BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4953_g1_i1 len=158 path=[729:0-157]

Length=158
                                                                      Score     E

emb|CDP17248.1|  unnamed protein product                              92.0    8e-22   
emb|CDP20865.1|  unnamed protein product                              92.8    4e-21   
emb|CDP10664.1|  unnamed protein product                              95.1    5e-21   
emb|CDP12624.1|  unnamed protein product                              93.6    2e-20   
gb|EYU33367.1|  hypothetical protein MIMGU_mgv1a001775mg              93.6    2e-20   
gb|EYU34015.1|  hypothetical protein MIMGU_mgv1a021513mg              92.8    3e-20   
ref|XP_011096562.1|  PREDICTED: dammarenediol II synthase-like        90.9    2e-19   
gb|AEX99665.1|  amyrin synthase                                       88.2    1e-18   
gb|AFJ19235.1|  mixed amyrin synthase                                 88.2    1e-18   
gb|AIS39793.1|  mixed amyrin synthase 1                               87.8    2e-18   
ref|XP_010053899.1|  PREDICTED: beta-Amyrin Synthase 1-like           86.7    3e-18   
ref|XP_003531781.1|  PREDICTED: beta-amyrin synthase-like isoform 1   87.0    4e-18   
ref|XP_009344148.1|  PREDICTED: beta-amyrin synthase-like             86.7    5e-18   
gb|KEH18380.1|  beta-amyrin synthase                                  86.7    5e-18   
gb|AHF49822.1|  bAS                                                   86.7    5e-18   
ref|XP_008353811.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  86.3    5e-18   
gb|KHN38108.1|  Beta-amyrin synthase                                  86.7    5e-18   
gb|AAS01523.1|  putative beta-amyrin synthase                         86.7    6e-18   Centella asiatica [Asiatic pennywort]
ref|XP_010091128.1|  Beta-amyrin synthase                             86.7    6e-18   
gb|KCW78276.1|  hypothetical protein EUGRSUZ_D02459                   86.3    6e-18   
ref|XP_010054896.1|  PREDICTED: beta-amyrin synthase-like             86.3    6e-18   
ref|XP_009347735.1|  PREDICTED: beta-amyrin synthase-like             86.3    6e-18   
ref|XP_008362478.1|  PREDICTED: beta-amyrin synthase                  86.3    7e-18   
ref|XP_003627088.1|  Beta-amyrin synthase                             85.1    8e-18   
sp|Q9MB42.1|BAMS_GLYGL  RecName: Full=Beta-amyrin synthase            85.9    8e-18   Glycyrrhiza glabra
gb|ADE88148.1|  beta-amyrin synthase                                  85.9    8e-18   
ref|XP_010063691.1|  PREDICTED: beta-amyrin synthase-like             85.9    1e-17   
gb|ACV21067.1|  beta-amyrin synthase                                  85.9    1e-17   
gb|KHG28038.1|  Beta-amyrin synthase                                  85.5    1e-17   
ref|XP_008342939.1|  PREDICTED: beta-amyrin synthase-like             83.6    1e-17   
ref|XP_008365698.1|  PREDICTED: beta-amyrin synthase-like             85.1    2e-17   
gb|AET01567.2|  beta-amyrin synthase                                  85.1    2e-17   
sp|Q9LRH7.1|ABAMS_PEA  RecName: Full=Mixed-amyrin synthase            85.1    2e-17   Pisum sativum [garden pea]
ref|XP_003627091.1|  Beta-amyrin synthase                             84.7    2e-17   
gb|ADX01169.1|  putative beta-amyrin synthase                         84.3    2e-17   
gb|KCW83375.1|  hypothetical protein EUGRSUZ_B00308                   84.7    3e-17   
gb|AAO33578.1|AF478453_1  beta-amyrin synthase                        84.7    3e-17   Medicago truncatula
ref|XP_003604121.1|  Beta-amyrin synthase                             84.7    3e-17   
ref|XP_011031247.1|  PREDICTED: beta-amyrin synthase                  84.7    3e-17   
ref|XP_006582958.1|  PREDICTED: beta-amyrin synthase isoform X1       84.7    3e-17   
gb|KHN39383.1|  Beta-amyrin synthase                                  84.7    3e-17   
gb|ADM86392.1|  putative beta-amyrin synthase                         84.3    3e-17   
ref|XP_010027785.1|  PREDICTED: beta-amyrin synthase-like             84.3    3e-17   
ref|XP_008362476.1|  PREDICTED: beta-amyrin synthase-like             84.3    3e-17   
ref|XP_010027664.1|  PREDICTED: beta-amyrin synthase-like isoform X1  84.3    3e-17   
ref|NP_001236591.1|  beta-amyrin synthase                             84.3    3e-17   
ref|XP_010027674.1|  PREDICTED: beta-amyrin synthase-like isoform X2  84.3    3e-17   
