI
Sbjct  82   YLERGI  87



>ref|XP_006852374.1| hypothetical protein AMTR_s00049p00225510 [Amborella trichopoda]
 gb|ERN13841.1| hypothetical protein AMTR_s00049p00225510 [Amborella trichopoda]
Length=403

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+S+NGK  W+ V ERC  EWA+F+ R+ENAEK Y
Sbjct  329  PAHEKIGVVDSQWIVHQVVPSLGNQGQSDNGKAPWEGVRERCRKEWAIFQGRMENAEKAY  388

Query  182  NKSIGI  199
               +G+
Sbjct  389  FAEMGL  394



>ref|XP_006357597.1| PREDICTED: uncharacterized protein LOC102579567 isoform X2 [Solanum 
tuberosum]
Length=376

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ G++++GK  WK V +RC  EW MF++R+ NAEK Y
Sbjct  303  PAHKKIGVVDAQWIVHQGLPSLGNEGEAKDGKAPWKGVRDRCRKEWTMFQSRVANAEKAY  362

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  363  FKSIGVDPS  371



>ref|XP_008221901.1| PREDICTED: uncharacterized protein LOC103321836 isoform X3 [Prunus 
mume]
 ref|XP_008221902.1| PREDICTED: uncharacterized protein LOC103321836 isoform X3 [Prunus 
mume]
Length=387

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+++NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  314  PAHEKIGVVDSQWIVHQTVPSLGSQGETQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  373

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  374  FKAIGVDPS  382



>gb|KHG06071.1| Trimethylguanosine synthase [Gossypium arboreum]
Length=381

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSE+GKP W+ V  RC  EW+MF+ RL NA+K Y
Sbjct  315  PAHEKIGVVDSQWIIHQVIPSLGSQGKSEDGKPPWEGVRTRCKKEWSMFQNRLANADKAY  374

Query  182  NKSIG  196
               +G
Sbjct  375  LAQLG  379



>ref|XP_006357596.1| PREDICTED: uncharacterized protein LOC102579567 isoform X1 [Solanum 
tuberosum]
Length=392

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ G++++GK  WK V +RC  EW MF++R+ NAEK Y
Sbjct  319  PAHKKIGVVDAQWIVHQGLPSLGNEGEAKDGKAPWKGVRDRCRKEWTMFQSRVANAEKAY  378

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  379  FKSIGVDPS  387



>ref|XP_008221898.1| PREDICTED: uncharacterized protein LOC103321836 isoform X1 [Prunus 
mume]
 ref|XP_008221899.1| PREDICTED: uncharacterized protein LOC103321836 isoform X1 [Prunus 
mume]
Length=403

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+++NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGSQGETQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  389

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  390  FKAIGVDPS  398



>ref|XP_010499155.1| PREDICTED: uncharacterized protein LOC104776741 [Camelina sativa]
 ref|XP_010499157.1| PREDICTED: uncharacterized protein LOC104776741 [Camelina sativa]
 ref|XP_010499158.1| PREDICTED: uncharacterized protein LOC104776741 [Camelina sativa]
Length=385

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ G SENGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  310  PAYEKIGIVDSQWIVHQFIPSLGNEGNSENGKAPWQGVRDRCQMEWKLFEKRVENAEKDY  369

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  370  FKSLQVES  377



>ref|XP_008221900.1| PREDICTED: uncharacterized protein LOC103321836 isoform X2 [Prunus 
mume]
Length=398

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+++NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  325  PAHEKIGVVDSQWIVHQTVPSLGSQGETQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  384

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  385  FKAIGVDPS  393



>ref|XP_010460435.1| PREDICTED: uncharacterized protein LOC104741307 isoform X2 [Camelina 
sativa]
 ref|XP_010460436.1| PREDICTED: uncharacterized protein LOC104741307 isoform X2 [Camelina 
sativa]
 ref|XP_010460437.1| PREDICTED: uncharacterized protein LOC104741307 isoform X2 [Camelina 
sativa]
 ref|XP_010460438.1| PREDICTED: uncharacterized protein LOC104741307 isoform X2 [Camelina 
sativa]
Length=385

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ G SENGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  310  PAYEKIGIVDSQWIVHQFIPSLGNEGNSENGKAPWQGVRDRCQMEWKLFEKRVENAEKDY  369

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  370  FKSLQVES  377



>ref|XP_010251037.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251038.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251039.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251040.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251041.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251042.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
 ref|XP_010251043.1| PREDICTED: uncharacterized protein LOC104593065 [Nelumbo nucifera]
Length=408

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+++NGK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  335  PAHEKIGVVDAQWIVHQTVPSLGNQGETQNGKAPWQGVRERCRKEWTMFQGRVANAEKAY  394

Query  182  NKSIG  196
             K IG
Sbjct  395  YKEIG  399



>emb|CDP07097.1| unnamed protein product [Coffea canephora]
Length=380

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G+SENGK  W+ V ERC +EWA F+ RL NA+K+Y
Sbjct  312  PAHEKIGVVDSQWIVHQVIPSLGSQGQSENGKAPWQGVRERCRSEWAQFQDRLANADKKY  371

Query  182  NKSIG  196
             + +G
Sbjct  372  IEQLG  376



>ref|XP_010460429.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
 ref|XP_010460430.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
 ref|XP_010460431.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
 ref|XP_010460432.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
 ref|XP_010460433.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
 ref|XP_010460434.1| PREDICTED: uncharacterized protein LOC104741307 isoform X1 [Camelina 
sativa]
Length=386

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ G SENGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  311  PAYEKIGIVDSQWIVHQFIPSLGNEGNSENGKAPWQGVRDRCQMEWKLFEKRVENAEKDY  370

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  371  FKSLQVES  378



>ref|XP_009359206.1| PREDICTED: uncharacterized protein LOC103949812 isoform X3 [Pyrus 
x bretschneideri]
Length=387

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVD+Q + HQ   +LG  G+SENGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  314  PAHDKIGVVDSQWIIHQTVPSLGSQGESENGKAPWQGVRERCRKEWTMFQMRVSNAENAY  373

Query  182  NKSIGIKSS  208
             K+IG   S
Sbjct  374  FKAIGADPS  382



>ref|XP_009359205.1| PREDICTED: uncharacterized protein LOC103949812 isoform X2 [Pyrus 
x bretschneideri]
Length=398

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVD+Q + HQ   +LG  G+SENGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  325  PAHDKIGVVDSQWIIHQTVPSLGSQGESENGKAPWQGVRERCRKEWTMFQMRVSNAENAY  384

Query  182  NKSIGIKSS  208
             K+IG   S
Sbjct  385  FKAIGADPS  393



>ref|XP_003551994.1| PREDICTED: uncharacterized protein LOC100811265 isoform X1 [Glycine 
max]
 gb|KHN43983.1| hypothetical protein glysoja_048217 [Glycine soja]
Length=399

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  326  PAHEKIGVVDSQWIVHQGLPSLGNQGESQTGKSRWQGVRERCRKEWTMFQSRLANAENAY  385

Query  182  NKSIGIKSS  208
             KS+G  +S
Sbjct  386  YKSMGTDTS  394



>ref|XP_009359203.1| PREDICTED: uncharacterized protein LOC103949812 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009359204.1| PREDICTED: uncharacterized protein LOC103949812 isoform X1 [Pyrus 
x bretschneideri]
Length=412

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVD+Q + HQ   +LG  G+SENGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  339  PAHDKIGVVDSQWIIHQTVPSLGSQGESENGKAPWQGVRERCRKEWTMFQMRVSNAENAY  398

Query  182  NKSIGIKSS  208
             K+IG   S
Sbjct  399  FKAIGADPS  407



>ref|NP_001141005.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
 gb|ACF85151.1| unknown [Zea mays]
 gb|ACG34813.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|AFW75009.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=401

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SENG+  W+ V  RC  EW MF+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQSENGRAPWEGVRARCRKEWGMFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             K +GI
Sbjct  388  YKMMGI  393



>ref|XP_006601926.1| PREDICTED: uncharacterized protein LOC100811265 isoform X2 [Glycine 
max]
Length=403

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  330  PAHEKIGVVDSQWIVHQGLPSLGNQGESQTGKSRWQGVRERCRKEWTMFQSRLANAENAY  389

Query  182  NKSIGIKSS  208
             KS+G  +S
Sbjct  390  YKSMGTDTS  398



>gb|KDP26690.1| hypothetical protein JCGZ_17848 [Jatropha curcas]
Length=383

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  310  PAHEKIGVVDSQWIVHQTVPSLGNQGESQNGKAPWQGVRERCRKEWTMFQNRMANAEKAY  369

Query  182  NKSIGIKSS  208
             K+  ++SS
Sbjct  370  FKAKELESS  378



>ref|XP_009402707.1| PREDICTED: uncharacterized protein LOC103986416 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402708.1| PREDICTED: uncharacterized protein LOC103986416 [Musa acuminata 
subsp. malaccensis]
Length=402

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENG+  W+ V +RC  EW MF+TR+ +AEK Y
Sbjct  329  PAHEKIGVVDSQWIVHQVVPSLGNQGLAENGRAPWEGVRQRCRKEWGMFQTRMSDAEKAY  388

Query  182  NKSIGI  199
             +++GI
Sbjct  389  FRAMGI  394



>ref|XP_004231837.1| PREDICTED: uncharacterized protein LOC101259691 [Solanum lycopersicum]
Length=399

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  326  PAHEKIGVVDAQWIVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  385

Query  182  NKSIGI  199
             K++G+
Sbjct  386  YKAMGM  391



>emb|CDY03878.1| BnaC07g11030D [Brassica napus]
Length=363

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG  GK +NGK   + V +RCH EW MF +RL+NAEK+Y
Sbjct  288  PAYEKIGIVDSQWIVHQFIPSLGSQGKEKNGKSPLEGVRDRCHMEWKMFESRLDNAEKDY  347

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  348  YKSLQVQS  355



>ref|XP_003525038.1| PREDICTED: uncharacterized protein LOC100785650 isoformX1 [Glycine 
max]
 ref|XP_006580249.1| PREDICTED: uncharacterized protein LOC100785650 isoform X2 [Glycine 
max]
 ref|XP_006580250.1| PREDICTED: uncharacterized protein LOC100785650 isoform X3 [Glycine 
max]
 gb|KHN06547.1| hypothetical protein glysoja_010891 [Glycine soja]
Length=397

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S++GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  324  PAHEKIGVVDSQWIIHQSVPSLGNQGESQSGKAPWQGVRERCKREWTMFQSRLANAEDAY  383

Query  182  NKSIGI  199
             K++G+
Sbjct  384  YKAVGV  389



>ref|XP_006338630.1| PREDICTED: uncharacterized protein LOC102584113 [Solanum tuberosum]
Length=399

