BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49677_g1_i1 len=191 path=[169:0-190]

Length=191
                                                                      Score     E

ref|XP_009779527.1|  PREDICTED: uncharacterized protein LOC104228700  51.2    2e-06   
ref|XP_008456437.1|  PREDICTED: uncharacterized protein LOC103496379  51.6    2e-06   
ref|XP_009787259.1|  PREDICTED: uncharacterized protein LOC104235235  51.2    2e-06   
ref|XP_009628249.1|  PREDICTED: uncharacterized protein LOC104118653  51.2    2e-06   
gb|ABN08973.1|  Peptidase aspartic, catalytic; Polynucleotidyl tr...  53.9    2e-06   Medicago truncatula
ref|XP_009602205.1|  PREDICTED: uncharacterized protein LOC104097352  50.8    2e-06   
ref|XP_009794241.1|  PREDICTED: uncharacterized protein LOC104241033  50.4    3e-06   
ref|XP_009594169.1|  PREDICTED: uncharacterized protein LOC104090704  50.4    3e-06   
ref|XP_008463331.1|  PREDICTED: uncharacterized protein LOC103501512  50.4    5e-06   
ref|XP_009610136.1|  PREDICTED: uncharacterized protein LOC104103889  50.1    5e-06   
ref|XP_009616583.1|  PREDICTED: uncharacterized protein LOC104109084  49.7    6e-06   
ref|XP_009781339.1|  PREDICTED: uncharacterized protein LOC104230269  49.7    6e-06   
ref|XP_010451629.1|  PREDICTED: uncharacterized protein LOC104733779  50.1    6e-06   
ref|XP_009605616.1|  PREDICTED: uncharacterized protein LOC104100148  49.7    7e-06   
ref|XP_007022575.1|  Uncharacterized protein TCM_033346               48.9    9e-06   
ref|XP_009796389.1|  PREDICTED: uncharacterized protein LOC104242974  49.3    1e-05   
ref|XP_009773152.1|  PREDICTED: uncharacterized protein LOC104223416  49.3    1e-05   
ref|XP_009791346.1|  PREDICTED: uncharacterized protein LOC104238629  48.9    1e-05   
ref|XP_009773314.1|  PREDICTED: uncharacterized protein LOC104223530  48.9    1e-05   
ref|XP_010451638.1|  PREDICTED: uncharacterized protein LOC104733788  48.9    1e-05   
ref|XP_009602552.1|  PREDICTED: uncharacterized protein LOC104097655  48.5    1e-05   
ref|XP_009588289.1|  PREDICTED: uncharacterized protein LOC104085874  48.5    2e-05   
ref|XP_009788912.1|  PREDICTED: uncharacterized protein LOC104236639  48.5    2e-05   
ref|XP_009759589.1|  PREDICTED: uncharacterized protein LOC104212102  48.9    2e-05   
ref|XP_009607218.1|  PREDICTED: uncharacterized protein LOC104101475  48.1    2e-05   
ref|XP_009801440.1|  PREDICTED: uncharacterized protein LOC104247182  48.9    2e-05   
ref|XP_009804564.1|  PREDICTED: uncharacterized protein LOC104249781  48.1    2e-05   
ref|XP_009785929.1|  PREDICTED: uncharacterized protein LOC104234128  48.5    2e-05   
ref|XP_009792930.1|  PREDICTED: uncharacterized protein LOC104239892  48.1    2e-05   
ref|XP_009773902.1|  PREDICTED: uncharacterized protein LOC104224043  48.1    2e-05   
ref|XP_009600322.1|  PREDICTED: uncharacterized protein LOC104095811  50.1    2e-05   
ref|XP_008454691.1|  PREDICTED: uncharacterized protein LOC103495045  49.3    2e-05   
gb|ABW74585.1|  pol polyprotein                                       50.4    2e-05   Boechera divaricarpa
ref|XP_003595207.1|  Nucleosome assembly protein 1-like protein       50.8    3e-05   
ref|XP_009615247.1|  PREDICTED: uncharacterized protein LOC104107997  48.1    3e-05   
emb|CAN59961.1|  hypothetical protein VITISV_003173                   48.1    3e-05   Vitis vinifera
ref|XP_010456696.1|  PREDICTED: uncharacterized protein LOC104738177  50.1    3e-05   
ref|XP_008461532.1|  PREDICTED: uncharacterized protein LOC103500103  48.1    3e-05   
ref|XP_009776480.1|  PREDICTED: uncharacterized protein LOC104226237  48.1    3e-05   
ref|XP_010430901.1|  PREDICTED: uncharacterized protein LOC104715161  50.1    3e-05   
ref|XP_009622650.1|  PREDICTED: uncharacterized protein LOC104114017  47.8    3e-05   
ref|XP_009610225.1|  PREDICTED: uncharacterized protein LOC104103961  47.8    3e-05   
ref|XP_007208742.1|  hypothetical protein PRUPE_ppa015362mg           50.1    3e-05   
ref|XP_009608103.1|  PREDICTED: uncharacterized protein LOC104102166  50.4    3e-05   
ref|XP_010484842.1|  PREDICTED: uncharacterized protein LOC104763123  47.8    3e-05   
ref|XP_009776792.1|  PREDICTED: uncharacterized protein LOC104226477  47.4    3e-05   
ref|XP_008464761.1|  PREDICTED: uncharacterized protein LOC103502566  49.7    3e-05   
gb|KHN13683.1|  hypothetical protein glysoja_047643                   47.4    3e-05   
ref|XP_009803273.1|  PREDICTED: uncharacterized protein LOC104248667  47.4    3e-05   
ref|XP_009795206.1|  PREDICTED: uncharacterized protein LOC104241935  48.1    3e-05   
ref|XP_009784452.1|  PREDICTED: uncharacterized protein LOC104232864  47.8    4e-05   
ref|XP_009601129.1|  PREDICTED: uncharacterized protein LOC104096464  47.4    4e-05   
ref|XP_009592699.1|  PREDICTED: uncharacterized protein LOC104089492  48.1    4e-05   
ref|XP_009630048.1|  PREDICTED: uncharacterized protein LOC104120071  50.1    4e-05   
ref|XP_010104192.1|  G-type lectin S-receptor-like serine/threoni...  50.1    4e-05   
ref|XP_010419179.1|  PREDICTED: uncharacterized protein LOC104704856  49.7    5e-05   
ref|XP_008444029.1|  PREDICTED: uncharacterized protein LOC103487481  47.4    5e-05   
ref|XP_009799772.1|  PREDICTED: uncharacterized protein LOC104245798  49.7    5e-05   
ref|XP_009604881.1|  PREDICTED: uncharacterized protein LOC104099551  47.4    5e-05   
ref|XP_009800502.1|  PREDICTED: uncharacterized protein LOC104246389  47.0    5e-05   
ref|XP_009587335.1|  PREDICTED: uncharacterized protein LOC104085085  49.3    6e-05   
ref|XP_009628726.1|  PREDICTED: uncharacterized protein LOC104119037  47.0    6e-05   
ref|XP_010507018.1|  PREDICTED: uncharacterized protein LOC104783573  47.0    6e-05   
ref|XP_009769441.1|  PREDICTED: uncharacterized protein LOC104220299  47.0    6e-05   
ref|XP_007221201.1|  hypothetical protein PRUPE_ppa022451m1g          47.0    6e-05   
ref|XP_009630334.1|  PREDICTED: uncharacterized protein LOC104120293  46.6    6e-05   
ref|XP_010535308.1|  PREDICTED: uncharacterized protein LOC104810656  49.3    7e-05   
gb|ADN33760.1|  gag-pol polyprotein                                   47.4    7e-05   
ref|XP_009603210.1|  PREDICTED: uncharacterized protein LOC104098240  46.6    8e-05   
ref|XP_009614338.1|  PREDICTED: uncharacterized protein LOC104107283  48.9    8e-05   
ref|XP_009768227.1|  PREDICTED: uncharacterized protein LOC104219270  46.6    8e-05   
ref|XP_010470141.1|  PREDICTED: uncharacterized protein LOC104750095  47.8    9e-05   
ref|XP_008345390.1|  PREDICTED: uncharacterized protein LOC103408311  48.5    1e-04   
ref|XP_008451170.1|  PREDICTED: uncharacterized protein LOC103492548  46.6    1e-04   
gb|AAC64917.1|  gag-pol polyprotein                                   48.9    1e-04   Glycine max [soybeans]
ref|XP_009757329.1|  PREDICTED: uncharacterized protein LOC104210197  46.2    1e-04   
ref|XP_009597197.1|  PREDICTED: uncharacterized protein LOC104093183  46.2    1e-04   
gb|AAO73529.1|  gag-pol polyprotein                                   48.9    1e-04   Glycine max [soybeans]
ref|XP_009780581.1|  PREDICTED: uncharacterized protein LOC104229623  47.0    1e-04   
ref|XP_010326522.1|  PREDICTED: uncharacterized protein LOC104649326  46.2    1e-04   
ref|XP_009609275.1|  PREDICTED: uncharacterized protein LOC104103094  46.2    1e-04   
ref|XP_010530585.1|  PREDICTED: uncharacterized protein LOC104807152  48.1    1e-04   
ref|XP_010544441.1|  PREDICTED: uncharacterized protein LOC104817061  48.5    1e-04   
ref|XP_009607199.1|  PREDICTED: uncharacterized protein LOC104101459  48.1    1e-04   
ref|XP_009629117.1|  PREDICTED: uncharacterized protein LOC104119339  46.6    1e-04   
ref|XP_010463104.1|  PREDICTED: uncharacterized protein LOC104743752  48.5    1e-04   
ref|XP_010539141.1|  PREDICTED: uncharacterized protein LOC104813272  48.5    1e-04   
ref|XP_009620458.1|  PREDICTED: kinetochore-associated protein DS...  48.1    1e-04   
ref|XP_009619534.1|  PREDICTED: uncharacterized protein LOC104111527  46.2    1e-04   
ref|XP_009785493.1|  PREDICTED: uncharacterized protein LOC104233752  45.8    1e-04   
ref|XP_010546473.1|  PREDICTED: uncharacterized protein LOC104818552  48.5    1e-04   
ref|XP_009587381.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.5    1e-04   
ref|XP_009781902.1|  PREDICTED: uncharacterized protein LOC104230723  45.8    1e-04   
ref|XP_009759033.1|  PREDICTED: uncharacterized protein LOC104211645  45.8    1e-04   
emb|CAN74955.1|  hypothetical protein VITISV_043980                   47.0    1e-04   Vitis vinifera
ref|XP_009760634.1|  PREDICTED: uncharacterized protein LOC104212959  45.8    1e-04   
ref|XP_009595078.1|  PREDICTED: uncharacterized protein LOC104091450  46.6    2e-04   
ref|XP_010451492.1|  PREDICTED: uncharacterized protein LOC104733620  48.1    2e-04   
ref|XP_010485235.1|  PREDICTED: uncharacterized protein LOC104763577  45.4    2e-04   
ref|XP_009760665.1|  PREDICTED: uncharacterized protein LOC104212987  45.4    2e-04   
ref|XP_009782661.1|  PREDICTED: uncharacterized protein LOC104231371  46.2    2e-04   
ref|XP_009608406.1|  PREDICTED: uncharacterized protein LOC104102413  45.4    2e-04   