gb|AHI17180.1|  beta-amyrin synthase                                  84.3    3e-17   
gb|KEH28511.1|  beta-amyrin synthase                                  84.3    3e-17   
ref|XP_008228023.1|  PREDICTED: beta-amyrin synthase                  84.3    3e-17   
gb|AEJ79821.1|  beta-amyrin synthase AS2                              82.8    3e-17   
emb|CDP15852.1|  unnamed protein product                              84.3    3e-17   
gb|AAS83468.1|  beta-armyrin synthase                                 84.3    4e-17   Bupleurum kaoi
ref|XP_007214979.1|  hypothetical protein PRUPE_ppa001817mg           84.3    4e-17   
gb|ADM89633.1|  beta-amyrin synthase                                  84.3    4e-17   
ref|XP_010065065.1|  PREDICTED: beta-amyrin synthase-like             83.6    4e-17   
ref|XP_007023608.1|  Beta-Amyrin Synthase                             84.0    4e-17   
ref|XP_003604122.1|  Beta-amyrin synthase                             84.0    4e-17   
gb|ACA13386.1|  beta-amyrin synthase                                  84.0    5e-17   Artemisia annua [sweet Annie]
gb|ACB87531.1|  beta-amyrin synthase                                  84.0    5e-17   Artemisia annua [sweet Annie]
ref|XP_008353809.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  84.0    5e-17   
ref|XP_004488915.1|  PREDICTED: beta-amyrin synthase-like             84.0    5e-17   
gb|AHF22084.1|  OSC2                                                  83.6    5e-17   
ref|XP_009344015.1|  PREDICTED: beta-amyrin synthase                  83.6    6e-17   
ref|XP_009369010.1|  PREDICTED: beta-amyrin synthase-like             83.6    6e-17   
ref|XP_006380842.1|  hypothetical protein POPTR_0007s15180g           83.2    7e-17   
ref|XP_008380417.1|  PREDICTED: beta-amyrin synthase-like             83.2    7e-17   
ref|XP_010696136.1|  PREDICTED: beta-amyrin synthase-like             83.2    7e-17   
ref|XP_007214978.1|  hypothetical protein PRUPE_ppa001812mg           83.2    7e-17   
ref|XP_009612988.1|  PREDICTED: beta-amyrin synthase                  83.2    8e-17   
dbj|BAE43642.1|  beta-amyrin synthase                                 83.2    8e-17   Euphorbia tirucalli
gb|KCW70932.1|  hypothetical protein EUGRSUZ_F04049                   83.2    8e-17   
gb|KCW70935.1|  hypothetical protein EUGRSUZ_F04052                   83.2    8e-17   
sp|A8CDT2.1|BAS_BRUGY  RecName: Full=Beta-amyrin synthase; Short=...  83.2    9e-17   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_002310349.1|  beta-Amyrin synthase family protein              83.2    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009337925.1|  PREDICTED: beta-amyrin synthase-like             82.8    1e-16   
ref|XP_010063688.1|  PREDICTED: beta-amyrin synthase-like             83.2    1e-16   
ref|XP_010063692.1|  PREDICTED: beta-amyrin synthase                  83.2    1e-16   
ref|XP_010065064.1|  PREDICTED: beta-amyrin synthase-like             82.8    1e-16   
gb|KEH22226.1|  beta-amyrin synthase                                  82.8    1e-16   
sp|B9X0J1.1|STBOS_STERE  RecName: Full=Baccharis oxide synthase; ...  82.8    1e-16   Stevia rebaudiana
gb|KCW70929.1|  hypothetical protein EUGRSUZ_F04042                   82.4    1e-16   
gb|ABK76265.1|  beta-amyrin synthase                                  82.8    1e-16   Gypsophila vaccaria [bladder-soapwort]
ref|XP_002527337.1|  Cycloartenol synthase, putative                  82.4    1e-16   Ricinus communis
sp|A8C980.1|GERS_RHISY  RecName: Full=Germanicol synthase; Short=...  82.4    1e-16   Rhizophora stylosa
gb|ABC33922.1|  beta-amyrin synthase                                  82.4    1e-16   Gypsophila paniculata
sp|Q2XPU7.1|LUPS_RICCO  RecName: Full=Lupeol synthase                 82.4    1e-16   Ricinus communis
ref|XP_006374734.1|  hypothetical protein POPTR_0014s00350g           82.4    1e-16   
ref|XP_010065062.1|  PREDICTED: beta-amyrin synthase-like             82.4    1e-16   
gb|KHN38795.1|  Beta-amyrin synthase                                  82.0    2e-16   
ref|XP_009379199.1|  PREDICTED: beta-amyrin synthase-like             82.4    2e-16   
gb|EYU38890.1|  hypothetical protein MIMGU_mgv1a001796mg              82.4    2e-16   
ref|XP_011085901.1|  PREDICTED: beta-amyrin synthase-like             82.4    2e-16   