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  GKSENGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  326  PAHEKIGVVDAQWIVHQTVPSLGSQGKSENGKAPWEGVRERCRREWTMFQDRMATAEMAY  385

Query  182  NKSIGI  199
             K++G+
Sbjct  386  YKAMGM  391



>ref|XP_003601902.1| hypothetical protein MTR_3g086610 [Medicago truncatula]
 gb|AES72153.1| lysine ketoglutarate reductase trans-splicing protein [Medicago 
truncatula]
Length=399

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   TLG+ GK+E GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  325  PAHEKIGVVDAQWIVHQGVPTLGNQGKTETGKAPWQGVRERCRKEWTMFQSRLANAEHAY  384

Query  182  NKSIG  196
             KS G
Sbjct  385  FKSGG  389



>ref|XP_007159701.1| hypothetical protein PHAVU_002G259900g [Phaseolus vulgaris]
 gb|ESW31695.1| hypothetical protein PHAVU_002G259900g [Phaseolus vulgaris]
Length=388

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVDAQ + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  313  PAHEKIGVVDAQWIVHQGIPSLGNQGEAQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  372

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  373  YYKSKGIDFS  382



>emb|CDY68593.1| BnaCnng59670D [Brassica napus]
Length=363

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG  GK ENGK   + V +RCH EW MF +R++NAEK+Y
Sbjct  288  PAYEKIGIVDSQWIVHQFIPSLGSQGKEENGKSPLEGVRDRCHMEWKMFESRVDNAEKDY  347

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  348  FKSLQVQS  355



>ref|NP_001149970.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 ref|XP_008681447.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG37370.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|ACN26060.1| unknown [Zea mays]
 gb|ACN27550.1| unknown [Zea mays]
 gb|ACN28090.1| unknown [Zea mays]
 gb|AFW70890.1| lysine ketoglutarate reductase trans-splicing 1 isoform 1 [Zea 
mays]
 gb|AFW70891.1| lysine ketoglutarate reductase trans-splicing 1 isoform 2 [Zea 
mays]
Length=401

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+P W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQSVPSLGNQGKSDNGRPPWEGVRARCRKEWGIFQTRLADAEKAY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLERGI  393



>ref|XP_006580252.1| PREDICTED: uncharacterized protein LOC100793049 isoform X3 [Glycine 
max]
Length=373

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVDAQ + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  298  PAHEKIGVVDAQWIVHQGIPSLGNQGEAQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  357

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  358  YYKSKGIDFS  367



>ref|XP_007222780.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
 gb|EMJ23979.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
Length=398

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+ +NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  325  PAHEKIGVVDSQWIVHQTVPSLGSQGEPQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  384

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  385  FKAIGVDPS  393



>emb|CDX84961.1| BnaC05g20940D [Brassica napus]
Length=370

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD Q + HQ   +LG  GK E+GK  W+ V +RCH EW MF  R++ AEKEY
Sbjct  295  PAYEKIGIVDTQWIVHQFIPSLGSQGKEEDGKSPWQGVKDRCHMEWKMFERRVDEAEKEY  354

Query  182  NKSIGIKS  205
             KS+ +++
Sbjct  355  FKSLQVQT  362



>emb|CDY27582.1| BnaA09g28250D [Brassica napus]
Length=370

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD Q + HQ   +LG  GK E+GK  W+ V +RCH EW MF  R++ AEKEY
Sbjct  295  PAYEKIGIVDTQWIVHQFIPSLGSQGKEEDGKSPWQGVKDRCHMEWKMFERRVDEAEKEY  354

Query  182  NKSIGIKS  205
             KS+ +++
Sbjct  355  FKSLQVQT  362



>ref|XP_007222781.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
 gb|EMJ23980.1| hypothetical protein PRUPE_ppa006602mg [Prunus persica]
Length=403

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+ +NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGSQGEPQNGKAPWQGVRERCRKEWTMFQMRVANAENAY  389

Query  182  NKSIGIKSS  208
             K+IG+  S
Sbjct  390  FKAIGVDPS  398



>ref|XP_003524254.1| PREDICTED: uncharacterized protein LOC100793049 isoform X1 [Glycine 
max]
 ref|XP_006580251.1| PREDICTED: uncharacterized protein LOC100793049 isoform X2 [Glycine 
max]
Length=389

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVDAQ + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  314  PAHEKIGVVDAQWIVHQGIPSLGNQGEAQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  373

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  374  YYKSKGIDFS  383



>ref|XP_009103748.1| PREDICTED: uncharacterized protein LOC103829800 [Brassica rapa]
Length=385

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG  GK ENGK   + V +RCH EW MF +R++NAEK+Y
Sbjct  310  PAYEKIGIVDSQWIVHQFIPSLGSQGKEENGKSPLEGVRDRCHMEWKMFESRVDNAEKDY  369

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  370  FKSLQVQS  377



>gb|KHN06548.1| hypothetical protein glysoja_010892 [Glycine soja]
Length=380

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVDAQ + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  305  PAHEKIGVVDAQWIVHQGIPSLGNQGEAQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  364

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  365  YYKSKGIDFS  374



>ref|XP_010477996.1| PREDICTED: uncharacterized protein LOC104757006 isoform X2 [Camelina 
sativa]
 ref|XP_010477997.1| PREDICTED: uncharacterized protein LOC104757006 isoform X2 [Camelina 
sativa]
Length=384

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ G S+NGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  309  PAYEKIGIVDSQWIVHQFIPSLGNEGNSDNGKAPWQGVRDRCQMEWKLFEKRVENAEKDY  368

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  369  FKSLQVES  376



>ref|XP_010477994.1| PREDICTED: uncharacterized protein LOC104757006 isoform X1 [Camelina 
sativa]
 ref|XP_010477995.1| PREDICTED: uncharacterized protein LOC104757006 isoform X1 [Camelina 
sativa]
Length=385

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ G S+NGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  310  PAYEKIGIVDSQWIVHQFIPSLGNEGNSDNGKAPWQGVRDRCQMEWKLFEKRVENAEKDY  369

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  370  FKSLQVES  377



>ref|XP_010912960.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105038769 
[Elaeis guineensis]
Length=403

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++ NGKP W+ V ERC  EW MF+ R+ +AE  Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQAANGKPPWQGVRERCRKEWWMFQKRMADAEIAY  387

Query  182  NKSIGI  199
             K++GI
Sbjct  388  CKAMGI  393



>gb|AFK47373.1| unknown [Medicago truncatula]
Length=399

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   TLG+ GK+E GK  W+ V ERC  EW MF++RL NAE  Y
Sbjct  325  PAHEKIGVVDAQWIVHQGVPTLGNQGKTETGKAPWQGVRERCRKEWTMFQSRLGNAEHAY  384

Query  182  NKSIG  196
             KS G
Sbjct  385  FKSGG  389



>ref|XP_009589970.1| PREDICTED: uncharacterized protein LOC104087260 [Nicotiana tomentosiformis]
Length=389

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G SENGK  W+ V ERC +EWAMF+ RL NA+K Y
Sbjct  321  PAHEKIGVVDSQWIVHQVIPSLGSQGSSENGKAPWEGVRERCRSEWAMFQDRLANADKAY  380



>ref|XP_009770312.1| PREDICTED: uncharacterized protein LOC104221038 [Nicotiana sylvestris]
Length=389

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G SENGK  W+ V ERC +EWAMF+ RL NA+K Y
Sbjct  321  PAHEKIGVVDSQWIVHQVIPSLGSQGSSENGKAPWEGVRERCRSEWAMFQDRLANADKAY  380



>emb|CDY32571.1| BnaC02g17640D [Brassica napus]
Length=179

 Score = 80.1 bits (196),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  103  PAHEKIGVVDSQWIVHQTVPSLGSQGEAVDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  162

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  163  FKSLQVEGS  171



>ref|XP_009763116.1| PREDICTED: uncharacterized protein LOC104215067 [Nicotiana sylvestris]
Length=397

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + H    +LG+ G+S++GK  W+ V ERC  EW MF++R+ NAEK Y
Sbjct  324  PAHEKIGVVDAQWIVHHGVPSLGNQGQSKDGKAPWQGVRERCRKEWTMFQSRVANAEKAY  383

Query  182  NKSIGIKSS  208
             KS GI  S
Sbjct  384  FKSKGIDPS  392



>ref|XP_009113820.1| PREDICTED: uncharacterized protein LOC103839077 [Brassica rapa]
Length=388

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD Q + HQ   +LG  GK E+GK  W+ V +RCH EW MF  R++ AEKEY
Sbjct  313  PAYEKIGIVDTQWIVHQFIPSLGSQGKEEDGKSPWQGVKDRCHMEWKMFERRVDEAEKEY  372

Query  182  NKSIGIKS  205
             KS+ +++
Sbjct  373  FKSLQVQT  380



>gb|AAG28913.1|AC008113_29 F12A21.2 [Arabidopsis thaliana]
Length=332

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  256  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  315

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  316  FKSLQVEGS  324



>ref|XP_002521489.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40979.1| conserved hypothetical protein [Ricinus communis]
Length=374

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  GK+E+G+  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  301  PAHEKIGVVDAQWIVHQGVPSLGSQGKAESGRAPWEGVRERCRKEWTMFQDRMTNAEKAY  360

Query  182  NKSIGI  199
             +++GI
Sbjct  361  FEAMGI  366



>gb|KEH22115.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=388

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ V HQ   +LG+ G++E GK  W+ V ERC  EW+MF+ RL NAEK+Y
Sbjct  316  PAHEKIGVVDAQWVVHQSVPSLGNQGQAEGGKAPWEGVRERCQKEWSMFKERLANAEKDY  375

Query  182  NK  187
             K
Sbjct  376  FK  377



>ref|XP_009419384.1| PREDICTED: uncharacterized protein LOC103999363 [Musa acuminata 
subsp. malaccensis]
Length=402

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+S+NGK  W+ V ERC  EW +FR RL  AEK Y
Sbjct  329  PAHEKIGVVDSQWIIHQVVPSLGNQGQSDNGKAPWEGVRERCKKEWGIFRKRLSEAEKAY  388

Query  182  NKSIGI  199
              S GI
Sbjct  389  YLSKGI  394



>ref|XP_010906956.1| PREDICTED: uncharacterized protein LOC105033746 isoform X3 [Elaeis 
guineensis]
Length=397

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENGK  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  324  PAHEKIGVVDSQWIVHQVVPSLGNQGVAENGKAPWEGVRERCRKEWGMFQNRMADAEKAY  383

Query  182  NKSIGIK  202
             K  GI+
Sbjct  384  YKEKGIR  390



>ref|XP_010906954.1| PREDICTED: uncharacterized protein LOC105033746 isoform X1 [Elaeis 
guineensis]
Length=404

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENGK  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  331  PAHEKIGVVDSQWIVHQVVPSLGNQGVAENGKAPWEGVRERCRKEWGMFQNRMADAEKAY  390