ref|XP_009784481.1|  PREDICTED: uncharacterized protein LOC104232893  46.2    2e-04   
ref|XP_007227415.1|  hypothetical protein PRUPE_ppb021890mg           47.0    2e-04   
ref|XP_009774807.1|  PREDICTED: uncharacterized protein LOC104224799  46.2    2e-04   
ref|XP_010424981.1|  PREDICTED: uncharacterized protein LOC104710127  47.8    2e-04   
ref|XP_009587490.1|  PREDICTED: uncharacterized protein LOC104085183  45.4    2e-04   
ref|XP_009618662.1|  PREDICTED: uncharacterized protein LOC104110811  47.8    2e-04   
ref|XP_009767601.1|  PREDICTED: uncharacterized protein LOC104218739  45.4    2e-04   
ref|XP_010451819.1|  PREDICTED: uncharacterized protein LOC104734001  47.8    2e-04   
ref|XP_010507406.1|  PREDICTED: uncharacterized protein LOC104784024  48.1    2e-04   
ref|XP_009629426.1|  PREDICTED: uncharacterized protein LOC104119582  45.8    2e-04   
ref|XP_009595633.1|  PREDICTED: uncharacterized protein LOC104091898  45.8    2e-04   
ref|XP_007226462.1|  hypothetical protein PRUPE_ppb017449mg           47.8    2e-04   
ref|XP_009786846.1|  PREDICTED: uncharacterized protein LOC104234899  45.8    2e-04   
ref|XP_009803925.1|  PREDICTED: uncharacterized protein LOC104249243  46.2    2e-04   
ref|XP_009778397.1|  PREDICTED: uncharacterized protein LOC104227780  45.1    2e-04   
ref|XP_009778567.1|  PREDICTED: uncharacterized protein LOC104227897  45.8    2e-04   
ref|XP_009787967.1|  PREDICTED: uncharacterized protein LOC104235839  45.1    2e-04   
ref|XP_007207691.1|  hypothetical protein PRUPE_ppa023772mg           47.4    3e-04   
ref|XP_007224570.1|  hypothetical protein PRUPE_ppb015931mg           47.8    3e-04   
ref|XP_006383600.1|  hypothetical protein POPTR_0005s20655g           45.8    3e-04   
ref|XP_009625995.1|  PREDICTED: uncharacterized protein LOC104116764  45.8    3e-04   
ref|XP_007224145.1|  hypothetical protein PRUPE_ppa016186mg           47.4    3e-04   
ref|XP_009606547.1|  PREDICTED: uncharacterized protein LOC104100885  47.4    3e-04   
ref|XP_009589311.1|  PREDICTED: uncharacterized protein LOC104086697  47.8    3e-04   
ref|XP_010424571.1|  PREDICTED: uncharacterized protein LOC104709699  47.4    3e-04   
ref|XP_008235681.1|  PREDICTED: spindle pole body component 110-like  47.4    3e-04   
gb|AAC69114.1|  putative gag-protease polyprotein                     47.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAO73527.1|  gag-pol polyprotein                                   47.8    3e-04   Glycine max [soybeans]
ref|XP_009758393.1|  PREDICTED: uncharacterized protein LOC104211092  44.7    3e-04   
ref|XP_007206206.1|  hypothetical protein PRUPE_ppa014977mg           47.4    3e-04   
emb|CAN73512.1|  hypothetical protein VITISV_028522                   46.6    3e-04   Vitis vinifera
ref|XP_009757540.1|  PREDICTED: uncharacterized protein LOC104210350  44.7    3e-04   
ref|XP_009623168.1|  PREDICTED: uncharacterized protein LOC104114420  45.4    3e-04   
ref|XP_009611094.1|  PREDICTED: uncharacterized protein LOC104104661  45.1    3e-04   
emb|CAN73575.1|  hypothetical protein VITISV_008297                   46.6    3e-04   Vitis vinifera
ref|XP_009779723.1|  PREDICTED: uncharacterized protein LOC104228873  44.7    3e-04   
ref|XP_010430957.1|  PREDICTED: uncharacterized protein LOC104715228  45.1    3e-04   
ref|XP_009780764.1|  PREDICTED: uncharacterized protein LOC104229760  44.7    3e-04   
ref|XP_009770614.1|  PREDICTED: uncharacterized protein LOC104221284  44.7    3e-04   
ref|XP_007199289.1|  hypothetical protein PRUPE_ppa022949mg           47.0    3e-04   
ref|XP_009763232.1|  PREDICTED: uncharacterized protein LOC104215178  45.1    4e-04   
ref|XP_009796921.1|  PREDICTED: uncharacterized protein LOC104243433  44.7    4e-04   
gb|KHN11521.1|  hypothetical protein glysoja_044670                   44.3    4e-04   
ref|XP_008793768.1|  PREDICTED: uncharacterized protein LOC103709990  46.2    4e-04   
ref|XP_007226466.1|  hypothetical protein PRUPE_ppb017830mg           47.0    4e-04   
ref|XP_010315791.1|  PREDICTED: uncharacterized protein LOC104645626  45.4    4e-04   
ref|XP_009615674.1|  PREDICTED: uncharacterized protein LOC104108362  47.0    4e-04   
ref|XP_009622915.1|  PREDICTED: uncharacterized protein LOC104114226  44.3    4e-04   
ref|XP_010089312.1|  Receptor-like protein 12                         47.4    4e-04   
ref|XP_007226901.1|  hypothetical protein PRUPE_ppa016308mg           47.0    4e-04   
ref|XP_010467026.1|  PREDICTED: uncharacterized protein LOC104747145  47.0    4e-04   
ref|XP_010315759.1|  PREDICTED: uncharacterized protein LOC104645601  44.7    4e-04   
ref|XP_008454684.1|  PREDICTED: uncharacterized protein LOC103495039  47.0    4e-04   
ref|XP_006491759.1|  PREDICTED: uncharacterized protein LOC102614994  46.6    5e-04   
ref|XP_009613803.1|  PREDICTED: uncharacterized protein LOC104106859  44.3    5e-04   
ref|XP_009629298.1|  PREDICTED: uncharacterized protein LOC104119483  44.3    5e-04   
ref|XP_007202912.1|  hypothetical protein PRUPE_ppa016140mg           46.6    5e-04   
ref|XP_006301613.1|  hypothetical protein CARUB_v10022054mg           44.3    5e-04   
ref|XP_009776955.1|  PREDICTED: uncharacterized protein LOC104226621  44.3    5e-04   
ref|XP_008385981.1|  PREDICTED: uncharacterized protein LOC103448501  46.2    5e-04   
ref|XP_009765657.1|  PREDICTED: uncharacterized protein LOC104217182  46.6    5e-04   
ref|XP_009623620.1|  PREDICTED: uncharacterized protein LOC104114794  46.2    5e-04   
gb|KHN35311.1|  hypothetical protein glysoja_044389                   43.9    5e-04   
ref|XP_010418555.1|  PREDICTED: uncharacterized protein LOC104704120  46.6    5e-04   
ref|XP_008464095.1|  PREDICTED: uncharacterized protein LOC103502061  46.2    5e-04   
ref|XP_009597682.1|  PREDICTED: uncharacterized protein LOC104093616  45.1    5e-04   
gb|AAO73521.1|  gag-pol polyprotein                                   47.0    6e-04   Glycine max [soybeans]
ref|XP_006296739.1|  hypothetical protein CARUB_v10014861mg           43.9    6e-04   
emb|CAN70892.1|  hypothetical protein VITISV_039825                   45.1    6e-04   Vitis vinifera
ref|XP_010327584.1|  PREDICTED: uncharacterized protein LOC104649747  43.9    6e-04   
ref|XP_009626801.1|  PREDICTED: uncharacterized protein LOC104117450  46.2    6e-04   
ref|NP_001235160.1|  gag-protease polyprotein                         46.6    6e-04   
ref|XP_010555772.1|  PREDICTED: uncharacterized protein LOC104825183  46.6    6e-04   
ref|XP_010480935.1|  PREDICTED: uncharacterized protein LOC104759742  46.6    6e-04   
ref|XP_010314541.1|  PREDICTED: uncharacterized protein LOC104645162  44.3    6e-04   
ref|XP_009776144.1|  PREDICTED: uncharacterized protein LOC104225967  44.3    6e-04   
gb|KFK34260.1|  hypothetical protein AALP_AA5G121900                  46.2    6e-04   
ref|XP_009625895.1|  PREDICTED: uncharacterized protein LOC104116691  44.3    7e-04   
ref|XP_009615743.1|  PREDICTED: uncharacterized protein LOC104108427  43.9    7e-04   
emb|CAN76159.1|  hypothetical protein VITISV_012002                   45.4    7e-04   Vitis vinifera
emb|CAN80972.1|  hypothetical protein VITISV_043375                   44.3    7e-04   Vitis vinifera
ref|XP_008390391.1|  PREDICTED: uncharacterized protein LOC103452643  45.8    7e-04   
ref|XP_008350021.1|  PREDICTED: uncharacterized protein LOC103413324  44.7    7e-04   
ref|XP_009758916.1|  PREDICTED: uncharacterized protein LOC104211543  45.1    7e-04   
ref|XP_009623422.1|  PREDICTED: uncharacterized protein LOC104114639  44.3    7e-04   
ref|XP_009607495.1|  PREDICTED: uncharacterized protein LOC104101702  43.9    7e-04   
ref|XP_008224126.1|  PREDICTED: uncharacterized protein LOC103323884  45.8    7e-04   
ref|XP_007207735.1|  hypothetical protein PRUPE_ppb023473mg           44.3    7e-04   
ref|XP_007220032.1|  hypothetical protein PRUPE_ppb016845mg           46.2    7e-04   
ref|XP_009599126.1|  PREDICTED: uncharacterized protein LOC104094837  44.7    7e-04   
ref|XP_010321939.1|  PREDICTED: uncharacterized protein LOC104647818  43.5    7e-04   
ref|XP_007010204.1|  Uncharacterized protein TCM_043614               43.5    8e-04   
ref|XP_009356290.1|  PREDICTED: retrovirus-related Pol polyprotei...  46.2    8e-04   
ref|XP_009594493.1|  PREDICTED: uncharacterized protein LOC104090973  45.4    8e-04   
ref|XP_008351642.1|  PREDICTED: uncharacterized protein LOC103415057  45.4    8e-04   
ref|XP_009618972.1|  PREDICTED: uncharacterized protein LOC104111075  43.9    8e-04   
ref|XP_009773204.1|  PREDICTED: uncharacterized protein LOC104223454  43.9    8e-04   
ref|XP_009588972.1|  PREDICTED: uncharacterized protein LOC104086429  45.8    8e-04   
ref|XP_010326235.1|  PREDICTED: uncharacterized protein LOC104649188  43.9    9e-04   
ref|XP_010431414.1|  PREDICTED: uncharacterized protein LOC104715730  45.8    0.001   
ref|XP_009628791.1|  PREDICTED: uncharacterized protein LOC104119083  43.9    0.001   
ref|XP_008387251.1|  PREDICTED: uncharacterized protein LOC103449700  45.4    0.001   
ref|XP_009605403.1|  PREDICTED: uncharacterized protein LOC104099972  45.8    0.001   
gb|KHN47581.1|  hypothetical protein glysoja_044196                   43.1    0.001   