gb|AIE17465.1|  oxidosqualene cyclase                                 82.4    2e-16   
ref|XP_011093795.1|  PREDICTED: beta-amyrin synthase                  82.0    2e-16   
gb|KEH33351.1|  beta-amyrin synthase                                  82.0    2e-16   
emb|CBI18402.3|  unnamed protein product                              80.1    2e-16   
ref|XP_002269328.2|  PREDICTED: beta-Amyrin Synthase 1-like           82.0    2e-16   Vitis vinifera
gb|AET01563.2|  beta-amyrin synthase                                  82.0    2e-16   
emb|CDP08999.1|  unnamed protein product                              82.0    2e-16   
gb|AAO33580.1|AF478455_1  multifunctional beta-amyrin synthase        82.0    2e-16   Lotus japonicus
ref|XP_003521102.1|  PREDICTED: beta-amyrin synthase-like isoform X1  81.6    3e-16   
gb|ACO24697.1|  beta-amyrin synthase                                  81.6    3e-16   Gentiana straminea
gb|AGS16975.1|  dammarenediol synthase II                             81.6    3e-16   
gb|AGK62449.1|  dammarenediol-II synthase                             81.6    3e-16   
dbj|BAD15332.1|  beta-amyrin synthase                                 81.6    3e-16   Panax ginseng [Asiatic ginseng]
gb|AED99864.1|  DS synthase                                           81.6    3e-16   
gb|AJC01928.1|  dammarenediol synthase                                80.1    3e-16   
gb|AJC01930.1|  dammarenediol synthase                                80.1    3e-16   
gb|AJC01929.1|  dammarenediol synthase                                79.7    3e-16   
emb|CBI18395.3|  unnamed protein product                              80.9    3e-16   
gb|AGI15962.1|  dammarenediol synthase                                81.6    3e-16   
gb|KDP37005.1|  hypothetical protein JCGZ_06061                       79.3    3e-16   
gb|ACZ71036.1|  dammarenediol synthase protein                        81.6    3e-16   Panax ginseng [Asiatic ginseng]
emb|CDP17993.1|  unnamed protein product                              79.0    3e-16   
emb|CBI18407.3|  unnamed protein product                              81.6    3e-16   
ref|XP_002513298.1|  Cycloartenol synthase, putative                  81.6    3e-16   Ricinus communis
gb|AIK21788.1|  dammarenediol-II synthase                             81.6    3e-16   
gb|AGS79229.1|  dammarenediol-II synthase                             81.6    3e-16   
gb|AEO27862.1|  dammarenediol synthase                                81.6    3e-16   
ref|XP_009779988.1|  PREDICTED: beta-amyrin synthase                  81.6    3e-16   
gb|AJC01927.1|  dammarenediol synthase                                80.1    3e-16   
ref|XP_002270934.1|  PREDICTED: beta-amyrin synthase                  81.6    3e-16   Vitis vinifera
emb|CBI18382.3|  unnamed protein product                              81.6    3e-16   
gb|AGI19258.1|  dammarenediol synthase                                81.6    3e-16   
sp|Q08IT1.1|DADIS_PANGI  RecName: Full=Dammarenediol II synthase      81.6    3e-16   Panax ginseng [Asiatic ginseng]
ref|XP_007214977.1|  hypothetical protein PRUPE_ppa001810mg           81.6    3e-16   
emb|CAN65909.1|  hypothetical protein VITISV_001242                   81.3    3e-16   Vitis vinifera
gb|AAO33579.1|AF478454_1  putative beta-amyrin synthase               81.3    3e-16   Lotus japonicus
emb|CAN60316.1|  hypothetical protein VITISV_012054                   81.3    4e-16   Vitis vinifera
ref|XP_010655316.1|  PREDICTED: beta-Amyrin Synthase 1-like           80.9    4e-16   
gb|AAX14716.1|  beta-amyrin synthase                                  81.3    4e-16   Aster sedifolius
gb|KCW70930.1|  hypothetical protein EUGRSUZ_F04043                   80.9    4e-16   
ref|XP_009379200.1|  PREDICTED: beta-amyrin synthase-like             81.3    4e-16   
sp|E2IUA6.1|TARS_KALDA  RecName: Full=Taraxerol synthase; Short=K...  81.3    4e-16   
dbj|BAE53429.1|  beta-amyrin synthase                                 81.3    4e-16   Lotus japonicus
ref|XP_006435524.1|  hypothetical protein CICLE_v10010884mg           80.5    5e-16   
ref|XP_010063690.1|  PREDICTED: beta-amyrin synthase-like             80.9    5e-16   
gb|AIK19223.1|  triterpene synthase                                   80.9    5e-16   
ref|XP_007023364.1|  Beta-Amyrin Synthase                             80.9    6e-16   