Query  182  NKSIGIK  202
             K  GI+
Sbjct  391  YKEKGIR  397



>ref|NP_001150432.1| LOC100284062 [Zea mays]
 gb|ACG39074.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 tpg|DAA56218.1| TPA: lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=401

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW MF+TRL +AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVIPSLGNQGKAENGKAPWEGVRARCRKEWGMFQTRLTDAEKAY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLEHGI  393



>gb|AFK41298.1| unknown [Lotus japonicus]
Length=145

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   TLG+ G+S+ G   W+ V ERC  EW MF++RL  AE  Y
Sbjct  72   PAHEKIGVVDSQWIVHQGVPTLGNQGESKTGGKPWQGVRERCKKEWTMFQSRLAYAENAY  131

Query  182  NKSIGIKSS  208
             KSIG+  S
Sbjct  132  FKSIGVDLS  140



>ref|XP_010906955.1| PREDICTED: uncharacterized protein LOC105033746 isoform X2 [Elaeis 
guineensis]
Length=401

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENGK  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGVAENGKAPWEGVRERCRKEWGMFQNRMADAEKAY  387

Query  182  NKSIGIK  202
             K  GI+
Sbjct  388  YKEKGIR  394



>ref|XP_008672947.1| PREDICTED: LOC100284062 isoform X1 [Zea mays]
 tpg|DAA56216.1| TPA: hypothetical protein ZEAMMB73_146797 [Zea mays]
Length=400

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW MF+TRL +AEK Y
Sbjct  327  PAHEKIGVVDSQWIVHQVIPSLGNQGKAENGKAPWEGVRARCRKEWGMFQTRLTDAEKAY  386

Query  182  NKSIGI  199
                GI
Sbjct  387  YLEHGI  392



>ref|XP_004145746.1| PREDICTED: uncharacterized protein LOC101216740 [Cucumis sativus]
 ref|XP_004169195.1| PREDICTED: uncharacterized LOC101216740 [Cucumis sativus]
 gb|KGN46844.1| hypothetical protein Csa_6G141410 [Cucumis sativus]
Length=393

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSENGK  W+ V ERC  EWA F++RL NA+K Y
Sbjct  315  PAHEKIGVVDSQWIVHQVIPSLGSQGKSENGKAPWEGVRERCRTEWAEFQSRLANADKAY  374

Query  182  NKSI  193
               I
Sbjct  375  LAQI  378



>ref|XP_009804484.1| PREDICTED: uncharacterized protein LOC104249712 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804485.1| PREDICTED: uncharacterized protein LOC104249712 isoform X1 [Nicotiana 
sylvestris]
Length=433

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+SENGK  W+ V ERC  EWAMF+ RL NA++ Y
Sbjct  314  PAHEKIGVVDSQWIVHQFVPSLGNQGESENGKAPWEGVRERCTNEWAMFQDRLANADESY  373



>ref|XP_009804490.1| PREDICTED: uncharacterized protein LOC104249712 isoform X3 [Nicotiana 
sylvestris]
Length=382

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+SENGK  W+ V ERC  EWAMF+ RL NA++ Y
Sbjct  314  PAHEKIGVVDSQWIVHQFVPSLGNQGESENGKAPWEGVRERCTNEWAMFQDRLANADESY  373



>ref|XP_004971411.1| PREDICTED: uncharacterized protein LOC101761650 isoform X1 [Setaria 
italica]
 ref|XP_004971412.1| PREDICTED: uncharacterized protein LOC101761650 isoform X2 [Setaria 
italica]
 ref|XP_004971413.1| PREDICTED: uncharacterized protein LOC101761650 isoform X3 [Setaria 
italica]
 ref|XP_004971414.1| PREDICTED: uncharacterized protein LOC101761650 isoform X4 [Setaria 
italica]
Length=402

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SENG+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQSENGRAPWEGVRERCRKEWGIFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             + +G+
Sbjct  388  YEMMGV  393



>gb|KHN29027.1| hypothetical protein glysoja_008362 [Glycine soja]
Length=372

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVD Q + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  297  PAHEKIGVVDTQWIVHQGIPSLGNQGETQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  356

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  357  YYKSKGIDFS  366



>ref|XP_004971415.1| PREDICTED: uncharacterized protein LOC101761650 isoform X5 [Setaria 
italica]
Length=397

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SENG+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  323  PAHEKIGVVDSQWIVHQVVPSLGNQGQSENGRAPWEGVRERCRKEWGIFQTRMAEAEKAY  382

Query  182  NKSIGI  199
             + +G+
Sbjct  383  YEMMGV  388



>emb|CDX77169.1| BnaC04g39640D [Brassica napus]
Length=382

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  315  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  374

Query  182  NKSIGIK  202
               + +K
Sbjct  375  LGRMVVK  381



>ref|XP_009804486.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009804487.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009804489.1| PREDICTED: uncharacterized protein LOC104249712 isoform X2 [Nicotiana 
sylvestris]
Length=400

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+SENGK  W+ V ERC  EWAMF+ RL NA++ Y
Sbjct  314  PAHEKIGVVDSQWIVHQFVPSLGNQGESENGKAPWEGVRERCTNEWAMFQDRLANADESY  373



>ref|XP_004960543.1| PREDICTED: uncharacterized protein LOC101781300 [Setaria italica]
Length=401

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SENGK  W+ V  RC  EW  F+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQSENGKAPWEGVRARCRKEWGTFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             K +GI
Sbjct  388  YKMMGI  393



>ref|XP_002456820.1| hypothetical protein SORBIDRAFT_03g043390 [Sorghum bicolor]
 gb|EES01940.1| hypothetical protein SORBIDRAFT_03g043390 [Sorghum bicolor]
Length=401

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGKAENGKAPWEGVRARCRKEWGIFQTRLTDAEKAY  387

Query  182  NKSIGI  199
              + GI
Sbjct  388  YLAQGI  393



>ref|XP_002311761.1| hypothetical protein POPTR_0008s18970g [Populus trichocarpa]
 gb|EEE89128.1| hypothetical protein POPTR_0008s18970g [Populus trichocarpa]
Length=396

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+S+NGK  W+ V ERC  EW MF+TRL +AE  Y
Sbjct  323  PAHEKIGVVDSQWIVHQGVPSLGSQGESQNGKAPWQGVRERCRKEWTMFQTRLTSAENAY  382

Query  182  NKSIGIKSS  208
             ++ G+  S
Sbjct  383  FRAAGLDPS  391



>ref|XP_002880936.1| hypothetical protein ARALYDRAFT_481676 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57195.1| hypothetical protein ARALYDRAFT_481676 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  315  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKMEWTMFQNRLADADKEY  374



>emb|CDP20564.1| unnamed protein product [Coffea canephora]
Length=211

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKI VVD+Q + HQ+  +LG  G+SENGK  W+ V ERC +EWA F+  L NA+K+Y
Sbjct  78   PAHEKIDVVDSQWIVHQVIPSLGSQGQSENGKAPWQGVRERCRSEWAQFQDCLANADKKY  137

Query  182  NKSIG  196
             + +G
Sbjct  138  IEQLG  142



>ref|XP_002530039.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32339.1| conserved hypothetical protein [Ricinus communis]
Length=395

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ R+  AE  Y
Sbjct  322  PAHEKIGVVDSQWIVHQTVPSLGNQGESQNGKAPWQGVRERCRKEWTMFQNRMTYAENAY  381

Query  182  NKSIGIKSS  208
             +++ I+SS
Sbjct  382  FRAMAIESS  390



>ref|XP_006585254.1| PREDICTED: uncharacterized protein LOC100776631 [Glycine max]
Length=389

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSEN-GKPSWKAVNERCHAEWAMFRTRLENAEKE  178
            PAHEKIGVVD Q + HQ   +LG+ G+++  GKP+W+AV ERC  EW MF+ RL NAEK 
Sbjct  314  PAHEKIGVVDTQWIVHQGIPSLGNQGETQTTGKPAWRAVKERCGMEWRMFQGRLTNAEKG  373

Query  179  YNKSIGIKSS  208
            Y KS GI  S
Sbjct  374  YYKSKGIDFS  383



>emb|CDY70480.1| BnaAnng33820D [Brassica napus]
 emb|CDX71363.1| BnaC04g15980D [Brassica napus]
Length=383

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  317  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  376



>ref|XP_009103671.1| PREDICTED: uncharacterized protein LOC103829726 [Brassica rapa]
Length=383

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  317  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  376



>ref|XP_002887149.1| hypothetical protein ARALYDRAFT_894542 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63408.1| hypothetical protein ARALYDRAFT_894542 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>ref|XP_006303749.1| hypothetical protein CARUB_v10011910mg, partial [Capsella rubella]
 gb|EOA36647.1| hypothetical protein CARUB_v10011910mg, partial [Capsella rubella]
Length=365

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIG+VD+Q + HQ   +LG+ GK++NGK  W+ V +RC  EW +F  R+ENAEK+Y
Sbjct  302  PAYEKIGIVDSQWIVHQFIPSLGNEGKADNGKAPWQGVRDRCQLEWKLFEKRVENAEKDY  361

Query  182  NKSI  193
             KS+
Sbjct  362  FKSL  365



>gb|KHG02361.1| hypothetical protein F383_25835 [Gossypium arboreum]
Length=463

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+S+NGK  W+ V ERC  EW +F+TR   AEK Y
Sbjct  395  PAHEKIGVVDAQWIVHQSVPSLGNQGESQNGKAPWQGVRERCKREWTIFQTRFSRAEKSY  454

Query  182  NKSI  193
             K+I
Sbjct  455  YKAI  458



>ref|XP_009105088.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105089.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105090.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
 ref|XP_009105091.1| PREDICTED: uncharacterized protein LOC103831005 [Brassica rapa]
Length=404

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQTVPSLGSQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>ref|XP_002459174.1| hypothetical protein SORBIDRAFT_03g047280 [Sorghum bicolor]
 gb|EES04294.1| hypothetical protein SORBIDRAFT_03g047280 [Sorghum bicolor]
Length=402

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++ENG+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQAENGRAPWEGVRERCRKEWGLFQTRMAEAEKAY  387

Query  182  NKSIGI  199
             + +G+
Sbjct  388  YEMMGV  393



>ref|NP_564909.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974102.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK60335.1|AF385745_1 At1g67850/F12A21_2 [Arabidopsis thaliana]
 gb|AAN72241.1| At1g67850/F12A21_2 [Arabidopsis thaliana]
 dbj|BAH19864.1| AT1G67850 [Arabidopsis thaliana]
 dbj|BAH20333.1| AT1G67850 [Arabidopsis thaliana]
 gb|AEE34706.1| uncharacterized protein AT1G67850 [Arabidopsis thaliana]
 gb|AEE34707.1| uncharacterized protein AT1G67850 [Arabidopsis thaliana]
Length=404