>ref|XP_009779527.1| PREDICTED: uncharacterized protein LOC104228700 [Nicotiana sylvestris]
Length=117

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + +++   S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  63   YNMISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_008456437.1| PREDICTED: uncharacterized protein LOC103496379 [Cucumis melo]
Length=173

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+    + K +W+ LE  YEGTS VK S+ QL+   FE  RM EDE ++
Sbjct  93   FKLINSCSTAKEAWKTLEVAYEGTSKVKISRLQLITSKFEALRMTEDELVS  143



>ref|XP_009787259.1| PREDICTED: uncharacterized protein LOC104235235 [Nicotiana sylvestris]
Length=150

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  99   ISTCQSTKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  145



>ref|XP_009628249.1| PREDICTED: uncharacterized protein LOC104118653 [Nicotiana tomentosiformis]
Length=147

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  101  ISACQSTKEIWEALQTAHEGTTQVKQSKINMLTTEYELFRMKDDESI  147



>gb|ABN08973.1| Peptidase aspartic, catalytic; Polynucleotidyl transferase, Ribonuclease 
H fold [Medicago truncatula]
Length=972

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+   D  K +W+ L +T+EGTS VK S+ QL+   FE  +M EDETI
Sbjct  94   FRLIKKCDVAKDAWDILRTTHEGTSKVKSSRIQLLTTKFESLKMQEDETI  143



>ref|XP_009602205.1| PREDICTED: uncharacterized protein LOC104097352 [Nicotiana tomentosiformis]
Length=140

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  45   LVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            L++   S K  WE L++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  42   LISACQSAKKIWETLQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  89



>ref|XP_009794241.1| PREDICTED: uncharacterized protein LOC104241033 [Nicotiana sylvestris]
Length=136

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEALE+T+EGT+ VKQSK  ++  ++E FR+  DE+I
Sbjct  66   ISACQSAKEIWEALETTHEGTTQVKQSKIDMLTTEYELFRIKHDESI  112



>ref|XP_009594169.1| PREDICTED: uncharacterized protein LOC104090704 [Nicotiana tomentosiformis]
Length=152

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WE L++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSTKKIWEVLQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_008463331.1| PREDICTED: uncharacterized protein LOC103501512 [Cucumis melo]
Length=190

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+    +TK +W+ LE  YEGTS VK S  QL+   FE  +M EDE+++
Sbjct  93   FKLINSCTTTKEAWKILEVAYEGTSKVKISSLQLITSKFEVLKMTEDESVS  143



>ref|XP_009610136.1| PREDICTED: uncharacterized protein LOC104103889 [Nicotiana tomentosiformis]
Length=167

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++T+EGT+ VKQSK  ++  ++E F+M +DE+I
Sbjct  46   ISACHSAKEIWEALQTTHEGTTQVKQSKIDMLTTEYELFKMKDDESI  92



>ref|XP_009616583.1| PREDICTED: uncharacterized protein LOC104109084 [Nicotiana tomentosiformis]
Length=147

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_009781339.1| PREDICTED: uncharacterized protein LOC104230269 [Nicotiana sylvestris]
Length=170

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +    STK  WEAL++ ++GT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  71   ILACQSTKEIWEALQTVHKGTTQVKQSKIDMLTTEYELFRMKDDESI  117



>ref|XP_010451629.1| PREDICTED: uncharacterized protein LOC104733779 [Camelina sativa]
Length=186

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G  S K +WE L++ +EGT+SVK+++  ++  +FE  RM E E IT
Sbjct  99   FSLIQGCTSAKEAWEILQNIFEGTTSVKRTRLDILASEFENLRMYEFENIT  149



>ref|XP_009605616.1| PREDICTED: uncharacterized protein LOC104100148 [Nicotiana tomentosiformis]
Length=149

 Score = 49.7 bits (117),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WEAL++ +EGT+ VK+SK  ++   +E FRM +DE+I
Sbjct  66   ISACQSTKEIWEALQTAHEGTTQVKKSKIDMLTTKYELFRMKDDESI  112



>ref|XP_007022575.1| Uncharacterized protein TCM_033346 [Theobroma cacao]
 gb|EOY14100.1| Uncharacterized protein TCM_033346 [Theobroma cacao]
Length=98

 Score = 48.9 bits (115),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  57   IDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +   K  W+ LE+TYEGT+ VK+SK  L+ +DFE FR+ E E+I
Sbjct  31   VRECKEIWDTLETTYEGTNQVKESKIGLLPHDFELFRIREGESI  74



>ref|XP_009796389.1| PREDICTED: uncharacterized protein LOC104242974 [Nicotiana sylvestris]
Length=159

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +    S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  62   ILACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  108



>ref|XP_009773152.1| PREDICTED: uncharacterized protein LOC104223416 [Nicotiana sylvestris]
Length=162

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK++   ++ +D+E F M E E+I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTSKVKETHINILVHDYELFHMKEGESI  115



>ref|XP_009791346.1| PREDICTED: uncharacterized protein LOC104238629 [Nicotiana sylvestris]
Length=152

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F+M EDE+I
Sbjct  66   ISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTNEYELFKMKEDESI  112



>ref|XP_009773314.1| PREDICTED: uncharacterized protein LOC104223530 [Nicotiana sylvestris]
Length=138

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S    WEAL++T+EGT+ VKQ K  +V  ++E FRMN+D++I
Sbjct  66   ISACQSANEIWEALQTTHEGTTQVKQYKIDMVTTEYEFFRMNDDKSI  112



>ref|XP_010451638.1| PREDICTED: uncharacterized protein LOC104733788 [Camelina sativa]
Length=164

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L++   S + +W++LE+ +EGTSSVK++K  ++   FE  RM E ET+ 
Sbjct  85   FKLISQCVSAQKAWKSLENMFEGTSSVKRTKLDMLASQFENLRMEEKETVA  135



>ref|XP_009602552.1| PREDICTED: uncharacterized protein LOC104097655 [Nicotiana tomentosiformis]
Length=149

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WE L++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEPLQTAHEGTTQVKQSKIDMLTAEYELFRMKDDESI  112



>ref|XP_009588289.1| PREDICTED: uncharacterized protein LOC104085874 [Nicotiana tomentosiformis]
Length=112

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++++EGT+ VKQSK  ++  +++ FRM +DE+I
Sbjct  66   ISACQSAKEIWEALQTSHEGTTQVKQSKIDMLTTEYKLFRMKDDESI  112



>ref|XP_009788912.1| PREDICTED: uncharacterized protein LOC104236639, partial [Nicotiana 
sylvestris]
Length=141

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK++   ++ +D+E F M E E+I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTSKVKETHINMLVHDYELFLMKEGESI  115



>ref|XP_009759589.1| PREDICTED: uncharacterized protein LOC104212102 [Nicotiana sylvestris]
Length=184

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WE L++ +EGT+ VK+SKF ++  ++E FRM +DE+I
Sbjct  101  ISACQSAKKIWETLQTAHEGTTQVKKSKFDMLTTEYELFRMKDDESI  147



>ref|XP_009607218.1| PREDICTED: uncharacterized protein LOC104101475 [Nicotiana tomentosiformis]
Length=136

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+  +S K  WEAL++ +EGT+ VK+SK  ++  + E F+M EDE+I
Sbjct  63   FNRVSAFESAKEIWEALKTAHEGTTQVKKSKIDMLTAEHELFKMKEDESI  112



>ref|XP_009801440.1| PREDICTED: uncharacterized protein LOC104247182 [Nicotiana sylvestris]
Length=191

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            S K  WEAL+  +EGT+ VKQSK +++  ++E FRM +DE+I
Sbjct  71   SAKEIWEALQIAHEGTTQVKQSKIRMLTTEYELFRMQDDESI  112



>ref|XP_009804564.1| PREDICTED: uncharacterized protein LOC104249781 [Nicotiana sylvestris]
Length=129

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEALE  +EGT+ VKQSK  ++  ++E  RM +DE+I
Sbjct  66   ISACQSAKKIWEALEIAHEGTTQVKQSKIDMLTTEYELLRMKDDESI  112



>ref|XP_009785929.1| PREDICTED: uncharacterized protein LOC104234128 [Nicotiana sylvestris]
Length=171

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  45   LVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +++   S K  WEAL++++EGT+ VKQSK  ++  ++E F M +DE+I
Sbjct  65   MISACQSAKEIWEALQTSHEGTTQVKQSKIDMLTIEYELFIMKDDESI  112



>ref|XP_009792930.1| PREDICTED: uncharacterized protein LOC104239892 [Nicotiana sylvestris]
Length=163

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  W+A ++T+EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWKAFQTTHEGTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_009773902.1| PREDICTED: uncharacterized protein LOC104224043 [Nicotiana sylvestris]
Length=149

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F+M +DE+I
Sbjct  66   ISACQSAKEIWEALQTAHEGTTHVKQSKIYMLTTEYELFKMKDDESI  112



>ref|XP_009600322.1| PREDICTED: uncharacterized protein LOC104095811 [Nicotiana tomentosiformis]
Length=336

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ +KQSK  ++  ++E F+MNEDE+I
Sbjct  101  ISTCQSAKQIWEALQTAHEGTAQLKQSKIDMLTTEYELFKMNEDESI  147



>ref|XP_008454691.1| PREDICTED: uncharacterized protein LOC103495045 [Cucumis melo]
Length=228

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+   +STK  W+  E +YEGT+ VK S+ QLV   FE  +M++DE ++
Sbjct  43   FKLINSCNSTKEVWKIFEVSYEGTTKVKISRLQLVTSKFEALKMSKDEFVS  93



>gb|ABW74585.1| pol polyprotein [Boechera divaricarpa]
Length=551

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            V G+DS+K  WEA+++ + G   VK+++ Q + Y+FE  RMN+ ++I
Sbjct  77   VGGLDSSKAIWEAIKTRHLGAERVKEARLQTLTYEFERLRMNDSDSI  123



>ref|XP_003595207.1| Nucleosome assembly protein 1-like protein [Medicago truncatula]
Length=988

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+     TK  WE L++T+EGT+ V  S+ QL+  +FE  RMN DETI
Sbjct  577  FRLINTCIVTKDVWEILKTTHEGTAKVCMSRLQLLTTNFENLRMNYDETI  626



>ref|XP_009615247.1| PREDICTED: uncharacterized protein LOC104107997 [Nicotiana tomentosiformis]
Length=168

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            S K  WEAL+  +EGT+ VK+SK  ++  D+E FRM +DE+I
Sbjct  76   SAKEIWEALQIAHEGTTQVKKSKIDMLTTDYELFRMKDDESI  117



>emb|CAN59961.1| hypothetical protein VITISV_003173 [Vitis vinifera]
Length=174

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            +    STK  W  LE T+EGT+ VK+SK  L+ +++E F M E+ETI 
Sbjct  9    ICQCKSTKEIWRLLEITHEGTNQVKESKINLLVHNYELFSMKENETIV  56



>ref|XP_010456696.1| PREDICTED: uncharacterized protein LOC104738177 [Camelina sativa]
Length=460

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G  S K +WE L++ +EGT+SVK+++  ++  +FE  RM E E IT
Sbjct  98   FSLIQGCTSAKEAWEILQTIFEGTTSVKRTRLDILASEFENLRMYEFENIT  148



>ref|XP_008461532.1| PREDICTED: uncharacterized protein LOC103500103 [Cucumis melo]
Length=181

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+    + K +W+ LE  YEGTS++K S+ QL+   FE  +M +DE+++
Sbjct  93   FKLINSCTTAKEAWKILEVAYEGTSNMKISRLQLITSKFEALKMTKDESVS  143



>ref|XP_009776480.1| PREDICTED: uncharacterized protein LOC104226237 [Nicotiana sylvestris]
Length=174