ref|XP_007023369.1|  Beta-Amyrin Synthase                             80.9    6e-16   
gb|KDO48982.1|  hypothetical protein CISIN_1g006042mg                 80.5    6e-16   
gb|KHG20016.1|  Lupeol synthase                                       79.0    6e-16   
emb|CBI18406.3|  unnamed protein product                              80.9    6e-16   
ref|XP_002299271.2|  hypothetical protein POPTR_0001s14610g           80.5    7e-16   Populus trichocarpa [western balsam poplar]
sp|Q8W3Z1.1|BAMS_BETPL  RecName: Full=Beta-amyrin synthase            80.5    7e-16   Betula platyphylla [Asian white birch]
gb|KHG20017.1|  Lupeol synthase                                       79.0    7e-16   
ref|XP_011034490.1|  PREDICTED: lupeol synthase-like isoform X1       80.5    7e-16   
ref|XP_007216254.1|  hypothetical protein PRUPE_ppa017215mg           80.5    7e-16   
ref|XP_006488698.1|  PREDICTED: beta-amyrin synthase-like             80.5    7e-16   
ref|XP_006468116.1|  PREDICTED: beta-amyrin synthase-like             80.5    7e-16   
ref|XP_006450022.1|  hypothetical protein CICLE_v10013952mg           80.5    7e-16   
ref|XP_006488602.1|  PREDICTED: beta-amyrin synthase-like             80.5    7e-16   
ref|XP_002530442.1|  Cycloartenol synthase, putative                  80.5    7e-16   Ricinus communis
ref|XP_006425178.1|  hypothetical protein CICLE_v10027855mg           80.5    8e-16   
gb|KHG26534.1|  Lupeol synthase                                       79.0    8e-16   
gb|AIS39794.1|  mixed amyrin synthase 2                               80.5    8e-16   
ref|XP_004510379.1|  PREDICTED: mixed-amyrin synthase-like            80.5    8e-16   
sp|A8CDT3.1|LUPS_BRUGY  RecName: Full=Lupeol synthase; Short=BgLUS    80.5    9e-16   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010245751.1|  PREDICTED: beta-amyrin synthase-like isoform X3  80.1    9e-16   
gb|AGG09939.1|  beta-amyrin synthase                                  80.1    1e-15   
gb|KHG26533.1|  Lupeol synthase                                       78.6    1e-15   
ref|XP_010429761.1|  PREDICTED: beta-amyrin synthase                  80.1    1e-15   
ref|XP_010245750.1|  PREDICTED: beta-amyrin synthase-like isoform X2  80.1    1e-15   
ref|XP_006368910.1|  hypothetical protein POPTR_0001s146002g          80.1    1e-15   
ref|XP_010245749.1|  PREDICTED: beta-amyrin synthase-like isoform X1  80.1    1e-15   
gb|KDP25031.1|  hypothetical protein JCGZ_22566                       80.5    1e-15   
sp|O82146.1|BAMS2_PANGI  RecName: Full=Beta-Amyrin Synthase 2         80.1    1e-15   Panax ginseng [Asiatic ginseng]
gb|AGG09938.1|  beta-amyrin synthase                                  80.1    1e-15   
ref|XP_002271333.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X1     80.1    1e-15   Vitis vinifera
ref|XP_010655247.1|  PREDICTED: beta-Amyrin Synthase 1 isoform X2     79.7    1e-15   
emb|CAN77299.1|  hypothetical protein VITISV_033299                   79.7    1e-15   Vitis vinifera
gb|AIK21791.1|  beta-amyrin synthase                                  79.7    1e-15   
ref|XP_010531942.1|  PREDICTED: beta-amyrin synthase-like             79.7    1e-15   
ref|XP_006368912.1|  hypothetical protein POPTR_0001s14610g           79.7    1e-15   
gb|KDP36999.1|  hypothetical protein JCGZ_06055                       79.3    1e-15   
ref|XP_010052732.1|  PREDICTED: beta-amyrin synthase-like isoform X1  79.7    1e-15   
ref|XP_010655243.1|  PREDICTED: beta-Amyrin Synthase 1                79.7    1e-15   
gb|ACM89978.1|  putative beta amyrin synthase                         79.7    1e-15   Malus domestica [apple tree]
sp|E2IUA9.1|LUPS_KALDA  RecName: Full=Lupeol synthase; Short=KdLUS    79.3    2e-15   
gb|AAD05032.1|  lupeol synthase                                       79.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AIE17466.1|  oxidosqualene cyclase                                 79.3    2e-15   
ref|NP_178018.1|  lupeol synthase 1                                   79.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CBI18386.3|  unnamed protein product                              77.8    2e-15   
gb|AAC17055.1|  Strong similarity to lupeol synthase gb|U49919 fr...  79.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO47541.1|  hypothetical protein CISIN_1g0264001mg                73.9    2e-15   
ref|XP_004507562.1|  PREDICTED: beta-amyrin synthase-like isoform X1  79.3    2e-15   