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>ref|XP_010470103.1| PREDICTED: uncharacterized protein LOC104750070 [Camelina sativa]
Length=375

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  309  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  368



>gb|AAM15148.1| unknown protein [Arabidopsis thaliana]
 gb|AAD20694.2| hypothetical protein [Arabidopsis thaliana]
Length=355

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V +RC  EW MF+ RL +A+KEY
Sbjct  289  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRDRCKMEWTMFQNRLADADKEY  348



>ref|XP_010510643.1| PREDICTED: uncharacterized protein LOC104786889 [Camelina sativa]
 ref|XP_010510644.1| PREDICTED: uncharacterized protein LOC104786889 [Camelina sativa]
Length=375

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  309  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  368



>gb|AAF97966.1|AC000103_16 F21J9.23 [Arabidopsis thaliana]
Length=339

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA EKIG+VD+Q + HQ   +LG+ GK++NGK  W+ V +RC  EW MF  R+E AEK+Y
Sbjct  264  PAFEKIGIVDSQWIVHQFIPSLGNQGKADNGKAPWQGVRDRCQMEWKMFENRVEAAEKDY  323

Query  182  NKSIGIKS  205
             +S+ ++S
Sbjct  324  FRSLQVES  331



>ref|XP_011089275.1| PREDICTED: uncharacterized protein LOC105170284 [Sesamum indicum]
 ref|XP_011089276.1| PREDICTED: uncharacterized protein LOC105170284 [Sesamum indicum]
Length=383

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+S+NGK  WK V +RC  EWA+F+ RL NA+K Y
Sbjct  318  PAHEKIGVVDSQWIVHQVIPSLGNQGESDNGKAPWKGVRDRCKNEWALFQDRLANADKAY  377

Query  182  NKSI  193
               I
Sbjct  378  FSQI  381



>ref|XP_010414551.1| PREDICTED: uncharacterized protein LOC104700705 [Camelina sativa]
 ref|XP_010414552.1| PREDICTED: uncharacterized protein LOC104700705 [Camelina sativa]
 ref|XP_010414553.1| PREDICTED: uncharacterized protein LOC104700705 [Camelina sativa]
 ref|XP_010414554.1| PREDICTED: uncharacterized protein LOC104700705 [Camelina sativa]
Length=375

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL +A+KEY
Sbjct  309  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLADADKEY  368



>ref|XP_006340181.1| PREDICTED: uncharacterized protein LOC102584998 [Solanum tuberosum]
Length=387

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+ ENGK  W+ V ERC  EWAMF+ RL NA+K Y
Sbjct  319  PAHEKIGVVDSQWIVHQVIPSLGNQGQPENGKAPWEGVRERCRNEWAMFQDRLSNADKAY  378



>ref|XP_011034057.1| PREDICTED: uncharacterized protein LOC105132327 [Populus euphratica]
Length=396

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+TRL +AE  Y
Sbjct  323  PAHEKIGVVDSQWIVHQSVPSLGNQGESQNGKAPWQGVRERCRKEWTMFQTRLTSAENAY  382

Query  182  NKSIGIKSS  208
              + G+  S
Sbjct  383  FGAAGLDPS  391



>ref|XP_010689522.1| PREDICTED: uncharacterized protein LOC104903222 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD Q + H++  +LG+ G++ENGK  W+ V ERC  EWA F+ RL NA+KEY
Sbjct  312  PAHEKIGVVDQQWIVHKVIPSLGNQGQAENGKAPWQGVRERCKKEWAQFQNRLANADKEY  371

Query  182  NKSIG  196
               +G
Sbjct  372  LAQLG  376



>gb|KDP44036.1| hypothetical protein JCGZ_05503 [Jatropha curcas]
Length=375

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SE+G+  W+ V ERC  EWAMF+ RL NA+++Y
Sbjct  309  PAHEKIGVVDSQWIVHQVVPSLGNQGESEDGRAPWEGVRERCRNEWAMFQNRLTNADQKY  368

Query  182  NKSI  193
               I
Sbjct  369  RTRI  372



>ref|XP_009784116.1| PREDICTED: uncharacterized protein LOC104232580 [Nicotiana sylvestris]
Length=385

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+ ENGK  W+ V ERC  EWAMF+ RL NA+K Y
Sbjct  319  PAHEKIGVVDSQWIVHQVIPSLGNQGQPENGKAPWEGVRERCRNEWAMFQDRLANADKAY  378



>ref|XP_011042401.1| PREDICTED: uncharacterized protein LOC105138096 isoform X2 [Populus 
euphratica]
 ref|XP_011042402.1| PREDICTED: uncharacterized protein LOC105138096 isoform X2 [Populus 
euphratica]
Length=401

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ RL +AE+ Y
Sbjct  328  PAHEKIGVVDSQWIVHQTIPSLGNQGESQNGKKPWQGVKERCRKEWTMFQNRLASAERAY  387

Query  182  NKSIGI  199
             ++ G+
Sbjct  388  FRTAGL  393



>ref|XP_009617481.1| PREDICTED: uncharacterized protein LOC104109818 [Nicotiana tomentosiformis]
Length=387

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+ ENGK  W+ V ERC  EWAMF+ RL NA+K Y
Sbjct  319  PAHEKIGVVDSQWIVHQVIPSLGNQGQPENGKAPWEGVRERCRNEWAMFQDRLANADKAY  378



>ref|XP_011042400.1| PREDICTED: uncharacterized protein LOC105138096 isoform X1 [Populus 
euphratica]
Length=403

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ RL +AE+ Y
Sbjct  330  PAHEKIGVVDSQWIVHQTIPSLGNQGESQNGKKPWQGVKERCRKEWTMFQNRLASAERAY  389

Query  182  NKSIGI  199
             ++ G+
Sbjct  390  FRTAGL  395



>ref|XP_009140891.1| PREDICTED: uncharacterized protein LOC103864879 [Brassica rapa]
 ref|XP_009140892.1| PREDICTED: uncharacterized protein LOC103864879 [Brassica rapa]
Length=382

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL  A+KEY
Sbjct  315  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWTMFQNRLAEADKEY  374

Query  182  NKSIGIK  202
               + +K
Sbjct  375  LGRMVVK  381



>ref|XP_009618474.1| PREDICTED: uncharacterized protein LOC104110619 [Nicotiana tomentosiformis]
 ref|XP_009618536.1| PREDICTED: uncharacterized protein LOC104110619 [Nicotiana tomentosiformis]
Length=382

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+SENGK  W+ V ERC  EWAMF+ RL NA++ Y
Sbjct  314  PAHEKIGVVDSQWIVHQFVPSLGNQGESENGKAPWEGVRERCTNEWAMFQDRLANADESY  373



>ref|XP_002314593.1| hypothetical protein POPTR_0010s05730g [Populus trichocarpa]
 gb|EEF00764.1| hypothetical protein POPTR_0010s05730g [Populus trichocarpa]
Length=401

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ RL +AE+ Y
Sbjct  328  PAHEKIGVVDSQWIVHQTIPSLGNQGESQNGKKPWQGVKERCRKEWTMFQNRLASAERTY  387

Query  182  NKSIGI  199
             ++ G+
Sbjct  388  FRTAGL  393



>emb|CDY56527.1| BnaA07g38670D [Brassica napus]
Length=454

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  378  PAHEKIGVVDSQWVVHQTVPSLGSQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  437

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  438  FKSLQVEGS  446



>ref|XP_010696376.1| PREDICTED: uncharacterized protein LOC104908903, partial [Beta 
vulgaris subsp. vulgaris]
Length=284

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGV+D+Q + HQ   TLG+ G+++NGK  W  V ERC  EW MF+ R+  AEK+Y
Sbjct  207  PAHEKIGVIDSQWIVHQAVPTLGNQGETKNGKAPWVGVKERCRREWTMFQDRVAVAEKDY  266

Query  182  NKSIGI  199
             +S+G 
Sbjct  267  YESLGF  272



>ref|XP_010108849.1| hypothetical protein L484_020585 [Morus notabilis]
 gb|EXC20364.1| hypothetical protein L484_020585 [Morus notabilis]
Length=534

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+E+GK  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  461  PAHEKIGVVDAQWIVHQGVPSLGNQGKAESGKAPWEGVRERCRREWTMFQDRMTSAEKAY  520

Query  182  NKSIGI  199
             +++GI
Sbjct  521  FEAMGI  526



>ref|NP_683328.6| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE30547.1| uncharacterized protein AT1G24570 [Arabidopsis thaliana]
Length=381

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA EKIG+VD+Q + HQ   +LG+ GK++NGK  W+ V +RC  EW MF  R+E AEK+Y
Sbjct  306  PAFEKIGIVDSQWIVHQFIPSLGNQGKADNGKAPWQGVRDRCQMEWKMFENRVEAAEKDY  365

Query  182  NKSIGIKS  205
             +S+ ++S
Sbjct  366  FRSLQVES  373



>ref|XP_004971002.1| PREDICTED: uncharacterized protein LOC101768420 isoform X5 [Setaria 
italica]
 ref|XP_004971003.1| PREDICTED: uncharacterized protein LOC101768420 isoform X6 [Setaria 
italica]
Length=401

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVIPSLGNQGKAENGKAPWEGVRARCRKEWGIFQTRLADAEKAY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLDHGI  393



>ref|XP_003565154.1| PREDICTED: uncharacterized protein LOC100832535 [Brachypodium 
distachyon]
Length=403

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++ENGK  W+ V ERC  EW +F+TR+  A+K Y
Sbjct  329  PAHEKIGVVDSQWIVHQVVPSLGNQGRAENGKAPWEGVRERCRKEWGIFQTRIAEADKAY  388

Query  182  NKSIGI  199
             + +G+
Sbjct  389  YEMMGV  394



>gb|EEE56778.1| hypothetical protein OsJ_06354 [Oryza sativa Japonica Group]
Length=401

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G +ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQAVPSLGNQGNAENGKAPWEGVRARCRKEWEIFQTRLADAEKAY  387

Query  182  NKSIGI  199
              S GI
Sbjct  388  YLSQGI  393



>gb|EEC72958.1| hypothetical protein OsI_06843 [Oryza sativa Indica Group]
Length=401

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G +ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQAVPSLGNQGNAENGKAPWEGVRARCRKEWEIFQTRLADAEKAY  387

Query  182  NKSIGI  199
              S GI
Sbjct  388  YLSQGI  393



>ref|NP_001046611.1| Os02g0297600 [Oryza sativa Japonica Group]
 dbj|BAD21688.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08525.1| Os02g0297600 [Oryza sativa Japonica Group]
 dbj|BAG95108.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G +ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQAVPSLGNQGNAENGKAPWEGVRARCRKEWEIFQTRLADAEKAY  387