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+
Sbjct  66   ISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDES  111



>ref|XP_010430901.1| PREDICTED: uncharacterized protein LOC104715161 [Camelina sativa]
Length=505

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G  S K +WE L++ +EGT+SVK+++  ++  +FE  RM E E IT
Sbjct  98   FSLIQGCTSAKEAWEILQNIFEGTTSVKRTRLDILASEFENLRMYEFENIT  148



>ref|XP_009622650.1| PREDICTED: uncharacterized protein LOC104114017 [Nicotiana tomentosiformis]
Length=122

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            S K  WEAL+  +EGT+ VK+SK  ++  ++E FRMN+DE+I
Sbjct  76   SAKEIWEALQIAHEGTTQVKKSKIDMLTTEYEFFRMNDDESI  117



>ref|XP_009610225.1| PREDICTED: uncharacterized protein LOC104103961 [Nicotiana tomentosiformis]
Length=149

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F+M ++E+I
Sbjct  66   ISACQSAKEKWEALQTAHEGTTQVKQSKIDMLTTEYELFKMKDNESI  112



>ref|XP_007208742.1| hypothetical protein PRUPE_ppa015362mg, partial [Prunus persica]
 gb|EMJ09941.1| hypothetical protein PRUPE_ppa015362mg, partial [Prunus persica]
Length=450

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT+++K +K Q+    FE   MN+DET +
Sbjct  70   FEYISGCDTSKEAWDILQVTHEGTNTIKGAKLQMHTLQFETLMMNDDETFS  120



>ref|XP_009608103.1| PREDICTED: uncharacterized protein LOC104102166 [Nicotiana tomentosiformis]
Length=858

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 11/59 (19%)
 Frame = +3

Query  45   LVAGID-----------STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            LV GID           S K  WEAL+  +EGT+ VKQSK  ++  ++E FRM EDE+I
Sbjct  54   LVCGIDPDEYNKISACQSAKEIWEALQIAHEGTTQVKQSKIDMLTTEYELFRMKEDESI  112



>ref|XP_010484842.1| PREDICTED: uncharacterized protein LOC104763123 [Camelina sativa]
Length=165

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L++   S + +W++LE+ +EGTSSVK+ K  ++   FE  RM E ET+ 
Sbjct  85   FELISQCVSAQKAWKSLENMFEGTSSVKRKKLDMLASQFENLRMEEKETVA  135



>ref|XP_009776792.1| PREDICTED: uncharacterized protein LOC104226477 [Nicotiana sylvestris]
Length=115

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK++   ++ +D+E F M E ++I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTSKVKETHINMLVHDYELFSMKEGKSI  115



>ref|XP_008464761.1| PREDICTED: uncharacterized protein LOC103502566 [Cucumis melo]
Length=392

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+      K +WE LE  YEGTS++K S+ Q++   F+  +M EDETI 
Sbjct  231  FKLINTYKFAKAAWEILEVAYEGTSNIKMSRMQILTSHFKALKMEEDETIA  281



>gb|KHN13683.1| hypothetical protein glysoja_047643, partial [Glycine soja]
Length=90

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            V+   S K  W+ L+ T+EGT+ VK+S+   + +++E FRMN +E+I
Sbjct  7    VSNCKSAKDMWDTLQVTHEGTTDVKRSRINTLTHEYELFRMNANESI  53



>ref|XP_009803273.1| PREDICTED: uncharacterized protein LOC104248667 [Nicotiana sylvestris]
Length=122

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEALE+T+E T+ VKQSK  ++  ++E FRM +DE+I
Sbjct  76   ISTCQSAKEIWEALETTHEETTQVKQSKIDMLTTEYELFRMKDDESI  122



>ref|XP_009795206.1| PREDICTED: uncharacterized protein LOC104241935 [Nicotiana sylvestris]
Length=184

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  51   AGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +   S K  WEAL++++EGT+ VKQSK  ++  ++E F+M EDE+I
Sbjct  102  SACQSAKEIWEALQTSHEGTTQVKQSKIDMLTAEYELFKMKEDESI  147



>ref|XP_009784452.1| PREDICTED: uncharacterized protein LOC104232864 [Nicotiana sylvestris]
Length=164

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK+    ++ +D+E F M E E+I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTSKVKEIHINMLVHDYELFSMKEGESI  115



>ref|XP_009601129.1| PREDICTED: uncharacterized protein LOC104096464 [Nicotiana tomentosiformis]
Length=147

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++    TK  WEAL++T+EGT+ VKQSK  ++   +E  +M EDE+I
Sbjct  101  ISACQCTKEIWEALKTTHEGTTQVKQSKIDMLTTVYELLKMKEDESI  147



>ref|XP_009592699.1| PREDICTED: uncharacterized protein LOC104089492 [Nicotiana tomentosiformis]
Length=200

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++     K  WEAL++T+EGT+ VKQSK  ++   +E FRM +DE+I
Sbjct  101  ISACQFAKEIWEALQTTHEGTTQVKQSKINMLTTKYELFRMKDDESI  147



>ref|XP_009630048.1| PREDICTED: uncharacterized protein LOC104120071 [Nicotiana tomentosiformis]
Length=776

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK +++  ++E FRM +DE+I
Sbjct  79   ISACQSAKEIWEALQTAHEGTTQVKQSKIEMLTTEYELFRMKDDESI  125



>ref|XP_010104192.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
 gb|EXB99124.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
Length=673

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L++  +  K +WE L+ T+EGT++++ SK Q++   FE  RM EDE I+
Sbjct  612  FKLISTCEIAKDAWETLQMTHEGTATMRLSKLQILTTRFENLRMQEDEIIS  662



>ref|XP_010419179.1| PREDICTED: uncharacterized protein LOC104704856 [Camelina sativa]
Length=619

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+ G  S K +W+ L+ ++EGTSSVK+++  ++   FE  +M  DETI
Sbjct  91   FKLIQGCKSAKQAWDILQQSHEGTSSVKRTRLDMLATQFECLKMAPDETI  140



>ref|XP_008444029.1| PREDICTED: uncharacterized protein LOC103487481 [Cucumis melo]
Length=166

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+    + K +W+ LE  YEGTS VK  + QL+   FE  +M EDE+++
Sbjct  93   FKLINSCTTAKEAWKILEVAYEGTSKVKIFRLQLITSKFEALKMTEDESVS  143



>ref|XP_009799772.1| PREDICTED: uncharacterized protein LOC104245798 [Nicotiana sylvestris]
Length=470

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK++   ++ +D+E F+M E E+I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTSKVKETHINMLVHDYELFQMKEGESI  115



>ref|XP_009604881.1| PREDICTED: uncharacterized protein LOC104099551 [Nicotiana tomentosiformis]
Length=173

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL + + GT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEALHTAHNGTTRVKQSKIDMLITEYELFRMKDDESI  112



>ref|XP_009800502.1| PREDICTED: uncharacterized protein LOC104246389 [Nicotiana sylvestris]
Length=162

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WEAL++ ++GT+ VKQSK  ++  ++E FRM ++E I
Sbjct  65   ISACQSTKEIWEALQTAHKGTTQVKQSKIDMLTTEYELFRMKDNEFI  111



>ref|XP_009587335.1| PREDICTED: uncharacterized protein LOC104085085 [Nicotiana tomentosiformis]
Length=436

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGT+ VK+++  ++ +D+E F+M E E+I
Sbjct  69   ISSCDTTKEMWDKLEVTYEGTNKVKETRINMLVHDYELFQMKEGESI  115



>ref|XP_009628726.1| PREDICTED: uncharacterized protein LOC104119037 [Nicotiana tomentosiformis]
Length=164

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EG + VKQSK  ++  ++E FRM +DE+I
Sbjct  81   ISACQSVKEIWEALQIAHEGITQVKQSKIDMLTTEYELFRMKDDESI  127



>ref|XP_010507018.1| PREDICTED: uncharacterized protein LOC104783573 [Camelina sativa]
Length=163

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+ G  S K +W+ L+ ++EGTSSVK+++  L+   FE  +M  D TI
Sbjct  94   FKLIQGCKSAKQAWDILQQSHEGTSSVKRTRLDLLATQFECLKMALDVTI  143



>ref|XP_009769441.1| PREDICTED: uncharacterized protein LOC104220299 [Nicotiana sylvestris]
Length=152

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +D++I
Sbjct  101  ISTCQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDKSI  147



>ref|XP_007221201.1| hypothetical protein PRUPE_ppa022451m1g, partial [Prunus persica]
 gb|EMJ22400.1| hypothetical protein PRUPE_ppa022451m1g, partial [Prunus persica]
Length=150

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEAWDILQVTHEGTDAVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_009630334.1| PREDICTED: uncharacterized protein LOC104120293 [Nicotiana tomentosiformis]
Length=136

 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ L+ TYEGTS VK+++  L+ +D+E F+M E E+I
Sbjct  69   ISSYDTAKEMWDKLKVTYEGTSKVKETRINLLVHDYELFQMKEGESI  115



>ref|XP_010535308.1| PREDICTED: uncharacterized protein LOC104810656 [Tarenaya hassleriana]
Length=588

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  + G ++ K +W+ LE  +EGTS VK+++  ++   FE  RM +DE++
Sbjct  93   FEQIQGCETAKDAWDTLELIHEGTSKVKRNRLNMIDLQFERLRMGDDESV  142



>gb|ADN33760.1| gag-pol polyprotein [Cucumis melo subsp. melo]
Length=198

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  +    +TK +W  LE + EGTS VK S+ QL+   FE  +M+EDE+++
Sbjct  93   FKPIHSCSTTKEAWSILEGSCEGTSKVKISRLQLITSKFEALKMSEDESVS  143



>ref|XP_009603210.1| PREDICTED: uncharacterized protein LOC104098240 [Nicotiana tomentosiformis]
Length=133

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  57   IDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            I S K  WE L++ +EGT+ VKQSK  ++  ++E F+M EDE+I
Sbjct  53   ILSAKKIWEDLQTAHEGTTQVKQSKIDMLTTEYELFKMKEDESI  96



>ref|XP_009614338.1| PREDICTED: uncharacterized protein LOC104107283 [Nicotiana tomentosiformis]
Length=531

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            V  I S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM  DE+I
Sbjct  50   VKKILSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKNDESI  96



>ref|XP_009768227.1| PREDICTED: uncharacterized protein LOC104219270 [Nicotiana sylvestris]
Length=143

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEG S VK++   ++ +D+E F M E E+I
Sbjct  69   ISSCDTTKEIWDKLEVTYEGISKVKETHINMLVHDYELFSMKEGESI  115



>ref|XP_010470141.1| PREDICTED: uncharacterized protein LOC104750095 [Camelina sativa]
 ref|XP_010470142.1| PREDICTED: uncharacterized protein LOC104750095 [Camelina sativa]
 ref|XP_010470143.1| PREDICTED: uncharacterized protein LOC104750095 [Camelina sativa]
Length=253

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ L+ ++EG S+VK+++   +   FE  RM+ +ETI+
Sbjct  94   FKLVQGCESAKDAWDILQKSHEGNSNVKRTRLDQLASQFEVLRMDPEETIS  144



>ref|XP_008345390.1| PREDICTED: uncharacterized protein LOC103408311 [Malus domestica]
Length=476

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP +A  ++ KG+WE L+  Y G + V++ K Q ++ DFE  RM E+E +
Sbjct  89   FPRIANEETAKGAWEVLQQEYRGDTKVRKVKLQSLRRDFEYTRMRENELL  138