gb|KFK40207.1|  hypothetical protein AALP_AA3G344300                  79.3    2e-15   
ref|XP_010052737.1|  PREDICTED: beta-amyrin synthase-like isoform X2  79.0    2e-15   
ref|XP_010052738.1|  PREDICTED: beta-amyrin synthase-like isoform X3  79.0    2e-15   
ref|XP_007135871.1|  hypothetical protein PHAVU_010G165100g           79.3    2e-15   
ref|XP_002888561.1|  hypothetical protein ARALYDRAFT_475791           79.0    2e-15   
sp|E2IUA7.1|GLUTS_KALDA  RecName: Full=Glutinol synthase; Short=K...  79.0    2e-15   
emb|CAN72474.1|  hypothetical protein VITISV_009966                   78.6    2e-15   Vitis vinifera
ref|XP_004305793.1|  PREDICTED: beta-amyrin synthase-like             79.0    3e-15   
gb|AGC82084.1|  beta amyrn synthase                                   79.0    3e-15   
ref|XP_004507563.1|  PREDICTED: beta-amyrin synthase-like isoform X2  78.6    3e-15   
ref|XP_009344016.1|  PREDICTED: beta-amyrin synthase-like             78.6    3e-15   
ref|XP_004305792.1|  PREDICTED: beta-amyrin synthase-like             78.6    3e-15   
gb|AED99865.1|  DS synthase                                           78.6    3e-15   
sp|O82140.1|BAMS1_PANGI  RecName: Full=Beta-Amyrin Synthase 1         78.6    4e-15   Panax ginseng [Asiatic ginseng]
ref|XP_008365649.1|  PREDICTED: beta-amyrin synthase                  78.6    4e-15   
ref|XP_008380418.1|  PREDICTED: beta-amyrin synthase                  78.6    4e-15   
dbj|BAF35580.1|  multifunctional triterpene synthase                  78.2    5e-15   Kandelia candel
sp|E2IUA8.1|FRIES_KALDA  RecName: Full=Friedelin synthase; Short=...  78.2    5e-15   
gb|AFM82492.1|  lupeol synthase                                       78.2    5e-15   
ref|NP_001234597.1|  delta-amyrin synthase                            78.2    5e-15   
ref|XP_010313624.1|  PREDICTED: beta-amyrin synthase isoform X1       77.8    6e-15   
ref|NP_001234604.1|  beta-amyrin synthase                             77.8    6e-15   
emb|CDX79277.1|  BnaC06g20260D                                        77.8    6e-15   
gb|KFK42272.1|  hypothetical protein AALP_AA2G234400                  77.8    6e-15   
gb|AAB94341.1|  2,3-oxidosqualene-triterpenoid cyclase                77.8    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313621.1|  PREDICTED: delta-amyrin synthase isoform X1      77.8    7e-15   
gb|AEJ79820.1|  beta-amyrin synthase AS1                              76.3    9e-15   
gb|KEH17471.1|  beta-amyrin synthase                                  77.4    1e-14   
ref|XP_008228019.1|  PREDICTED: beta-amyrin synthase-like             77.0    1e-14   
ref|XP_004309763.1|  PREDICTED: beta-amyrin synthase-like             77.0    1e-14   
dbj|BAF01935.1|  putative lupeol synthase                             76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
sp|F8WQD0.1|SHS1_ASTTA  RecName: Full=Shionone synthase; Short=At...  77.0    1e-14   
ref|XP_006468105.1|  PREDICTED: beta-amyrin synthase-like isoform X2  76.6    1e-14   
gb|KDP25033.1|  hypothetical protein JCGZ_22568                       77.0    1e-14   
ref|XP_002887764.1|  hypothetical protein ARALYDRAFT_477065           76.6    1e-14   
ref|XP_006468104.1|  PREDICTED: beta-amyrin synthase-like isoform X1  76.6    1e-14   
gb|AAC17070.1|  Strong similarity to lupeol synthase gb|U49919 fr...  76.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAC98864.1|  pentacyclic triterpene synthase                       76.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178017.2|  lupeol synthase 2                                   76.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADK12003.1|  beta-amyrin synthase                                  76.6    2e-14   
gb|KDO39700.1|  hypothetical protein CISIN_1g048587mg                 72.8    2e-14   
dbj|BAE43643.1|  putative oxidosqulene cyclase                        76.6    2e-14   Euphorbia tirucalli
gb|KDO41126.1|  hypothetical protein CISIN_1g031897mg                 72.8    2e-14   
ref|XP_007023363.1|  Terpenoid cyclases family protein                77.0    2e-14   
gb|AAG41762.1|AF099968_1  pentacyclic triterpene synthase             76.6    2e-14   
ref|XP_006389936.1|  hypothetical protein EUTSA_v10018166mg           76.6    2e-14   
ref|XP_002887124.1|  ATLUP2                                           76.6    2e-14   