Query  182  NKSIGI  199
              S GI
Sbjct  388  YLSQGI  393



>ref|NP_850118.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850119.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001154537.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD94744.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08103.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
 gb|AEC08104.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
 gb|AEC08105.1| uncharacterized protein AT2G28310 [Arabidopsis thaliana]
Length=374

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V +RC  EW MF+ RL +A+KEY
Sbjct  308  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRDRCKMEWTMFQNRLADADKEY  367



>ref|XP_006647190.1| PREDICTED: uncharacterized protein LOC102709338 [Oryza brachyantha]
Length=401

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G +ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQAVPSLGNQGNAENGKAPWEGVRARCRKEWEIFQTRLADAEKAY  387

Query  182  NKSIGI  199
              S GI
Sbjct  388  YISQGI  393



>emb|CDM80653.1| unnamed protein product [Triticum aestivum]
Length=403

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++ENGK  W+ V ERC  EW +F+TR+  A+K Y
Sbjct  329  PAHEKIGVVDSQWIVHQVVPSLGNQGQAENGKAPWEGVRERCRKEWGIFQTRIAEADKAY  388

Query  182  NKSIGI  199
             + +G+
Sbjct  389  YEMMGV  394



>ref|XP_004971001.1| PREDICTED: uncharacterized protein LOC101768420 isoform X4 [Setaria 
italica]
Length=437

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  364  PAHEKIGVVDSQWIVHQVIPSLGNQGKAENGKAPWEGVRARCRKEWGIFQTRLADAEKAY  423

Query  182  NKSIGI  199
                GI
Sbjct  424  YLDHGI  429



>ref|XP_006438248.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 ref|XP_006438249.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 ref|XP_006483955.1| PREDICTED: uncharacterized protein LOC102616998 isoform X1 [Citrus 
sinensis]
 ref|XP_006483956.1| PREDICTED: uncharacterized protein LOC102616998 isoform X2 [Citrus 
sinensis]
 gb|ESR51488.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 gb|ESR51489.1| hypothetical protein CICLE_v10031670mg [Citrus clementina]
 gb|KDO82212.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
 gb|KDO82213.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
 gb|KDO82214.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
Length=415

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S++GK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  342  PAHEKIGVVDSQWIVHQTVPSLGNQGESKDGKAPWQGVRERCKKEWTMFQGRMANAEKAY  401

Query  182  NKSIGIKSS  208
             +++G  ++
Sbjct  402  FQALGADTT  410



>ref|XP_004970998.1| PREDICTED: uncharacterized protein LOC101768420 isoform X1 [Setaria 
italica]
 ref|XP_004970999.1| PREDICTED: uncharacterized protein LOC101768420 isoform X2 [Setaria 
italica]
 ref|XP_004971000.1| PREDICTED: uncharacterized protein LOC101768420 isoform X3 [Setaria 
italica]
Length=438

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GK+ENGK  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  365  PAHEKIGVVDSQWIVHQVIPSLGNQGKAENGKAPWEGVRARCRKEWGIFQTRLADAEKAY  424

Query  182  NKSIGI  199
                GI
Sbjct  425  YLDHGI  430



>ref|XP_010232719.1| PREDICTED: uncharacterized protein LOC100831721 isoform X1 [Brachypodium 
distachyon]
Length=402

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKSENGK  W+ V  RC  EW +F++RL +AEK+Y
Sbjct  329  PAHEKIGVVDAQWIVHQGVPSLGNQGKSENGKAPWEGVRGRCRKEWGIFQSRLADAEKKY  388

Query  182  NKSIGI  199
                GI
Sbjct  389  YLDQGI  394



>ref|XP_003564891.1| PREDICTED: uncharacterized protein LOC100831721 isoform X2 [Brachypodium 
distachyon]
Length=401

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKSENGK  W+ V  RC  EW +F++RL +AEK+Y
Sbjct  328  PAHEKIGVVDAQWIVHQGVPSLGNQGKSENGKAPWEGVRGRCRKEWGIFQSRLADAEKKY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLDQGI  393



>ref|XP_006300986.1| hypothetical protein CARUB_v10021375mg [Capsella rubella]
 gb|EOA33884.1| hypothetical protein CARUB_v10021375mg [Capsella rubella]
Length=404

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ +AEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCKKEWTMFQSRMADAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  YKSLQVEGS  396



>ref|XP_008676605.1| PREDICTED: uncharacterized protein LOC100193875 isoform X1 [Zea 
mays]
Length=403

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  330  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  389

Query  182  NKSIGI  199
                GI
Sbjct  390  YLERGI  395



>gb|AFW62453.1| hypothetical protein ZEAMMB73_667064 [Zea mays]
Length=402

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  388

Query  182  NKSIGI  199
                GI
Sbjct  389  YLERGI  394



>gb|AFW62455.1| hypothetical protein ZEAMMB73_667064 [Zea mays]
Length=401

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  328  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLERGI  393



>ref|XP_004952281.1| PREDICTED: uncharacterized protein LOC101755578 isoform X1 [Setaria 
italica]
 ref|XP_004952282.1| PREDICTED: uncharacterized protein LOC101755578 isoform X2 [Setaria 
italica]
Length=403

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  330  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  389

Query  182  NKSIGI  199
                GI
Sbjct  390  YLERGI  395



>ref|NP_001132425.1| uncharacterized protein LOC100193875 [Zea mays]
 gb|ACF81258.1| unknown [Zea mays]
Length=402

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  388

Query  182  NKSIGI  199
                GI
Sbjct  389  YLERGI  394



>ref|XP_004952283.1| PREDICTED: uncharacterized protein LOC101755578 isoform X3 [Setaria 
italica]
Length=402

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKS+NG+  W+ V  RC  EW +F+TRL +AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQAVPSLGNQGKSDNGRAPWEGVRARCRKEWGIFQTRLADAEKAY  388

Query  182  NKSIGI  199
                GI
Sbjct  389  YLERGI  394



>ref|XP_008804224.1| PREDICTED: uncharacterized protein LOC103717560 isoform X3 [Phoenix 
dactylifera]
Length=397

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G SE GK  W+ V ERC  EW +F+ RL +AEK+Y
Sbjct  324  PAHEKIGVVDSQWIVHQVVPSLGNQGISEKGKAPWEGVRERCRKEWGIFQNRLADAEKKY  383

Query  182  NKSIGI  199
             K  GI
Sbjct  384  YKKRGI  389



>emb|CDY28844.1| BnaC06g26320D [Brassica napus]
Length=472

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK+Y
Sbjct  396  PAHEKIGVVDSQWVVHQTVPSLGSQGEATDGKAPWQGVRDRCKKEWTMFQSRMANAEKDY  455

Query  182  NKSIGIKSS  208
             +S+ ++ S
Sbjct  456  FRSLQVEGS  464



>ref|XP_006424551.1| hypothetical protein CICLE_v10028654mg [Citrus clementina]
 ref|XP_006488074.1| PREDICTED: uncharacterized protein LOC102621821 isoform X2 [Citrus 
sinensis]
 gb|ESR37791.1| hypothetical protein CICLE_v10028654mg [Citrus clementina]
 gb|KDO73330.1| hypothetical protein CISIN_1g017018mg [Citrus sinensis]
Length=368

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G++ENGK  W+ V  RC  EW++F+ RL NA+K Y
Sbjct  302  PAHEKIGVVDSQWIIHQVIPSLGSQGQAENGKAPWEGVRARCKNEWSLFQNRLANADKAY  361

Query  182  NKSIG  196
             + IG
Sbjct  362  LEEIG  366



>ref|XP_006645331.1| PREDICTED: uncharacterized protein LOC102709326 [Oryza brachyantha]
Length=402

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SE+G+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQSEHGRAPWEGVRERCRKEWGIFQTRMAEAEKSY  387

Query  182  NKSIGI  199
             + +G+
Sbjct  388  YEMMGV  393



>ref|NP_001045532.1| Os01g0971200 [Oryza sativa Japonica Group]
 dbj|BAD87361.1| lysine ketoglutarate reductase trans-splicing related 1-like 
[Oryza sativa Japonica Group]
 dbj|BAF07446.1| Os01g0971200 [Oryza sativa Japonica Group]
 gb|EAZ14986.1| hypothetical protein OsJ_04921 [Oryza sativa Japonica Group]
 dbj|BAG95217.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SE+G+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGQSEHGRAPWEGVRERCRKEWGIFQTRIAEAEKSY  387

Query  182  NKSIGI  199
             + +G+
Sbjct  388  YEMMGV  393



>gb|KDO82211.1| hypothetical protein CISIN_1g013577mg [Citrus sinensis]
Length=440

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S++GK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  367  PAHEKIGVVDSQWIVHQTVPSLGNQGESKDGKAPWQGVRERCKKEWTMFQGRMANAEKAY  426

Query  182  NKSIGIKSS  208
             +++G  ++
Sbjct  427  FQALGADTT  435



>ref|XP_008804220.1| PREDICTED: uncharacterized protein LOC103717560 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008804221.1| PREDICTED: uncharacterized protein LOC103717560 isoform X1 [Phoenix 
dactylifera]
Length=404

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G SE GK  W+ V ERC  EW +F+ RL +AEK+Y
Sbjct  331  PAHEKIGVVDSQWIVHQVVPSLGNQGISEKGKAPWEGVRERCRKEWGIFQNRLADAEKKY  390

Query  182  NKSIGI  199
             K  GI
Sbjct  391  YKKRGI  396



>ref|XP_008804222.1| PREDICTED: uncharacterized protein LOC103717560 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804223.1| PREDICTED: uncharacterized protein LOC103717560 isoform X2 [Phoenix 
dactylifera]
Length=401

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G SE GK  W+ V ERC  EW +F+ RL +AEK+Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGISEKGKAPWEGVRERCRKEWGIFQNRLADAEKKY  387

Query  182  NKSIGI  199
             K  GI
Sbjct  388  YKKRGI  393



>ref|XP_006409854.1| hypothetical protein EUTSA_v10016806mg [Eutrema salsugineum]
 gb|ESQ51307.1| hypothetical protein EUTSA_v10016806mg [Eutrema salsugineum]
Length=379

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL  A+KEY
Sbjct  313  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWKMFQNRLAEADKEY  372



>ref|XP_006357566.1| PREDICTED: uncharacterized protein LOC102597248 [Solanum tuberosum]
Length=380

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ENGK  W+ V ERC  EWAMF+ RL NA++ Y
Sbjct  312  PAHEKIGVVDSQWIVHQFVPSLGSQGETENGKAPWEGVRERCTNEWAMFQDRLANADESY  371



>ref|XP_006424550.1| hypothetical protein CICLE_v10028654mg [Citrus clementina]
 ref|XP_006488073.1| PREDICTED: uncharacterized protein LOC102621821 isoform X1 [Citrus 
sinensis]
 gb|ESR37790.1| hypothetical protein CICLE_v10028654mg [Citrus clementina]
 gb|KDO73332.1| hypothetical protein CISIN_1g017018mg [Citrus sinensis]
Length=379