>ref|XP_008451170.1| PREDICTED: uncharacterized protein LOC103492548 [Cucumis melo]
Length=178

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+      K +W+ LE  YEGTS VK S+ Q++    E  +M ED+TI+
Sbjct  94   FKLINTCTPVKEAWDILEVVYEGTSKVKTSQLQILMSQIEGMKMREDQTIS  144



>gb|AAC64917.1| gag-pol polyprotein [Glycine max]
Length=1550

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+      K +WE L++T+EGTS VK S+ QL+   FE  +M E+E I
Sbjct  69   FRLINTCTVAKDAWEILKTTHEGTSKVKMSRLQLLATKFENLKMKEEECI  118



>ref|XP_009757329.1| PREDICTED: uncharacterized protein LOC104210197 [Nicotiana sylvestris]
Length=156

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  ++TK  W+ LE TYEGT+ VK++   ++ +D+E F+M E E+I
Sbjct  26   ISSCNTTKEMWDKLEVTYEGTNKVKETHINMLVHDYELFQMKEGESI  72



>ref|XP_009597197.1| PREDICTED: uncharacterized protein LOC104093183 [Nicotiana tomentosiformis]
Length=132

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
              K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  91   CAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  132



>gb|AAO73529.1| gag-pol polyprotein [Glycine max]
Length=1577

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+      K +WE L++T+EGTS VK S+ QL+   FE  +M E+E I
Sbjct  96   FRLINTCTVAKDAWEILKTTHEGTSKVKMSRLQLLATKFENLKMKEEECI  145



>ref|XP_009780581.1| PREDICTED: uncharacterized protein LOC104229623 [Nicotiana sylvestris]
Length=190

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE  Y+GTS+VK++   ++ +D+E F M E E+I
Sbjct  69   ISNCDTTKKMWDTLEVAYKGTSNVKETHINMLVHDYELFSMKEGESI  115



>ref|XP_010326522.1| PREDICTED: uncharacterized protein LOC104649326 [Solanum lycopersicum]
Length=160

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + L++  +S K  W+ L++TYEGT  +++SK  L    FE+F MN+ E I
Sbjct  79   YDLISSCESAKEIWDMLKTTYEGTEEIRKSKLDLFSTKFEDFTMNDGELI  128



>ref|XP_009609275.1| PREDICTED: uncharacterized protein LOC104103094 [Nicotiana tomentosiformis]
Length=137

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +   D  K  W+ LE TYEGTS VK+ +  L  +D+E F++ +DE+I
Sbjct  64   ILNCDIVKEMWDKLEVTYEGTSKVKKIRIHLFIHDYELFQIKKDESI  110



>ref|XP_010530585.1| PREDICTED: uncharacterized protein LOC104807152 [Tarenaya hassleriana]
Length=365

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  + G  S K +W+ALE  +EGTSSVK+++  L+++ F   +M E+E++
Sbjct  93   FKQIQGCKSAKEAWDALELIHEGTSSVKRTRRDLIKHQFNMLQMGENESV  142



>ref|XP_010544441.1| PREDICTED: uncharacterized protein LOC104817061 [Tarenaya hassleriana]
Length=722

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  + G  S K +W+ALE  +EGTSSVK+++  L+++ F   +M E+E++
Sbjct  93   FKQIQGCKSAKEAWDALELIHEGTSSVKRTRRDLIKHQFNMLQMGENESV  142



>ref|XP_009607199.1| PREDICTED: uncharacterized protein LOC104101459 [Nicotiana tomentosiformis]
Length=336

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGT+ VK++   ++ +D+E F+M E E+I
Sbjct  26   ISSCDTTKEMWDKLEVTYEGTNKVKKTHINILVHDYELFQMKEGESI  72



>ref|XP_009629117.1| PREDICTED: uncharacterized protein LOC104119339 [Nicotiana tomentosiformis]
Length=187

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EGT  VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEALKIAHEGTIQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_010463104.1| PREDICTED: uncharacterized protein LOC104743752 [Camelina sativa]
Length=635

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+ G  S K  W+ L+ ++EGTS+VK+++  ++   FE  +M +DETI
Sbjct  94   FKLIQGCKSAKQVWDILQQSHEGTSTVKRTRLDMLATQFECLKMAQDETI  143



>ref|XP_010539141.1| PREDICTED: uncharacterized protein LOC104813272 [Tarenaya hassleriana]
Length=725

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  + G ++ K +W+ LE  +EGTS VK+++  ++   FE  RM +DE++
Sbjct  93   FEQIQGCETAKDAWDTLELIHEGTSKVKRNRLDMIDLQFERLRMGDDESV  142



>ref|XP_009620458.1| PREDICTED: kinetochore-associated protein DSN1-like [Nicotiana 
tomentosiformis]
Length=493

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            STK  WEAL++ +EGT+ VKQS   ++  ++E F+MNED++I
Sbjct  50   STKEIWEALQTAHEGTTKVKQSIINMLTTEYELFKMNEDKSI  91



>ref|XP_009619534.1| PREDICTED: uncharacterized protein LOC104111527 [Nicotiana tomentosiformis]
Length=165

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            V+  D+    W+ LE TYEG S VK+++  L+ +D+E F+M E E+I
Sbjct  103  VSSCDTANEMWDKLEVTYEGNSKVKETRINLLVHDYELFQMKEGESI  149



>ref|XP_009785493.1| PREDICTED: uncharacterized protein LOC104233752 [Nicotiana sylvestris]
Length=148

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +E T+ V QSK  ++  D+E FRM +DE I
Sbjct  65   ISTCQSAKKIWEALQTAHERTTQVNQSKIDMLITDYELFRMKDDEPI  111



>ref|XP_010546473.1| PREDICTED: uncharacterized protein LOC104818552, partial [Tarenaya 
hassleriana]
Length=793

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  + G  S K +W+ALE  +EGTSSVK+++  L+++ F   +M E+E++
Sbjct  65   FKQIQGCKSAKEAWDALELIHEGTSSVKRTRRDLIKHQFNMLQMGENESV  114



>ref|XP_009587381.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104085130 
[Nicotiana tomentosiformis]
Length=2420

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  451  ISACQSAKEIWEALQMAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  497



>ref|XP_009781902.1| PREDICTED: uncharacterized protein LOC104230723 [Nicotiana sylvestris]
Length=147

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            S K  WEAL++ +EGT+ VKQ+K  ++  ++E F+M EDE+I
Sbjct  55   SAKEIWEALQTAHEGTTQVKQAKTDMLTTEYELFKMKEDESI  96



>ref|XP_009759033.1| PREDICTED: uncharacterized protein LOC104211645 [Nicotiana sylvestris]
Length=155

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++++EG + VKQSK  ++  +++ F+M +DE+I
Sbjct  66   ISACQSVKEIWEALQTSHEGINQVKQSKIDMLPIEYKLFKMKDDESI  112



>emb|CAN74955.1| hypothetical protein VITISV_043980 [Vitis vinifera]
Length=224

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            +    S K  W  LE T+EGT+ VK+SK  L+ +++E F MNE ETI 
Sbjct  9    ICQCKSAKEIWRLLEITHEGTNQVKESKINLLVHNYELFSMNETETIV  56



>ref|XP_009760634.1| PREDICTED: uncharacterized protein LOC104212959 [Nicotiana sylvestris]
Length=131

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +  ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F M  DE+I
Sbjct  45   YNCISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYELFNMEYDESI  94



>ref|XP_009595078.1| PREDICTED: uncharacterized protein LOC104091450 [Nicotiana tomentosiformis]
Length=206

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            ++   S K  WEAL++ YEGT+ VK+SK  ++  ++E F+M EDE 
Sbjct  101  ISACQSAKEIWEALQTAYEGTTQVKESKIDMLTTEYELFKMKEDEP  146



>ref|XP_010451492.1| PREDICTED: uncharacterized protein LOC104733620 [Camelina sativa]
Length=471

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ L+ T+EG SSVK+++   +   FE  RM+ +ETI+
Sbjct  151  FKLVQGCESAKEAWDILQKTHEGNSSVKRTRLDQLASQFEVLRMDPEETIS  201



>ref|XP_010485235.1| PREDICTED: uncharacterized protein LOC104763577 [Camelina sativa]
Length=136

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  33   K*FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            K F L+ G ++ K +W+ L+  YEGTS V+ S+  ++   FE  RM E E+I+
Sbjct  64   KQFELIQGCETAKEAWDILQIQYEGTSKVQSSRKDMLASRFENLRMEEHESIS  116



>ref|XP_009760665.1| PREDICTED: uncharacterized protein LOC104212987 [Nicotiana sylvestris]
Length=112

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   WEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            WEAL++ +EGT+ VKQSK  ++  ++  FRM +DE+I
Sbjct  76   WEALQTAHEGTTQVKQSKIDMLTIEYRLFRMKDDESI  112



>ref|XP_009782661.1| PREDICTED: uncharacterized protein LOC104231371 [Nicotiana sylvestris]
Length=198

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++T+EGT+ VKQSK  ++  ++E  ++ +DE+I
Sbjct  101  ISACQSVKDIWEALQTTHEGTTQVKQSKIDMLTTEYELLKIKDDESI  147



>ref|XP_009608406.1| PREDICTED: uncharacterized protein LOC104102413 [Nicotiana tomentosiformis]
Length=149

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F M +DE+I
Sbjct  66   ISACQSAKEIWEALQTAHEGTTQVKQSKIGMLTTEYELFIMKDDESI  112



>ref|XP_009784481.1| PREDICTED: uncharacterized protein LOC104232893 [Nicotiana sylvestris]
Length=184

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ ++GT+ VKQ+K  ++  ++E FRM +DE+I
Sbjct  101  ISACQSAKEIWEALQTKHDGTTQVKQTKIDMLTSEYEFFRMKDDESI  147



>ref|XP_007227415.1| hypothetical protein PRUPE_ppb021890mg, partial [Prunus persica]
 gb|EMJ28614.1| hypothetical protein PRUPE_ppb021890mg, partial [Prunus persica]
Length=261

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  174  FEYISGCDTSKRAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  224



>ref|XP_009774807.1| PREDICTED: uncharacterized protein LOC104224799 [Nicotiana sylvestris]
Length=191

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + +++   S    WEAL++ +EGT+ VKQS+  ++  ++E FRM ++E+I
Sbjct  63   YNMISACQSANEIWEALQTAHEGTTQVKQSQIDMLTIEYELFRMKDNESI  112



>ref|XP_010424981.1| PREDICTED: uncharacterized protein LOC104710127 [Camelina sativa]
Length=382

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ L+ ++EG SSVK+++   +   FE  RM+ +ETI+
Sbjct  58   FKLVQGCESAKKAWDILQKSHEGNSSVKRTRLDQLASQFEVLRMDPEETIS  108



>ref|XP_009587490.1| PREDICTED: uncharacterized protein LOC104085183 [Nicotiana tomentosiformis]
Length=151

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + +++   S K  WEAL+  +  T+ VKQSK  ++  ++E FRM +DE+I
Sbjct  63   YNIISACQSAKEIWEALQMAHRVTTQVKQSKIDMLTTEYEPFRMKDDESI  112



>ref|XP_009618662.1| PREDICTED: uncharacterized protein LOC104110811 [Nicotiana tomentosiformis]
Length=468