ref|XP_006364890.1|  PREDICTED: beta-amyrin synthase-like             76.6    2e-14   
ref|XP_006364889.1|  PREDICTED: delta-amyrin synthase-like            76.6    2e-14   
ref|XP_010531947.1|  PREDICTED: camelliol C synthase-like isoform X1  76.3    2e-14   
gb|ABA01561.1|  beta-amyrin synthase                                  73.2    2e-14   Bupleurum falcatum
gb|AFF27505.1|  beta-amyrin synthase                                  76.3    2e-14   
gb|KHN16704.1|  Lupeol synthase                                       76.3    2e-14   
ref|XP_010539601.1|  PREDICTED: camelliol C synthase-like isoform X4  76.3    2e-14   
ref|XP_003530475.1|  PREDICTED: lupeol synthase isoform 1             76.3    2e-14   
ref|XP_010531948.1|  PREDICTED: camelliol C synthase-like isoform X2  76.3    2e-14   
ref|XP_010539600.1|  PREDICTED: camelliol C synthase-like isoform X3  76.3    2e-14   
ref|XP_010539599.1|  PREDICTED: camelliol C synthase-like isoform X2  76.3    2e-14   
gb|AHX97777.1|  beta-amyrin synthase                                  76.3    2e-14   
ref|XP_010539597.1|  PREDICTED: camelliol C synthase-like isoform X1  76.3    2e-14   
gb|ABL07607.1|  beta-amyrin synthase                                  76.3    3e-14   Polygala tenuifolia [Chinese senega-root]
ref|XP_008465828.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  75.5    3e-14   
ref|XP_010539602.1|  PREDICTED: camelliol C synthase-like isoform X5  76.3    3e-14   
gb|AIU41743.1|  beta-amyrin synthase                                  75.9    3e-14   
gb|KFK33872.1|  hypothetical protein AALP_AA5G071200                  75.9    3e-14   
emb|CDX88494.1|  BnaC06g39380D                                        75.9    3e-14   
ref|XP_010534788.1|  PREDICTED: seco-amyrin synthase-like             75.9    3e-14   
gb|AAC17080.1|  Strong similarity to lupeol synthase gb|U49919 an...  76.3    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655670.1|  PREDICTED: beta-amyrin synthase                  75.9    3e-14   
ref|XP_004289557.1|  PREDICTED: beta-amyrin synthase-like             75.9    3e-14   
ref|XP_002270051.2|  PREDICTED: beta-amyrin synthase                  75.9    3e-14   Vitis vinifera
ref|XP_010655672.1|  PREDICTED: beta-amyrin synthase isoform X2       75.9    3e-14   
ref|XP_002269395.2|  PREDICTED: beta-amyrin synthase isoform X1       75.9    3e-14   Vitis vinifera
emb|CBI30890.3|  unnamed protein product                              75.9    3e-14   
emb|CBI18393.3|  unnamed protein product                              75.9    3e-14   
ref|XP_006436398.1|  hypothetical protein CICLE_v10033377mg           75.5    3e-14   
ref|XP_010245752.1|  PREDICTED: taraxerol synthase-like               75.9    4e-14   
gb|KFK42270.1|  hypothetical protein AALP_AA2G234200                  75.9    4e-14   
ref|XP_002265019.2|  PREDICTED: beta-amyrin synthase-like             75.5    4e-14   Vitis vinifera
dbj|BAG82628.1|  beta-amyrin synthase                                 75.5    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178016.2|  beta-amyrin synthase                                75.5    4e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94022.1|  putative lupeol synthase                             74.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532332.1|  PREDICTED: camelliol C synthase-like             75.5    4e-14   
ref|NP_683508.1|  camelliol C synthase 1                              75.5    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048520.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  75.5    4e-14   
emb|CDY57947.1|  BnaA07g38460D                                        75.5    4e-14   
ref|XP_009104558.1|  PREDICTED: amyrin synthase LUP2-like             75.5    4e-14   
ref|XP_009106614.1|  PREDICTED: amyrin synthase LUP2                  75.5    4e-14   
emb|CDX87419.1|  BnaA07g34540D                                        75.5    4e-14   
ref|XP_006374736.1|  hypothetical protein POPTR_0014s00370g           75.5    5e-14   
ref|XP_006374737.1|  hypothetical protein POPTR_0014s00370g           75.5    5e-14   
gb|KCW80789.1|  hypothetical protein EUGRSUZ_C02165                   75.1    5e-14   
gb|KFK42271.1|  hypothetical protein AALP_AA2G234300                  75.1    5e-14   