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G++ENGK  W+ V  RC  EW++F+ RL NA+K Y
Sbjct  313  PAHEKIGVVDSQWIIHQVIPSLGSQGQAENGKAPWEGVRARCKNEWSLFQNRLANADKAY  372

Query  182  NKSIG  196
             + IG
Sbjct  373  LEEIG  377



>gb|KDO73331.1| hypothetical protein CISIN_1g017018mg [Citrus sinensis]
Length=376

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G++ENGK  W+ V  RC  EW++F+ RL NA+K Y
Sbjct  310  PAHEKIGVVDSQWIIHQVIPSLGSQGQAENGKAPWEGVRARCKNEWSLFQNRLANADKAY  369

Query  182  NKSIG  196
             + IG
Sbjct  370  LEEIG  374



>ref|XP_006858380.1| hypothetical protein AMTR_s00064p00205830 [Amborella trichopoda]
 gb|ERN19847.1| hypothetical protein AMTR_s00064p00205830 [Amborella trichopoda]
Length=437

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + H++  +LGD G +++G+  W+ V  RC+ EWA FR R++ AEKEY
Sbjct  373  PAHEKIGVVDAQWIVHKVLPSLGDQGDAKDGRQPWEGVRARCNDEWAEFRIRMDKAEKEY  432

Query  182  -NKSI  193
             NKS+
Sbjct  433  FNKSV  437



>ref|XP_009771349.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
 ref|XP_009771350.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
 ref|XP_009771351.1| PREDICTED: uncharacterized protein LOC104221902 [Nicotiana sylvestris]
Length=403

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+ ENGK  W+ V ERC  EW +F+ R+  AEK+Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGNQGQEENGKAPWEGVRERCKREWTIFKERMAAAEKDY  389

Query  182  NKSIGI  199
             K+ GI
Sbjct  390  YKAKGI  395



>ref|XP_008362120.1| PREDICTED: uncharacterized protein LOC103425798 isoform X1 [Malus 
domestica]
 ref|XP_008362121.1| PREDICTED: uncharacterized protein LOC103425798 isoform X1 [Malus 
domestica]
Length=402

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ GK+E G+  W+ V ERC  EW MFR R+ +AEK Y
Sbjct  329  PAHKKIGVVDAQWIVHQGVPSLGNQGKAEXGRAPWEGVRERCRREWTMFRARMASAEKAY  388

Query  182  NKSIGI  199
             + +GI
Sbjct  389  FEEMGI  394



>ref|XP_008362122.1| PREDICTED: uncharacterized protein LOC103425798 isoform X2 [Malus 
domestica]
Length=401

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ GK+E G+  W+ V ERC  EW MFR R+ +AEK Y
Sbjct  328  PAHKKIGVVDAQWIVHQGVPSLGNQGKAEXGRAPWEGVRERCRREWTMFRARMASAEKAY  387

Query  182  NKSIGI  199
             + +GI
Sbjct  388  FEEMGI  393



>gb|EEC72250.1| hypothetical protein OsI_05383 [Oryza sativa Indica Group]
Length=404

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+SE+G+  W+ V ERC  EW +F+TR+  AEK Y
Sbjct  330  PAHEKIGVVDSQWIVHQVVPSLGNQGQSEHGRAPWEGVRERCRKEWGIFQTRIAEAEKSY  389

Query  182  NKSIGI  199
             + +G+
Sbjct  390  YEMMGV  395



>gb|EMT33056.1| hypothetical protein F775_17511 [Aegilops tauschii]
Length=527

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++ENGK  W+ V ERC  EW +F+TR+  A+K Y
Sbjct  453  PAHEKIGVVDSQWIVHQVVPSLGNQGQAENGKAPWEGVRERCRKEWGIFQTRIAEADKAY  512

Query  182  NKSIGI  199
             + +G+
Sbjct  513  YEMMGV  518



>emb|CDY12672.1| BnaA02g13400D [Brassica napus]
Length=457

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK Y
Sbjct  381  PAHEKIGVVDSQWIVHQTVPSLGSQGEAVDGKAPWQGVRDRCKKEWTMFQSRMANAEKAY  440

Query  182  NKSIGIKSS  208
             KS+ +  S
Sbjct  441  FKSLQVVGS  449



>ref|XP_006470471.1| PREDICTED: uncharacterized protein LOC102609262 [Citrus sinensis]
Length=390

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+  +G+  W+AV ERC  EW MF+ R+ +AEK Y
Sbjct  309  PAHEKIGVVDAQWIVHQGVPSLGNQGQPHDGRAPWEAVRERCKNEWEMFKDRMTSAEKAY  368

Query  182  NKSIGIKSS  208
             +++G+ S+
Sbjct  369  LEALGVDST  377



>gb|KDO49037.1| hypothetical protein CISIN_1g015489mg [Citrus sinensis]
Length=406

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+  +G+  W+AV ERC  EW MF+ R+ +AEK Y
Sbjct  325  PAHEKIGVVDAQWIVHQGVPSLGNQGQPHDGRAPWEAVRERCKNEWEMFKDRMTSAEKAY  384

Query  182  NKSIGIKSS  208
             +++G+ S+
Sbjct  385  LEALGVDST  393



>ref|XP_010415381.1| PREDICTED: uncharacterized protein LOC104701401 [Camelina sativa]
Length=404

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ +AEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCKKEWTMFQSRMASAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>emb|CDP16614.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ GK+ENGK  W+ V ERC  EW MF+ R+  AE+ Y
Sbjct  327  PAHEKIGVVDSQWIVHQTVPSLGNQGKAENGKAPWEGVRERCRREWTMFQDRMTAAERAY  386

Query  182  NKSIGI  199
              + GI
Sbjct  387  YLAKGI  392



>ref|XP_003531333.1| PREDICTED: uncharacterized protein LOC100805311 [Glycine max]
Length=397

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W  V ERC  EW MF++RL NAE  Y
Sbjct  324  PAHEKIGVVDSQWIIHQSVPSLGNQGESQPGKAPWHGVRERCKREWTMFQSRLANAEDAY  383

Query  182  NKSIG  196
             +++G
Sbjct  384  YRAVG  388



>gb|KHN29026.1| hypothetical protein glysoja_008361, partial [Glycine soja]
Length=390

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+ GK  W  V ERC  EW MF++RL NAE  Y
Sbjct  317  PAHEKIGVVDSQWIIHQSVPSLGNQGESQPGKAPWHGVRERCKREWTMFQSRLANAEDAY  376

Query  182  NKSIG  196
             +++G
Sbjct  377  YRAVG  381



>ref|XP_004304668.1| PREDICTED: uncharacterized protein LOC101309467 [Fragaria vesca 
subsp. vesca]
Length=404

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G++E+G+  W+ V ERC  EW MF+ R+  AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQSVPSLGNQGQAESGRAPWEGVRERCRREWTMFQARMAGAEKAY  388

Query  182  NKSIGIKS  205
             + +GI +
Sbjct  389  FEEMGIDT  396



>ref|XP_010470715.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
 ref|XP_010470716.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
 ref|XP_010470717.1| PREDICTED: uncharacterized protein LOC104750595 [Camelina sativa]
Length=404

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ +AEK+Y
Sbjct  328  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWQGVRDRCTKEWTMFQSRMASAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>ref|XP_009617945.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
 ref|XP_009617946.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
 ref|XP_009617947.1| PREDICTED: uncharacterized protein LOC104110200 [Nicotiana tomentosiformis]
Length=395

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E GK  W+ V ERC  EWAMF+ R+  AEK+Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGNQGQAEQGKAPWEGVRERCKREWAMFKERMAAAEKDY  389

Query  182  NKSIG  196
             K+ G
Sbjct  390  YKAKG  394



>ref|XP_010542587.1| PREDICTED: uncharacterized protein LOC104815743 [Tarenaya hassleriana]
Length=381

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G++E GK  W+ V ERC  EW MF+ RL  A+KEY
Sbjct  315  PAHEKIGVVDSQWIIHQVIPSLGNQGQAEKGKAPWQGVRERCRNEWGMFQNRLAEADKEY  374

Query  182  NKSIG  196
               +G
Sbjct  375  LAPMG  379



>ref|XP_011101801.1| PREDICTED: uncharacterized protein LOC105179859 isoform X2 [Sesamum 
indicum]
 ref|XP_011101802.1| PREDICTED: uncharacterized protein LOC105179859 isoform X2 [Sesamum 
indicum]
Length=382

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E GK  W+ V ERC  EW+MF+ R+  AEK Y
Sbjct  309  PAHEKIGVVDSQWIVHQTVPSLGNQGEAEKGKAPWEGVRERCRNEWSMFQDRMTAAEKAY  368

Query  182  NKSIGI  199
             +++GI
Sbjct  369  FQAMGI  374



>ref|XP_006391211.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
 gb|ESQ28497.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
Length=401

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ +AEK+Y
Sbjct  325  PAHEKIGVVDSQWIVHQTVPSLGSQGEATDGKAPWQGVRDRCKKEWTMFQSRMASAEKDY  384

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  385  FKSLQVEGS  393



>ref|XP_008379197.1| PREDICTED: uncharacterized protein LOC103442207 [Malus domestica]
Length=402

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ G+ E G+  W+ V ERC++EWAMF+ R+  AEK Y
Sbjct  329  PAHKKIGVVDAQWIVHQGVPSLGNQGRPEGGRAPWEGVRERCNSEWAMFQARMTGAEKAY  388

Query  182  NKSIGI  199
             + +GI
Sbjct  389  FEEMGI  394



>ref|XP_004977866.1| PREDICTED: uncharacterized protein LOC101753754 [Setaria italica]
Length=402

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+  G+  WK V  RC+ EW MFR+RL +AEK Y
Sbjct  330  PAHEKIGVVDAQWIVHQAIPSLGNQGKAVKGRAPWKGVKARCNLEWGMFRSRLADAEKAY  389

Query  182  NKSIGI  199
                GI
Sbjct  390  YLEKGI  395



>gb|EYU44800.1| hypothetical protein MIMGU_mgv1a007501mg [Erythranthe guttata]
 gb|EYU44801.1| hypothetical protein MIMGU_mgv1a007501mg [Erythranthe guttata]
Length=405

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ GK+E GK  W+ V ERC  EW +F+ R+  AEK Y
Sbjct  332  PAHEKIGVVDSQWIVHQTVPSLGNQGKAEKGKAPWEGVRERCRNEWTLFQDRMTAAEKAY  391

Query  182  NKSIGI  199
              S+GI
Sbjct  392  FISMGI  397



>ref|XP_006391212.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
 gb|ESQ28498.1| hypothetical protein EUTSA_v10018653mg [Eutrema salsugineum]
Length=404

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ +AEK+Y
Sbjct  328  PAHEKIGVVDSQWIVHQTVPSLGSQGEATDGKAPWQGVRDRCKKEWTMFQSRMASAEKDY  387