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ L+ TYEGT+ VKQ++  ++ +D+E F+M E+E+I
Sbjct  61   ISSYDTAKEMWDKLKVTYEGTNKVKQTRINMLVHDYELFQMKEEESI  107



>ref|XP_009767601.1| PREDICTED: uncharacterized protein LOC104218739 [Nicotiana sylvestris]
Length=150

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D  K  W+ LE TYEGTS VK++   ++ +D+E F+M E E+I
Sbjct  103  ISSCDIAKEMWDKLEVTYEGTSKVKETHINMLVHDYEFFQMKEGESI  149



>ref|XP_010451819.1| PREDICTED: uncharacterized protein LOC104734001 [Camelina sativa]
Length=451

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ L+ T+EG SSVK+++   +   FE  RM+ +ETI+
Sbjct  57   FKLVQGCESAKDAWDILQKTHEGNSSVKRTRLDQLASQFEVLRMDPEETIS  107



>ref|XP_010507406.1| PREDICTED: uncharacterized protein LOC104784024 [Camelina sativa]
Length=779

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G  S K +WE L++ +EGT+SVK++   ++  +FE  RM E E IT
Sbjct  98   FSLIQGCTSAKEAWEILQTIFEGTTSVKRTWLDILASEFENIRMYEFENIT  148



>ref|XP_009629426.1| PREDICTED: uncharacterized protein LOC104119582 [Nicotiana tomentosiformis]
Length=184

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  + E F+M +DE+I
Sbjct  101  ISSCQSAKEIWEALQTAHEGTTQVKQSKIDMLTTECELFKMKDDESI  147



>ref|XP_009595633.1| PREDICTED: uncharacterized protein LOC104091898 [Nicotiana tomentosiformis]
Length=173

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ LE TYEGT  VK++   ++ +D+E F+M E E+I
Sbjct  69   ISNCDTAKEMWDKLEVTYEGTGKVKETHINMLVHDYELFQMKEGESI  115



>ref|XP_007226462.1| hypothetical protein PRUPE_ppb017449mg [Prunus persica]
 gb|EMJ27661.1| hypothetical protein PRUPE_ppb017449mg [Prunus persica]
Length=522

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  41   FEYISGCDTSKEAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  91



>ref|XP_009786846.1| PREDICTED: uncharacterized protein LOC104234899 [Nicotiana sylvestris]
Length=173

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D  K  W+ LE TYEGTS VK++   ++ +D+E F M E E+I
Sbjct  69   ISSCDIAKEMWDKLEVTYEGTSKVKETHINMLVHDYELFSMKEGESI  115



>ref|XP_009803925.1| PREDICTED: uncharacterized protein LOC104249243 [Nicotiana sylvestris]
Length=218

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E F M EDE I
Sbjct  101  ISACQSAKEIWEALQTAHEGTTQVKQSKIDILTTEYELFEMKEDEYI  147



>ref|XP_009778397.1| PREDICTED: uncharacterized protein LOC104227780 [Nicotiana sylvestris]
Length=144

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  60   DSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            D  K  WEA+++ +EGT+ VKQSK  ++   +E F+M +DE+I
Sbjct  40   DRNKEIWEAVQTAHEGTTQVKQSKIDMLTTKYELFKMKDDESI  82



>ref|XP_009778567.1| PREDICTED: uncharacterized protein LOC104227897 [Nicotiana sylvestris]
Length=180

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  ++ K  WEAL++ +EG + VKQSK  ++  ++E FRM +DE+I
Sbjct  97   ISSCETAKEIWEALQTAHEGITQVKQSKIDMLATEYEFFRMMDDESI  143



>ref|XP_009787967.1| PREDICTED: uncharacterized protein LOC104235839 [Nicotiana sylvestris]
Length=149

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   STK  WEAL++ +E T+ VKQSK  ++   +E FRM  DE+I
Sbjct  66   ISSCQSTKEIWEALQTAHEETTQVKQSKIDMLTTAYELFRMKGDESI  112



>ref|XP_007207691.1| hypothetical protein PRUPE_ppa023772mg, partial [Prunus persica]
 gb|EMJ08890.1| hypothetical protein PRUPE_ppa023772mg, partial [Prunus persica]
Length=526

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEAWDILQVTHEGTDAVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_007224570.1| hypothetical protein PRUPE_ppb015931mg [Prunus persica]
 gb|EMJ25769.1| hypothetical protein PRUPE_ppb015931mg [Prunus persica]
Length=761

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  70   FEYISGCDTSKEAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  120



>ref|XP_006383600.1| hypothetical protein POPTR_0005s20655g [Populus trichocarpa]
 gb|ERP61397.1| hypothetical protein POPTR_0005s20655g [Populus trichocarpa]
Length=197

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L++   + +  W ALE T+EGT+ VK+SK  ++ + +E F+M  +E+IT
Sbjct  66   FNLISSFKNARNIWHALEVTHEGTNQVKESKIDMLIHQYELFKMLPNESIT  116



>ref|XP_009625995.1| PREDICTED: uncharacterized protein LOC104116764 [Nicotiana tomentosiformis]
Length=198

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +E T+ VKQSK  +++ ++E FRM +DE+I
Sbjct  101  ISACQSAKEIWEALQTAHERTTQVKQSKIDMLKTEYELFRMKDDESI  147



>ref|XP_007224145.1| hypothetical protein PRUPE_ppa016186mg, partial [Prunus persica]
 gb|EMJ25344.1| hypothetical protein PRUPE_ppa016186mg, partial [Prunus persica]
Length=707

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEAWDILQVTHEGTDAVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_009606547.1| PREDICTED: uncharacterized protein LOC104100885 [Nicotiana tomentosiformis]
Length=455

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGTS VK++   ++ +D+E F++ E E+I
Sbjct  26   ISSCDTTKEMWDKLEVTYEGTSKVKETHINMLVHDYEFFQLKEGESI  72



>ref|XP_009589311.1| PREDICTED: uncharacterized protein LOC104086697 [Nicotiana tomentosiformis]
Length=816

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EG + VKQSK  +++ ++E FRM +DE+I
Sbjct  71   ISACQSAKEIWEALQIAHEGNTQVKQSKIDMLKTEYELFRMKDDESI  117



>ref|XP_010424571.1| PREDICTED: uncharacterized protein LOC104709699 [Camelina sativa]
Length=654

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ LE T+EG SSVK+++   +   FE  RM+ +E+I+
Sbjct  103  FKLVQGCESAKDAWDILEKTHEGNSSVKRTRLDQLASQFEVLRMDPEESIS  153



>ref|XP_008235681.1| PREDICTED: spindle pole body component 110-like [Prunus mume]
Length=594

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++  +++K +W+ L+ TYEGT++VK+SK Q     FE  RM EDET +
Sbjct  109  FSNISNCETSKEAWDILQVTYEGTNAVKESKLQRYVTQFEIIRMEEDETFS  159



>gb|AAC69114.1| putative gag-protease polyprotein [Arabidopsis thaliana]
Length=627

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G  S K +W+ L+ ++EGTSSVK+++   +   FE  +M  DE I 
Sbjct  75   FKLIQGCKSAKQAWDTLQKSHEGTSSVKRTRLDHIATQFEYLKMEPDEKIV  125



>gb|AAO73527.1| gag-pol polyprotein [Glycine max]
Length=1576

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+      K +WE L+ T+EGTS VK S+ QL+   FE  +M E+E I
Sbjct  96   FRLINTCTVAKDAWEILKITHEGTSKVKMSRLQLLATKFENLKMKEEECI  145



>ref|XP_009758393.1| PREDICTED: uncharacterized protein LOC104211092 [Nicotiana sylvestris]
Length=122

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            ++  +  K  WEAL++T+E T+ VKQSK  ++  ++E FRM +DE+
Sbjct  71   ISSCEIAKEIWEALQTTHERTTQVKQSKIDMLTTEYEIFRMKDDES  116



>ref|XP_007206206.1| hypothetical protein PRUPE_ppa014977mg [Prunus persica]
 gb|EMJ07405.1| hypothetical protein PRUPE_ppa014977mg [Prunus persica]
Length=467

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDNSKEAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  145



>emb|CAN73512.1| hypothetical protein VITISV_028522 [Vitis vinifera]
Length=274

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            +    STK  W+ LE T+EGT+ VK+SK  L+ + +E F M E+ETI 
Sbjct  39   ICQCKSTKEIWKLLEITHEGTNQVKKSKINLLVHSYELFFMKENETIV  86



>ref|XP_009757540.1| PREDICTED: uncharacterized protein LOC104210350 [Nicotiana sylvestris]
Length=135

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  66   TKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            TK   EAL++ +EG + VKQSK  L+  ++E FRM +DE+I
Sbjct  55   TKKVLEALQTAHEGNTQVKQSKIDLITTEYELFRMKDDESI  95



>ref|XP_009623168.1| PREDICTED: uncharacterized protein LOC104114420 [Nicotiana tomentosiformis]
Length=187

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EGT+ VKQSK  ++  ++E F+M +D++I
Sbjct  101  ISACQSAKEIWEALQMAHEGTTQVKQSKIDMLTTEYELFKMKDDKSI  147



>ref|XP_009611094.1| PREDICTED: uncharacterized protein LOC104104661 [Nicotiana tomentosiformis]
Length=164

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EGT+ VKQSK  ++   +E FR+ +DE+I
Sbjct  101  ISSCQSAKEIWEALQIAHEGTTQVKQSKIDMLTTGYELFRLKDDESI  147



>emb|CAN73575.1| hypothetical protein VITISV_008297 [Vitis vinifera]
Length=357

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            F  +A   S K +W+ L+ T+EGT++VK SK Q++   FE  RM++ ET
Sbjct  13   FRRIATCTSAKEAWDILQVTHEGTNAVKVSKLQMLTSRFETIRMDDHET  61



>ref|XP_009779723.1| PREDICTED: uncharacterized protein LOC104228873 [Nicotiana sylvestris]
Length=130

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W  L+ TYEGTS VK+++  L+ +D+E F+M E E+I
Sbjct  57   ISSCDTAKKMWGKLKFTYEGTSKVKETQIYLLVHDYEIFQMKEGESI  103



>ref|XP_010430957.1| PREDICTED: uncharacterized protein LOC104715228 [Camelina sativa]
Length=160

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDE  182
            F L++   S + +W++LE+ +EGTSSVK++K  ++   FE  RM E +
Sbjct  85   FKLISQCVSAQKAWKSLENMFEGTSSVKRTKLDMLASQFENLRMEEKK  132



>ref|XP_009780764.1| PREDICTED: uncharacterized protein LOC104229760 [Nicotiana sylvestris]
Length=111

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + K  WEAL + +EG + VKQSK  ++  ++E FRM +DE+I
Sbjct  70   AAKEIWEALRTAHEGKTQVKQSKIDMLTTEYELFRMKDDESI  111



>ref|XP_009770614.1| PREDICTED: uncharacterized protein LOC104221284 [Nicotiana sylvestris]
Length=153

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            S K  WEAL++T+ GT+ VKQSK  ++  ++E  +M EDE+I
Sbjct  62   SAKEIWEALQTTHNGTTQVKQSKIDILTNEYELLKMKEDESI  103



>ref|XP_007199289.1| hypothetical protein PRUPE_ppa022949mg, partial [Prunus persica]
 gb|EMJ00488.1| hypothetical protein PRUPE_ppa022949mg, partial [Prunus persica]
Length=501

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  81   FEYISGCDTSKEAWDILQLTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  131