gb|KDO47544.1|  hypothetical protein CISIN_1g020852mg                 73.2    5e-14   
emb|CDY72111.1|  BnaCnng76020D                                        73.9    6e-14   
ref|XP_009591746.1|  PREDICTED: beta-amyrin synthase-like             75.1    6e-14   
gb|EPS60486.1|  beta-amyrin synthase                                  74.7    6e-14   
ref|XP_006371457.1|  hypothetical protein POPTR_0019s10800g           75.1    6e-14   
sp|Q8W3Z2.1|LUPS_BETPL  RecName: Full=Lupeol synthase                 75.1    6e-14   
ref|XP_009379194.1|  PREDICTED: beta-amyrin synthase                  75.1    7e-14   
ref|NP_001280946.1|  beta-amyrin synthase                             75.1    7e-14   
gb|AIK19225.1|  triterpene synthase                                   74.7    7e-14   
ref|XP_006409183.1|  hypothetical protein EUTSA_v10022563mg           74.7    7e-14   
ref|XP_008228020.1|  PREDICTED: beta-amyrin synthase-like             74.7    8e-14   
ref|XP_007214981.1|  hypothetical protein PRUPE_ppa001830mg           74.7    8e-14   
emb|CAN82129.1|  hypothetical protein VITISV_040666                   74.7    8e-14   
ref|XP_002887763.1|  ATLUP2                                           74.7    8e-14   
ref|XP_006468107.1|  PREDICTED: beta-amyrin synthase-like             74.7    8e-14   
ref|XP_004303791.1|  PREDICTED: beta-amyrin synthase-like             74.7    9e-14   
ref|XP_006416800.1|  hypothetical protein EUTSA_v10007055mg           74.3    9e-14   
ref|XP_006436395.1|  hypothetical protein CICLE_v10030771mg           74.3    9e-14   
gb|ABY90140.2|  beta-amyrin synthase                                  74.3    9e-14   
emb|CAN65908.1|  hypothetical protein VITISV_001241                   74.3    1e-13   
ref|XP_006409184.1|  hypothetical protein EUTSA_v10022563mg           74.3    1e-13   
gb|EPS65499.1|  beta-amyrin synthase                                  74.3    1e-13   
ref|XP_007014713.1|  Beta-Amyrin Synthase isoform 2                   74.3    1e-13   
ref|XP_006495457.1|  PREDICTED: beta-amyrin synthase-like             69.3    1e-13   
ref|XP_007014712.1|  Beta-Amyrin Synthase isoform 1                   74.3    1e-13   
ref|XP_006436400.1|  hypothetical protein CICLE_v10031967mg           72.8    1e-13   
ref|XP_009149097.1|  PREDICTED: amyrin synthase LUP2-like             74.3    1e-13   
emb|CDY35103.1|  BnaA06g11130D                                        74.3    1e-13   
ref|XP_002889222.1|  hypothetical protein ARALYDRAFT_316793           74.7    1e-13   
ref|NP_176868.1|  Terpenoid cyclases family protein                   74.3    1e-13   
ref|XP_010655249.1|  PREDICTED: beta-amyrin synthase                  73.9    1e-13   
emb|CBI18408.3|  unnamed protein product                              73.9    1e-13   
ref|XP_010537757.1|  PREDICTED: camelliol C synthase-like isoform X3  73.9    1e-13   
ref|XP_002513299.1|  Cycloartenol synthase, putative                  73.9    1e-13   
emb|CAN60786.1|  hypothetical protein VITISV_015054                   73.9    1e-13   
ref|XP_010537756.1|  PREDICTED: camelliol C synthase-like isoform X2  73.9    1e-13   
gb|ACH88048.1|  beta-amyrin synthase                                  73.9    2e-13   
ref|XP_009779991.1|  PREDICTED: beta-amyrin synthase-like             73.9    2e-13   
ref|XP_006301366.1|  hypothetical protein CARUB_v10021777mg           73.6    2e-13   
ref|XP_010537755.1|  PREDICTED: camelliol C synthase-like isoform X1  73.6    2e-13   
gb|KCW71124.1|  hypothetical protein EUGRSUZ_F04226                   70.9    2e-13   
ref|XP_007147801.1|  hypothetical protein PHAVU_006G156100g           73.6    2e-13   
dbj|BAF63702.1|  mixed amyrin synthase                                73.6    2e-13   
ref|XP_006436402.1|  hypothetical protein CICLE_v100339301mg          73.2    2e-13   
ref|XP_010067480.1|  PREDICTED: lupeol synthase-like                  72.8    3e-13   
ref|XP_010245747.1|  PREDICTED: beta-amyrin synthase-like isoform X2  72.8    3e-13   
ref|XP_007214975.1|  hypothetical protein PRUPE_ppa001797mg           73.2    3e-13   
gb|KDP37007.1|  hypothetical protein JCGZ_06063                       73.2    3e-13   
gb|KDP37006.1|  hypothetical protein JCGZ_06062                       73.2    3e-13   
ref|XP_009334975.1|  PREDICTED: beta-amyrin synthase-like             73.2    3e-13   