Query  182  NKSIGIKSS  208
             KS+ ++ S
Sbjct  388  FKSLQVEGS  396



>ref|XP_010557340.1| PREDICTED: uncharacterized protein LOC104826374 [Tarenaya hassleriana]
Length=378

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ+  +LG+ G++E GK  W+ V ERC  EW MF++R+  A+KEY
Sbjct  312  PAHEKIGVVDAQWIIHQVIPSLGNQGQAEKGKAPWQGVRERCRKEWTMFQSRMVEADKEY  371

Query  182  -NKSIG  196
              +++G
Sbjct  372  IGRTVG  377



>gb|KDP46396.1| hypothetical protein JCGZ_10236 [Jatropha curcas]
Length=402

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G++ +G+  W+ V ERC  EW MF+ RL  AEK Y
Sbjct  329  PAHEKIGVVDAQWIVHQSVPSLGNQGEAGSGRAPWEGVRERCQNEWKMFQDRLFGAEKAY  388

Query  182  NKSIGI  199
             +SIGI
Sbjct  389  FESIGI  394



>ref|XP_011101803.1| PREDICTED: uncharacterized protein LOC105179859 isoform X3 [Sesamum 
indicum]
Length=404

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E GK  W+ V ERC  EW+MF+ R+  AEK Y
Sbjct  331  PAHEKIGVVDSQWIVHQTVPSLGNQGEAEKGKAPWEGVRERCRNEWSMFQDRMTAAEKAY  390

Query  182  NKSIGI  199
             +++GI
Sbjct  391  FQAMGI  396



>ref|XP_011101800.1| PREDICTED: uncharacterized protein LOC105179859 isoform X1 [Sesamum 
indicum]
Length=403

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E GK  W+ V ERC  EW+MF+ R+  AEK Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGNQGEAEKGKAPWEGVRERCRNEWSMFQDRMTAAEKAY  389

Query  182  NKSIGI  199
             +++GI
Sbjct  390  FQAMGI  395



>emb|CDM85600.1| unnamed protein product [Triticum aestivum]
Length=401

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKSENG+  W+ V  RC  EW +F+ RL +AEK+Y
Sbjct  328  PAHEKIGVVDAQWIVHQGVPSLGNQGKSENGRAPWEGVRGRCRKEWGIFQARLADAEKKY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLDQGI  393



>ref|XP_009127584.1| PREDICTED: uncharacterized protein LOC103852432 [Brassica rapa]
Length=404

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G++ +GK  W+ V +RC  EW MF++R+ NAEK Y
Sbjct  328  PAHEKIGVVDSQWIVHQTVPSLGSQGEAVDGKAPWQGVRDRCKKEWTMFQSRMANAEKAY  387

Query  182  NKSIGIKSS  208
             KS+ +  S
Sbjct  388  FKSLQVVGS  396



>ref|XP_007031624.1| Uncharacterized protein isoform 7 [Theobroma cacao]
 gb|EOY02550.1| Uncharacterized protein isoform 7 [Theobroma cacao]
Length=392

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G +E G+  W+ V ERC  EWAMF+ R+ +AE  Y
Sbjct  314  PPHEKIGVVDAQWIVHQGVPSLGNQGHAEGGRAPWEGVRERCRKEWAMFQDRMADAETAY  373

Query  182  NKSIGIKSS  208
             K++G+ +S
Sbjct  374  FKAMGMNTS  382



>ref|XP_004251145.1| PREDICTED: uncharacterized protein LOC101261883 [Solanum lycopersicum]
Length=387

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+  NGK  W+ V ERC  EWAMF+ RL NA+K Y
Sbjct  319  PAHEKIGVVDSQWIVHQVIPSLGNQGQPVNGKAPWEGVRERCRNEWAMFQDRLSNADKAY  378



>emb|CDY30497.1| BnaA04g16360D [Brassica napus]
Length=382

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + H++  +LG  GKSENGK  W+ V ERC  EW MF+ RL  A+KE+
Sbjct  315  PAHEKIGVVDSQWIIHKVIPSLGSQGKSENGKAPWQGVRERCKKEWVMFQNRLAEADKEH  374

Query  182  NKSIGIK  202
               + +K
Sbjct  375  LGRMVVK  381



>ref|XP_007159700.1| hypothetical protein PHAVU_002G259800g [Phaseolus vulgaris]
 gb|ESW31694.1| hypothetical protein PHAVU_002G259800g [Phaseolus vulgaris]
Length=397

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG  G+SE+GK  W+ V ERC  EW MF++RL  AE  Y
Sbjct  324  PAHEKIGVVDSQWIIHQSVPSLGSQGESESGKAPWQGVRERCKKEWTMFQSRLAKAEDAY  383

Query  182  NKSIGI  199
             K++ +
Sbjct  384  YKAVEV  389



>gb|EMT06881.1| hypothetical protein F775_28460 [Aegilops tauschii]
Length=457

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GKSENG+  W+ V  RC  EW +F+ RL +AEK+Y
Sbjct  384  PAHEKIGVVDAQWIVHQGVPSLGNQGKSENGRAPWEGVRGRCRKEWGIFQARLADAEKKY  443

Query  182  NKSIGI  199
                GI
Sbjct  444  YLDQGI  449



>ref|XP_010511750.1| PREDICTED: uncharacterized protein LOC104787807 [Camelina sativa]
 ref|XP_010511751.1| PREDICTED: uncharacterized protein LOC104787807 [Camelina sativa]
Length=404

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ   +LG+ G++ +GK  W+ V +RC  EW MF++R+ +AEKEY
Sbjct  330  PAHEKIGVVDSQWVVHQSFPSLGNQGEATDGKAPWEGVRDRCKKEWTMFQSRMASAEKEY  389

Query  182  NKSI  193
             KS+
Sbjct  390  FKSL  393



>ref|XP_007031618.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007031619.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007031623.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02544.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02545.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY02549.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=404

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G +E G+  W+ V ERC  EWAMF+ R+ +AE  Y
Sbjct  326  PPHEKIGVVDAQWIVHQGVPSLGNQGHAEGGRAPWEGVRERCRKEWAMFQDRMADAETAY  385

Query  182  NKSIGIKSS  208
             K++G+ +S
Sbjct  386  FKAMGMNTS  394



>emb|CBI34843.3| unnamed protein product [Vitis vinifera]
Length=388

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+E GK  W+ V ERC  EW MF+ R+  AEK Y
Sbjct  315  PAHEKIGVVDAQWILHQSVPSLGNQGKAEGGKAPWEGVRERCRKEWTMFQDRMAVAEKAY  374

Query  182  NKSIGI  199
             +++ I
Sbjct  375  FEAMKI  380



>ref|XP_007031620.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY02546.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=410

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G +E G+  W+ V ERC  EWAMF+ R+ +AE  Y
Sbjct  332  PPHEKIGVVDAQWIVHQGVPSLGNQGHAEGGRAPWEGVRERCRKEWAMFQDRMADAETAY  391

Query  182  NKSIGIKSS  208
             K++G+ +S
Sbjct  392  FKAMGMNTS  400



>ref|XP_011089930.1| PREDICTED: uncharacterized protein LOC105170731 [Sesamum indicum]
 ref|XP_011089931.1| PREDICTED: uncharacterized protein LOC105170731 [Sesamum indicum]
Length=382

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ+  +LG+ G+  +G+P+W+ V ERC  EW +F+ RL  A+K Y
Sbjct  319  PAHEKIGVVDAQTILHQVIPSLGNQGEVGDGRPAWQGVRERCKNEWTLFQDRLATADKAY  378



>ref|XP_002529935.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32443.1| conserved hypothetical protein [Ricinus communis]
Length=368

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ GKSE GK  W+ V  RC  EW+MF++RL +A+K Y
Sbjct  304  PAHEKIGVVDSQWIIHQVIPSLGNQGKSEKGKAPWEGVRARCKNEWSMFQSRLADADKAY  363

Query  182  NKSI  193
               I
Sbjct  364  LSQI  367



>ref|XP_010253713.1| PREDICTED: uncharacterized protein LOC104594877 isoform X2 [Nelumbo 
nucifera]
Length=358

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+S NGK  W+ V ERC +EWA F+ RL NA+K Y
Sbjct  292  PAHEKIGVVDSQWIVHQVIPSLGNQGQSLNGKAPWEGVRERCRSEWAEFQARLANADKAY  351



>ref|XP_002272341.1| PREDICTED: uncharacterized protein LOC100264636 [Vitis vinifera]
Length=402

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ GK+E GK  W+ V ERC  EW MF+ R+  AEK Y
Sbjct  329  PAHEKIGVVDAQWILHQSVPSLGNQGKAEGGKAPWEGVRERCRKEWTMFQDRMAVAEKAY  388

Query  182  NKSIGI  199
             +++ I
Sbjct  389  FEAMKI  394



>ref|XP_008463954.1| PREDICTED: uncharacterized protein LOC103501955 [Cucumis melo]
Length=392

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSE+GK  W+ V  RC  EWA F++RL NA+K Y
Sbjct  315  PAHEKIGVVDSQWIVHQVIPSLGSQGKSEDGKAPWEGVRARCRTEWAEFQSRLANADKAY  374

Query  182  NKSI  193
               I
Sbjct  375  LAQI  378



>dbj|BAD82423.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAD82335.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
Length=393

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q V HQ+  +LG+ G +ENG+  W+ V  RC  EW MF+ RL +AEK Y
Sbjct  324  PAHEKIGVVDSQWVIHQVIPSLGNQGTAENGRTPWEGVRARCRKEWGMFQKRLADAEKAY  383

Query  182  NKSIGI  199
                GI
Sbjct  384  YLGKGI  389



>ref|XP_010253712.1| PREDICTED: uncharacterized protein LOC104594877 isoform X1 [Nelumbo 
nucifera]
Length=382

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G+S NGK  W+ V ERC +EWA F+ RL NA+K Y
Sbjct  316  PAHEKIGVVDSQWIVHQVIPSLGNQGQSLNGKAPWEGVRERCRSEWAEFQARLANADKAY  375



>ref|XP_011097376.1| PREDICTED: uncharacterized protein LOC105176309 isoform X2 [Sesamum 
indicum]
Length=375

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E+G+  W+ V ERC  EWAMF  RL  AE+ Y
Sbjct  302  PAHEKIGVVDSQWIVHQTVPSLGNQGEAEDGRAPWEGVRERCRNEWAMFHDRLAIAERRY  361

Query  182  NKSIG  196
               +G
Sbjct  362  YAGLG  366



>ref|XP_007031622.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY02548.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=433

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G +E G+  W+ V ERC  EWAMF+ R+ +AE  Y
Sbjct  355  PPHEKIGVVDAQWIVHQGVPSLGNQGHAEGGRAPWEGVRERCRKEWAMFQDRMADAETAY  414