>ref|XP_009763232.1| PREDICTED: uncharacterized protein LOC104215178 [Nicotiana sylvestris]
Length=163

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  WEAL+  +EGT+ VKQ K  ++  ++E F+M +DE+I
Sbjct  66   ISTYDTAKEVWEALQKAHEGTTQVKQFKIDMLTTEYEIFKMRDDESI  112



>ref|XP_009796921.1| PREDICTED: uncharacterized protein LOC104243433 [Nicotiana sylvestris]
Length=138

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   WEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            WEAL++T+EGT+ VKQ K  ++   +E FRM  DE+I
Sbjct  89   WEALQTTHEGTTQVKQLKIDILTIVYELFRMKNDESI  125



>gb|KHN11521.1| hypothetical protein glysoja_044670, partial [Glycine soja]
Length=106

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            V+   + K  W+ L+ T+EGT+ VK+S+   + +++E FRMN +E I
Sbjct  23   VSNCSNAKEMWDTLQLTHEGTTDVKRSRVNTLTHEYELFRMNTNENI  69



>ref|XP_008793768.1| PREDICTED: uncharacterized protein LOC103709990 [Phoenix dactylifera]
Length=286

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  VA     K +WE L+++Y+G   VK+ + Q+++ DFE  RM E E+I 
Sbjct  21   FERVANATIAKQAWEILQNSYQGVDKVKKVRLQMLREDFEGIRMQESESIA  71



>ref|XP_007226466.1| hypothetical protein PRUPE_ppb017830mg [Prunus persica]
 gb|EMJ27665.1| hypothetical protein PRUPE_ppb017830mg [Prunus persica]
Length=616

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKKAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_010315791.1| PREDICTED: uncharacterized protein LOC104645626 [Solanum lycopersicum]
Length=207

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            + L++  +S K  W+ L++TYEGT  +++SK  L    FE F MNE E I
Sbjct  127  YDLISSCESAKEIWDLLKTTYEGTEEIRKSKLDLFTTQFEGFTMNEGELI  176



>ref|XP_009615674.1| PREDICTED: uncharacterized protein LOC104108362 [Nicotiana tomentosiformis]
Length=438

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  71   ISACQSAKEIWEALQTAHEGTTQVKQSKIDMLTTEYEIFRMKDDESI  117



>ref|XP_009622915.1| PREDICTED: uncharacterized protein LOC104114226 [Nicotiana tomentosiformis]
Length=119

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+  E TYEG S +K+ +  L+ YD+E F+M E  +I
Sbjct  72   ISSCDTTKKMWDKREVTYEGMSKMKEIRINLLVYDYELFQMKEGRSI  118



>ref|XP_010089312.1| Receptor-like protein 12 [Morus notabilis]
 gb|EXB37637.1| Receptor-like protein 12 [Morus notabilis]
Length=1482

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L++  +S K +W+ L++ +EGT++V+ SK Q++   FE   M EDETI
Sbjct  94   FKLISTCESAKEAWKILQTAHEGTAAVRLSKLQILTTRFENLGMLEDETI  143



>ref|XP_007226901.1| hypothetical protein PRUPE_ppa016308mg [Prunus persica]
 gb|EMJ28100.1| hypothetical protein PRUPE_ppa016308mg [Prunus persica]
Length=545

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEAWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_010467026.1| PREDICTED: uncharacterized protein LOC104747145 [Camelina sativa]
Length=556

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G  S K +W+ L+ T+EG SSVK+++   +   FE  RM+ +ETI+
Sbjct  95   FKLVQGCGSAKDAWDILQKTHEGNSSVKRTRLDQLASQFEVLRMDPEETIS  145



>ref|XP_010315759.1| PREDICTED: uncharacterized protein LOC104645601 [Solanum lycopersicum]
Length=150

 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+  +S+K  W+ L++ +EG   VK+SK  ++   +E F+M E ETI
Sbjct  70   FNHVSACESSKQIWDCLKTAHEGIEQVKESKIDMISSQYENFKMREGETI  119



>ref|XP_008454684.1| PREDICTED: uncharacterized protein LOC103495039 [Cucumis melo]
Length=580

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            F L+    + K +W+ LE  YEGTS VK  + QLV   FE  +M EDET
Sbjct  36   FKLIDSCTTAKEAWKILEVAYEGTSKVKIFRLQLVTSKFEALKMIEDET  84



>ref|XP_006491759.1| PREDICTED: uncharacterized protein LOC102614994 [Citrus sinensis]
Length=574

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  45   LVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            L+    ++K +W+ L+ST++G + VK+SK Q +  DFE  +M+E ETI+
Sbjct  96   LIFTCKTSKAAWDILQSTFKGDNMVKRSKLQKLTSDFENLKMHEHETIS  144



>ref|XP_009613803.1| PREDICTED: uncharacterized protein LOC104106859 [Nicotiana tomentosiformis]
Length=112

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  W+AL++T+EGT+ VKQ K  ++  ++E F M +DE+I
Sbjct  66   ISACQSAKEIWDALQTTHEGTTQVKQFKIDMLTTEYEFFNMKDDESI  112



>ref|XP_009629298.1| PREDICTED: uncharacterized protein LOC104119483 [Nicotiana tomentosiformis]
Length=134

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   WEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            WEAL+  +EGT+ VKQSK  ++  +++ FRM +DE+I
Sbjct  61   WEALQIAHEGTTQVKQSKIDMLTTEYKLFRMKDDESI  97



>ref|XP_007202912.1| hypothetical protein PRUPE_ppa016140mg [Prunus persica]
 gb|EMJ04111.1| hypothetical protein PRUPE_ppa016140mg [Prunus persica]
Length=564

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K +W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEAWDILQVTHEGTDTVKGAKLQMHTLQFEILMMDENETFS  145



>ref|XP_006301613.1| hypothetical protein CARUB_v10022054mg [Capsella rubella]
 gb|EOA34511.1| hypothetical protein CARUB_v10022054mg [Capsella rubella]
Length=119

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP +A   S + +W ALE  ++G+S VK    Q ++  +E  +M E ETI
Sbjct  57   FPRIAPASSAREAWNALEMEFQGSSQVKMINLQSLRRKYENLKMEESETI  106



>ref|XP_009776955.1| PREDICTED: uncharacterized protein LOC104226621 [Nicotiana sylvestris]
Length=152

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ LE TYEGT+ VK+    ++ +D+E F M E E+I
Sbjct  69   ISSCDTAKEMWDKLEVTYEGTNKVKEIHINMMVHDYELFSMKEGESI  115



>ref|XP_008385981.1| PREDICTED: uncharacterized protein LOC103448501 [Malus domestica]
Length=339

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            FP +A  DS K +W+ L   Y G   V+  K Q ++ +FE  RM +DE++T
Sbjct  92   FPRIANADSAKXAWDLLXGEYHGGDXVRSVKLQNLRREFEYTRMXDDESLT  142



>ref|XP_009765657.1| PREDICTED: uncharacterized protein LOC104217182 [Nicotiana sylvestris]
Length=762

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            ++  D+ K  W+ LE TYEGTS VK++   ++ +D+E F M E E+I 
Sbjct  103  ISSCDTAKEMWDKLEVTYEGTSKVKETHINMLVHDYELFSMKEGESIV  150



>ref|XP_009623620.1| PREDICTED: uncharacterized protein LOC104114794 [Nicotiana tomentosiformis]
Length=384

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            +  ++G D  K  W+ LE TY+GTS VK+    ++ +D+E F+M E E+I
Sbjct  66   YERISGCDIAKEMWDKLEVTYKGTSKVKEIHINMLVHDYELFQMKEGESI  115



>gb|KHN35311.1| hypothetical protein glysoja_044389, partial [Glycine soja]
Length=118

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP + G  + K +W  L+  ++G++ V+  K Q ++ DFE  +M E ET+
Sbjct  10   FPRIMGAKTAKEAWNTLQEEFQGSAKVRAVKLQSLRKDFELLKMKESETV  59



>ref|XP_010418555.1| PREDICTED: uncharacterized protein LOC104704120 [Camelina sativa]
Length=505

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F LV G +S K +W+ LE ++EG SS K+++   +   FE  RM+ +ETI+
Sbjct  94   FKLVQGCESAKDAWDILEKSHEGNSSFKRTRLDQLASQFEVLRMDPEETIS  144



>ref|XP_008464095.1| PREDICTED: uncharacterized protein LOC103502061 [Cucumis melo]
Length=433

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  66   TKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
             K +W  LE+ YEGTS VK SK Q++   FE  ++ EDETI 
Sbjct  110  AKEAWNILETAYEGTSKVKISKLQILSSKFEAVKLTEDETIV  151



>ref|XP_009597682.1| PREDICTED: uncharacterized protein LOC104093616 [Nicotiana tomentosiformis]
Length=205

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  ++  D+ K  W+ L+  YEGT  VK+++  L+  D+E F+M +DE+I
Sbjct  73   FEKISSCDTAKEMWDKLKVIYEGTGKVKETRINLLIRDYELFQMKDDESI  122



>gb|AAO73521.1| gag-pol polyprotein [Glycine max]
Length=1574

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+      K +WE L+ T+EGTS VK S+ QL+   FE  +M E+E I
Sbjct  96   FRLINTCTVAKDAWEILKITHEGTSKVKISRLQLLATKFENLKMKEEECI  145



>ref|XP_006296739.1| hypothetical protein CARUB_v10014861mg [Capsella rubella]
 gb|EOA29637.1| hypothetical protein CARUB_v10014861mg [Capsella rubella]
Length=144

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L++   S + +W++LE+ +EGT+SVK++K  ++   FE  RM   E +
Sbjct  85   FKLISQCASAQKAWKSLENMFEGTTSVKRTKLDMLASQFENLRMEVKELV  134



>emb|CAN70892.1| hypothetical protein VITISV_039825 [Vitis vinifera]
Length=216

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  63   STKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            S K  W  LE T+EGT+ VK+SK  L+ +++E F M E+ETI 
Sbjct  106  SAKEIWRLLEITHEGTNQVKESKINLLVHNYELFSMKENETIV  148



>ref|XP_010327584.1| PREDICTED: uncharacterized protein LOC104649747 [Solanum lycopersicum]
Length=125

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+  +S K  W+ L++ +EGT  VK+SK  ++   +E F+M E ETI
Sbjct  62   FNRVSACESAKEIWDCLKTAHEGTEQVKESKIDMLTSLYENFKMKEGETI  111



>ref|XP_009626801.1| PREDICTED: uncharacterized protein LOC104117450 [Nicotiana tomentosiformis]
Length=377

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W  LE TYEGT+ VK+++  ++ +D+E F+M E E+I
Sbjct  69   ISNCDTAKEMWGKLEVTYEGTNKVKETRINMLVHDYELFQMKEGESI  115



>ref|NP_001235160.1| gag-protease polyprotein [Glycine max]
 pir||T06419 gag-proteinase polyprotein - soybean retrovirus-like element
 gb|AAC18777.1| gag-protease polyprotein [Glycine max]
Length=640

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F L+      K +WE L++T+EGTS VK S+ QL+   FE  +M E+E I
Sbjct  96   FRLINTCTVAKDAWEILKTTHEGTSKVKMSRLQLLATKFENLKMKEEECI  145



>ref|XP_010555772.1| PREDICTED: uncharacterized protein LOC104825183 [Tarenaya hassleriana]
Length=681

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  +    + K +W+ALE  +EGTSSVK+ +  +V++ F++  M+EDE++
Sbjct  93   FKQIQACKTAKEAWDALELIHEGTSSVKRKRRDIVKHQFDKLEMDEDESV  142



>ref|XP_010480935.1| PREDICTED: uncharacterized protein LOC104759742 [Camelina sativa]
Length=758

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G +S K +W+ L+ ++EG SSVK+++   +   FE  RM+  ETI+
Sbjct  94   FKLLQGCESAKEAWDILQKSHEGNSSVKRTRLDQLPSQFEVLRMDPKETIS  144



>ref|XP_010314541.1| PREDICTED: uncharacterized protein LOC104645162 [Solanum lycopersicum]
Length=169

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+   STK  W+ +++ +EGT  VK+SK  ++   +E F+M E ETI
Sbjct  70   FNRVSACKSTKEIWDCIKTNHEGTKQVKESKIDMLTSLYENFKMREGETI  119



>ref|XP_009776144.1| PREDICTED: uncharacterized protein LOC104225967 [Nicotiana sylvestris]
Length=172

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+TK  W+ LE TYEGT+ VK+    ++ +++E F+M E E+I
Sbjct  68   ISSCDTTKEMWDKLEVTYEGTNKVKKIHINMLFHNYELFQMKEGESI  114



>gb|KFK34260.1| hypothetical protein AALP_AA5G121900 [Arabis alpina]
Length=565

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G ++ K +W  L+S YEGT  V+ S+  L+   FE  +M E E+I 
Sbjct  93   FELIQGCETAKEAWNLLQSHYEGTQKVQNSRRDLIASRFENLKMEEHESIA  143



>ref|XP_009625895.1| PREDICTED: uncharacterized protein LOC104116691 [Nicotiana tomentosiformis]
Length=162

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   WEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            WEAL++ +E T+ VKQSK  ++  ++E FRM +DE+I
Sbjct  76   WEALQTAHERTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_009615743.1| PREDICTED: uncharacterized protein LOC104108427 [Nicotiana tomentosiformis]
Length=126

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRM  170
            V+   STK  WE L++ +EGT+ VKQSK  ++  ++E FRM
Sbjct  66   VSACQSTKEIWEDLQTAHEGTTQVKQSKIDMLTIEYELFRM  106



>emb|CAN76159.1| hypothetical protein VITISV_012002 [Vitis vinifera]
Length=268

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            +    S K  W  LE T+EGT+ VK+SK  L+ +++E F M E+ETI 
Sbjct  9    ICQCKSAKEIWRLLEITHEGTNQVKESKINLLVHNYELFSMKENETIV  56



>emb|CAN80972.1| hypothetical protein VITISV_043375 [Vitis vinifera]
Length=164

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDET  185
            F  +    ST  +W+ L+ T+EGT++VK SK Q++   FE  RM++ ET
Sbjct  13   FRRIGTCTSTMEAWDILQVTHEGTNAVKVSKLQMLTSRFETIRMDDHET  61



>ref|XP_008390391.1| PREDICTED: uncharacterized protein LOC103452643 [Malus domestica]
Length=312

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP +A  ++ K +W+ L+  Y G   V++ K Q ++ DFE  RM E+E +
Sbjct  88   FPRIANEETAKAAWDTLQQEYRGDVKVRKVKLQSLRRDFEYTRMREBEXL  137



>ref|XP_008350021.1| PREDICTED: uncharacterized protein LOC103413324 [Malus domestica]
Length=188

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP +    + KG+WE L   + G   V+  K Q ++ DFE  RMN+ E++
Sbjct  98   FPRIRNEKTAKGAWEILRREFRGDKKVRAVKLQAIRADFEYLRMNDVESL  147



>ref|XP_009758916.1| PREDICTED: uncharacterized protein LOC104211543 [Nicotiana sylvestris]
Length=221

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+  +EG + VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEALQIAHEGKNQVKQSKIDMLTTEYELFRMYDDESI  112



>ref|XP_009623422.1| PREDICTED: uncharacterized protein LOC104114639 [Nicotiana tomentosiformis]
Length=176

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ LE TYEG + VK+++  ++ +D+E F+M E E+I
Sbjct  103  ISTCDTAKEIWDKLEVTYEGINKVKETRINMLVHDYELFQMKEGESI  149



>ref|XP_009607495.1| PREDICTED: uncharacterized protein LOC104101702 [Nicotiana tomentosiformis]
Length=153

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL+++++G + VKQSK  ++  ++E F+M +DE+I
Sbjct  66   ISACQSAKEIWEALQTSHKGITQVKQSKTDMLTTEYELFKMKDDESI  112



>ref|XP_008224126.1| PREDICTED: uncharacterized protein LOC103323884 [Prunus mume]
Length=327

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            FP ++  +++KG+W+ L   + G   V+  K Q ++ DFE  RM +DET++
Sbjct  19   FPRISNEETSKGAWDILHQEFHGDKQVRSIKLQGLRIDFEYTRMKDDETLS  69



>ref|XP_007207735.1| hypothetical protein PRUPE_ppb023473mg [Prunus persica]
 gb|EMJ08934.1| hypothetical protein PRUPE_ppb023473mg [Prunus persica]
Length=167

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP +    + K +WE L S + G   V+  K Q ++ DFE  RMN+ E++
Sbjct  74   FPRIRNEKTAKAAWEILRSEFRGDKKVRAVKLQAIRADFEYLRMNDVESL  123



>ref|XP_007220032.1| hypothetical protein PRUPE_ppb016845mg [Prunus persica]
 gb|EMJ21231.1| hypothetical protein PRUPE_ppb016845mg [Prunus persica]
Length=462

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  ++G D++K  W+ L+ T+EGT +VK +K Q+    FE   M+E+ET +
Sbjct  95   FEYISGCDTSKEVWDILQVTHEGTDTVKGAKLQMHTLQFETLMMDENETFS  145



>ref|XP_009599126.1| PREDICTED: uncharacterized protein LOC104094837 [Nicotiana tomentosiformis]
Length=202

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  ++TK  W+ LE TYEGT+ VK+++  L+  D+E F+M + E +
Sbjct  109  ISSCETTKKMWDKLEVTYEGTNKVKETRINLLVRDYELFQMKDGEAV  155



>ref|XP_010321939.1| PREDICTED: uncharacterized protein LOC104647818 [Solanum lycopersicum]
Length=130

 Score = 43.5 bits (101),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+  +S K  W+ L++ +EGT  VK+SK  ++   +E F+M E ETI
Sbjct  70   FNHVSACESAKEIWDCLKTAHEGTEQVKESKIDMLTSLYENFKMKEGETI  119



>ref|XP_007010204.1| Uncharacterized protein TCM_043614 [Theobroma cacao]
 gb|EOY19014.1| Uncharacterized protein TCM_043614 [Theobroma cacao]
Length=111

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F  V+   + K  WE L+  +EGTS VK+SK  L+ +++E F+M   E IT
Sbjct  47   FNKVSSCIAAKQVWEKLKIIHEGTSQVKESKIALLTHNYEMFKMEPGEDIT  97



>ref|XP_009356290.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Pyrus x bretschneideri]
Length=798

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            FP ++  +S+K +W+ L+  + G   V+  K Q ++ DFE  RMNE E+++
Sbjct  88   FPRISNFESSKPAWDVLQQEFRGDKKVRSVKLQCLRRDFEYTRMNEGESLS  138



>ref|XP_009594493.1| PREDICTED: uncharacterized protein LOC104090973 [Nicotiana tomentosiformis]
Length=326

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  78   WEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            WE+L++ +EGT+ VKQSK  ++  ++E FRM +DE+I
Sbjct  76   WESLQTAHEGTTQVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_008351642.1| PREDICTED: uncharacterized protein LOC103415057, partial [Malus 
domestica]
Length=298

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            FP +A  DS K +W+ L   Y G   V+  K Q ++ +FE  RM +DET++
Sbjct  63   FPRIANADSAKMAWDLLYGEYHGGDQVRPMKLQNLRREFEYARMRDDETLS  113



>ref|XP_009618972.1| PREDICTED: uncharacterized protein LOC104111075 [Nicotiana tomentosiformis]
Length=161

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  ++TK  W  LE TYEGT+ VK+++  L+  D+E F+M + E++
Sbjct  41   ISSCETTKEIWNKLEVTYEGTNKVKETRINLLVRDYELFQMKDGESV  87



>ref|XP_009773204.1| PREDICTED: uncharacterized protein LOC104223454 [Nicotiana sylvestris]
Length=149

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  ++ K  WEAL++ +EGT+ VK+ K  ++  ++E FRM +DE I
Sbjct  66   ISVCETAKEIWEALQTAHEGTTQVKKYKIDMLTIEYELFRMKDDEYI  112



>ref|XP_009588972.1| PREDICTED: uncharacterized protein LOC104086429 [Nicotiana tomentosiformis]
Length=399

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K  WEAL++ +E T+ VKQSK  ++  ++E FRM +DE+I
Sbjct  66   ISACQSAKEIWEALQTKHEETTHVKQSKIDMLTTEYELFRMKDDESI  112



>ref|XP_010326235.1| PREDICTED: uncharacterized protein LOC104649188 [Solanum lycopersicum]
Length=163

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            F  V+  +S K  W+ L + +EGT  VK+SK  ++   +E F+M E ETI
Sbjct  100  FNRVSACESAKEIWDCLNTAHEGTEQVKKSKIDMLTSRYENFKMKEGETI  149



>ref|XP_010431414.1| PREDICTED: uncharacterized protein LOC104715730 [Camelina sativa]
Length=543

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            F L+ G ++ K +W+ L+  YEGT++V+ S+  ++   FE  RM E E+I+
Sbjct  93   FNLIQGCETAKEAWDILQIQYEGTTNVQSSRKNMLASRFENLRMEEHESIS  143



>ref|XP_009628791.1| PREDICTED: uncharacterized protein LOC104119083 [Nicotiana tomentosiformis]
Length=163

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++   S K   EAL++ +EGT+ VKQSK  ++  ++E F MN+DE+I
Sbjct  66   ISACQSAKEISEALQTAHEGTTQVKQSKIDILTTEYELFSMNDDESI  112



>ref|XP_008387251.1| PREDICTED: uncharacterized protein LOC103449700 [Malus domestica]
Length=394

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETIT  191
            FP +A  DS K +W+ L   Y G   V+  K Q ++ +FE  RM +DE++T
Sbjct  67   FPRIANADSAKMAWDLLYGEYHGGDQVRSVKLQNLRREFEYTRMRDDESLT  117



>ref|XP_009605403.1| PREDICTED: uncharacterized protein LOC104099972 [Nicotiana tomentosiformis]
Length=525

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  48   VAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            ++  D+ K  W+ LE TYEGTS VK++   ++ +D+E F M E E I
Sbjct  71   ISSCDTAKEMWDKLEVTYEGTSKVKETHINMLVHDYELFHMKEGEYI  117



>gb|KHN47581.1| hypothetical protein glysoja_044196, partial [Glycine soja]
Length=131

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  39   FPLVAGIDSTKGSWEALESTYEGTSSVKQSKFQLVQYDFEEFRMNEDETI  188
            FP + G  + K +W  L+  ++G+  V+  K Q ++ DFE  +M E ET+
Sbjct  23   FPRIMGAKTAKEAWNTLQEEFQGSVKVRAVKLQSLRRDFELLKMKESETV  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524026180552