Query  182  NKSIGIKSS  208
             K++G+ +S
Sbjct  415  FKAMGMNTS  423



>ref|XP_009370346.1| PREDICTED: uncharacterized protein LOC103959709 [Pyrus x bretschneideri]
Length=402

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ GK+E G+  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  329  PAHKKIGVVDAQWIVHQGVPSLGNQGKAEGGRAPWEGVRERCRREWTMFQARMASAEKAY  388

Query  182  NKSIGI  199
             + +GI
Sbjct  389  FEEMGI  394



>ref|XP_002893440.1| hypothetical protein ARALYDRAFT_313424 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69699.1| hypothetical protein ARALYDRAFT_313424 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA E IG+VD+Q + HQ   +LG+ GK +NGK  W+ V +RC  EW MF  R++ AEK+Y
Sbjct  288  PAFENIGIVDSQWIVHQFIPSLGNQGKEDNGKAPWQGVRDRCQMEWKMFENRVDAAEKDY  347

Query  182  NKSIGIKS  205
             KS+ ++S
Sbjct  348  FKSLQVES  355



>ref|XP_009371751.1| PREDICTED: uncharacterized protein LOC103960971 [Pyrus x bretschneideri]
 ref|XP_009371752.1| PREDICTED: uncharacterized protein LOC103960971 [Pyrus x bretschneideri]
Length=402

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAH+KIGVVDAQ + HQ   +LG+ GK+E G+  W+ V ERC  EW MF+ R+ +AEK Y
Sbjct  329  PAHKKIGVVDAQWIVHQGVPSLGNQGKAEGGRAPWEGVRERCRREWTMFQARMASAEKAY  388

Query  182  NKSIGI  199
             + +GI
Sbjct  389  FEEMGI  394



>ref|XP_011044400.1| PREDICTED: uncharacterized protein LOC105139600 isoform X2 [Populus 
euphratica]
Length=364

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSE GK  W+ V  RC  EW++FR+RL +AE+ Y
Sbjct  298  PAHEKIGVVDSQWIIHQVIPSLGSQGKSEKGKAPWEGVRARCRNEWSLFRSRLADAEQAY  357



>ref|XP_010029096.1| PREDICTED: uncharacterized protein LOC104419210 isoform X2 [Eucalyptus 
grandis]
 gb|KCW55939.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
Length=377

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+ E+GK  W+ V ERC  EWAMF+ R+ +AE+ Y
Sbjct  304  PAHEKIGVVDAQWIVHQGVPSLGNQGQPESGKAPWEGVRERCRREWAMFQERVASAERTY  363

Query  182  NKSIGI  199
              ++G+
Sbjct  364  FLAMGM  369



>ref|XP_011044399.1| PREDICTED: uncharacterized protein LOC105139600 isoform X1 [Populus 
euphratica]
Length=368

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSE GK  W+ V  RC  EW++FR+RL +AE+ Y
Sbjct  302  PAHEKIGVVDSQWIIHQVIPSLGSQGKSEKGKAPWEGVRARCRNEWSLFRSRLADAEQAY  361



>ref|XP_002314280.2| hypothetical protein POPTR_0009s01620g [Populus trichocarpa]
 gb|EEE88235.2| hypothetical protein POPTR_0009s01620g [Populus trichocarpa]
Length=382

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  GKSE GK  W+ V  RC  EW++FR+RL +AE+ Y
Sbjct  316  PAHEKIGVVDSQWIIHQVIPSLGSQGKSEKGKAPWEGVRARCRNEWSLFRSRLADAEQAY  375



>ref|XP_006645202.1| PREDICTED: uncharacterized protein LOC102718787 [Oryza brachyantha]
Length=400

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENG+  W+ V  RC  EW MF+TRL +AE  Y
Sbjct  328  PAHEKIGVVDSQWIVHQVVPSLGNQGMAENGRAPWEGVRARCRKEWGMFQTRLADAENAY  387

Query  182  NKSIGI  199
                GI
Sbjct  388  YLQKGI  393



>ref|XP_010029094.1| PREDICTED: uncharacterized protein LOC104419210 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029095.1| PREDICTED: uncharacterized protein LOC104419210 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55936.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
 gb|KCW55937.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
 gb|KCW55938.1| hypothetical protein EUGRSUZ_I01729 [Eucalyptus grandis]
Length=403

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG+ G+ E+GK  W+ V ERC  EWAMF+ R+ +AE+ Y
Sbjct  330  PAHEKIGVVDAQWIVHQGVPSLGNQGQPESGKAPWEGVRERCRREWAMFQERVASAERTY  389

Query  182  NKSIGI  199
              ++G+
Sbjct  390  FLAMGM  395



>ref|XP_011014025.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014026.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014027.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014028.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014029.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014030.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
 ref|XP_011014031.1| PREDICTED: uncharacterized protein LOC105117916 [Populus euphratica]
Length=399

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVDAQ + HQ   +LG  G+++ GK  W+ V ERC  EW MF+ R+ NAEK Y
Sbjct  330  PAHEKIGVVDAQWIIHQGVPSLGSQGQAQKGKAPWEGVRERCRKEWTMFQDRMTNAEKVY  389

Query  182  NKSI  193
             K++
Sbjct  390  YKAM  393



>gb|KHG25698.1| hypothetical protein F383_04429 [Gossypium arboreum]
Length=392

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S +GK  WK V ERC  EW++F+TR   AEK Y
Sbjct  324  PAHEKIGVVDSQWIVHQSVPSLGNQGESLDGKAPWKGVRERCKKEWSIFQTRFSRAEKAY  383

Query  182  NKSI  193
             K I
Sbjct  384  LKEI  387



>ref|XP_007044821.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00653.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=392

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+++NGK +W+ V ERC  EW +F+TR   AEK Y
Sbjct  324  PAHEKIGVVDSQWIVHQSVPSLGNQGEAQNGKAAWQGVRERCKKEWTVFQTRFSRAEKAY  383

Query  182  NKSI  193
             K +
Sbjct  384  LKEL  387



>gb|KHG21523.1| copii coat assembly sec16 [Gossypium arboreum]
Length=369

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVDAQ + HQ   +LG+ G++E G+  W+ V +RC  EW MF+ R+  AEK Y
Sbjct  295  PPHEKIGVVDAQWIVHQSVPSLGNQGEAEGGRAPWEGVRQRCRKEWTMFQDRMTTAEKAY  354

Query  182  NKSIGI  199
              S+GI
Sbjct  355  YASLGI  360



>ref|XP_011097369.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
 ref|XP_011097370.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
 ref|XP_011097371.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
 ref|XP_011097372.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
 ref|XP_011097373.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
 ref|XP_011097375.1| PREDICTED: uncharacterized protein LOC105176309 isoform X1 [Sesamum 
indicum]
Length=424

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E+G+  W+ V ERC  EWAMF  RL  AE+ Y
Sbjct  351  PAHEKIGVVDSQWIVHQTVPSLGNQGEAEDGRAPWEGVRERCRNEWAMFHDRLAIAERRY  410

Query  182  NKSIG  196
               +G
Sbjct  411  YAGLG  415



>ref|XP_004299222.1| PREDICTED: uncharacterized protein LOC101313310 [Fragaria vesca 
subsp. vesca]
Length=397

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+S+NGK  W+ V ERC  EW MF+ R+ NAE  Y
Sbjct  325  PAHEKIGVVDSQWIVHQTVPSLGNQGESQNGKAPWQGVRERCRKEWTMFQMRVANAESAY  384



>gb|EYU36175.1| hypothetical protein MIMGU_mgv1a0248541mg, partial [Erythranthe 
guttata]
Length=126

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            P HEKIGVVD+Q + HQ+  +LG+ G+SENGK  W+ V ERC  EWA F+ RL  A+K Y
Sbjct  60   PPHEKIGVVDSQWIVHQVIPSLGNQGESENGKAPWEGVRERCRNEWARFQDRLATADKAY  119



>gb|EEC72009.1| hypothetical protein OsI_04874 [Oryza sativa Indica Group]
Length=395

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG+ G +ENG+  W+ V  RC  EW MF+ RL +AEK Y
Sbjct  326  PAHEKIGVVDSQWIIHQVIPSLGNQGTAENGRTPWEGVRARCRKEWGMFQKRLADAEKAY  385

Query  182  NKSIGI  199
                GI
Sbjct  386  YLGKGI  391



>ref|XP_010556216.1| PREDICTED: uncharacterized protein LOC104825558 isoform X2 [Tarenaya 
hassleriana]
Length=400

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+  +GK  W+ V ERC  EW MF+ R+ NAEK+Y
Sbjct  330  PAHEKIGVVDSQWIVHQTVPSLGNQGEGRDGKAPWQGVRERCKREWTMFQNRMANAEKDY  389

Query  182  NKS  190
             K+
Sbjct  390  LKA  392



>ref|XP_010556214.1| PREDICTED: uncharacterized protein LOC104825558 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556215.1| PREDICTED: uncharacterized protein LOC104825558 isoform X1 [Tarenaya 
hassleriana]
Length=401

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G+  +GK  W+ V ERC  EW MF+ R+ NAEK+Y
Sbjct  331  PAHEKIGVVDSQWIVHQTVPSLGNQGEGRDGKAPWQGVRERCKREWTMFQNRMANAEKDY  390

Query  182  NKS  190
             K+
Sbjct  391  LKA  393



>ref|XP_004504126.1| PREDICTED: uncharacterized protein LOC101498964 [Cicer arietinum]
Length=394

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PA+EKIGVVD+Q + HQ   +LG+ G+S++G   W+ V ERC  EW MF++R+ +AE  Y
Sbjct  321  PAYEKIGVVDSQWIIHQSIPSLGNQGESKSGTAPWQGVRERCRKEWTMFQSRMASAENAY  380

Query  182  NKSIGI  199
             K++GI
Sbjct  381  YKAVGI  386



>ref|XP_006365731.1| PREDICTED: uncharacterized protein LOC102598936 [Solanum tuberosum]
Length=387

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ+  +LG  G SENGK  W+ V  RC  EW MF+ RL NA+K Y
Sbjct  319  PAHEKIGVVDSQWIVHQVIPSLGSQGSSENGKAPWEGVRVRCRNEWTMFQDRLANADKAY  378



>ref|XP_006338796.1| PREDICTED: uncharacterized protein LOC102581795 [Solanum tuberosum]
Length=394

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    PAHEKIGVVDAQPVFHQMKTTLGDGGKSENGKPSWKAVNERCHAEWAMFRTRLENAEKEY  181
            PAHEKIGVVD+Q + HQ   +LG+ G++E GK  W+ V ERC  EWAMF+ R+  AEK+Y
Sbjct  320  PAHEKIGVVDSQWIVHQTVPSLGNQGQAEKGKAPWEGVRERCKKEWAMFKERMAGAEKDY  379



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514307204152