gb|AFP95334.2|  mixed amyrin synthase                                 73.2    3e-13   
ref|XP_008368666.1|  PREDICTED: beta-amyrin synthase-like             73.2    3e-13   
ref|XP_010245746.1|  PREDICTED: beta-amyrin synthase-like isoform X1  72.8    3e-13   
gb|KEH25840.1|  beta-amyrin synthase                                  72.8    3e-13   
ref|XP_007147809.1|  hypothetical protein PHAVU_006G156700g           72.8    3e-13   
emb|CAN64506.1|  hypothetical protein VITISV_022911                   72.4    4e-13   
gb|KCW88519.1|  hypothetical protein EUGRSUZ_A009022                  71.6    4e-13   
gb|KCW88518.1|  hypothetical protein EUGRSUZ_A009022                  72.0    4e-13   
ref|XP_010429762.1|  PREDICTED: amyrin synthase LUP2-like             72.8    4e-13   
ref|XP_007202928.1|  hypothetical protein PRUPE_ppa016625mg           72.4    4e-13   
ref|XP_011031246.1|  PREDICTED: beta-amyrin synthase-like             72.8    4e-13   
ref|XP_002310351.1|  hypothetical protein POPTR_0007s15210g           72.8    4e-13   
ref|XP_010417509.1|  PREDICTED: camelliol C synthase                  72.4    4e-13   
ref|XP_006351975.1|  PREDICTED: beta-amyrin synthase-like             72.4    4e-13   
ref|XP_010417511.1|  PREDICTED: amyrin synthase LUP2-like isoform X2  72.4    4e-13   
ref|XP_010417510.1|  PREDICTED: amyrin synthase LUP2-like isoform X1  72.4    4e-13   
ref|XP_010417512.1|  PREDICTED: amyrin synthase LUP2-like isoform X3  72.4    4e-13   
ref|XP_006300770.1|  hypothetical protein CARUB_v10019849mg           72.4    5e-13   
ref|XP_010472735.1|  PREDICTED: amyrin synthase LUP2 isoform X2       72.4    5e-13   
ref|XP_006436396.1|  hypothetical protein CICLE_v10033368mg           72.4    5e-13   
ref|XP_010472733.1|  PREDICTED: amyrin synthase LUP2 isoform X1       72.4    5e-13   
gb|EYU25764.1|  hypothetical protein MIMGU_mgv1a024154mg              72.4    5e-13   
ref|XP_010429765.1|  PREDICTED: amyrin synthase LUP2-like isoform X1  72.4    5e-13   
ref|XP_010429766.1|  PREDICTED: amyrin synthase LUP2-like isoform X2  72.4    5e-13   
ref|XP_009106612.1|  PREDICTED: camelliol C synthase                  72.4    6e-13   
ref|XP_010472731.1|  PREDICTED: camelliol C synthase-like isoform X1  72.4    6e-13   
ref|XP_010533174.1|  PREDICTED: seco-amyrin synthase-like             72.0    6e-13   
emb|CDX88493.1|  BnaC06g39370D                                        72.0    6e-13   
ref|XP_006389937.1|  hypothetical protein EUTSA_v10018165mg           72.0    7e-13   
ref|XP_010531955.1|  PREDICTED: camelliol C synthase-like isoform X5  72.0    7e-13   
ref|XP_010472732.1|  PREDICTED: camelliol C synthase-like isoform X2  72.0    7e-13   
ref|XP_003521100.1|  PREDICTED: beta-amyrin synthase-like isoformX1   72.0    7e-13   
ref|XP_010531956.1|  PREDICTED: beta-amyrin synthase-like isoform X6  71.6    7e-13   
ref|XP_010531953.1|  PREDICTED: camelliol C synthase-like isoform X3  71.6    8e-13   
ref|XP_010531957.1|  PREDICTED: beta-amyrin synthase-like isoform X7  71.6    8e-13   
ref|XP_004173097.1|  PREDICTED: beta-amyrin synthase-like             70.5    8e-13   
ref|XP_010531954.1|  PREDICTED: camelliol C synthase-like isoform X4  71.6    8e-13   
ref|XP_010669612.1|  PREDICTED: lupeol synthase-like                  71.6    8e-13   
ref|XP_008465723.1|  PREDICTED: beta-amyrin synthase-like isoform X2  71.6    8e-13   
ref|XP_008465722.1|  PREDICTED: beta-amyrin synthase-like isoform X1  71.6    9e-13   
ref|XP_002519670.1|  cycloartenol synthase, putative                  70.9    9e-13   
ref|XP_006300769.1|  hypothetical protein CARUB_v10019844mg           71.6    9e-13   
ref|XP_010054047.1|  PREDICTED: beta-amyrin synthase-like             71.6    9e-13   
ref|XP_004301515.1|  PREDICTED: beta-amyrin synthase-like             71.2    9e-13   
ref|XP_010531952.1|  PREDICTED: camelliol C synthase-like isoform X2  71.6    9e-13   
ref|XP_010531951.1|  PREDICTED: camelliol C synthase-like isoform X1  71.6    1e-12   
ref|XP_008240807.1|  PREDICTED: lupeol synthase-like                  71.6    1e-12   
ref|NP_193272.1|  baruol synthase 1                                   71.6    1e-12   
emb|CBI18383.3|  unnamed protein product                              68.6    1e-12   
ref|XP_010095206.1|  Lupeol synthase                                  71.2    1e-12   
gb|KDP37004.1|  hypothetical protein JCGZ_06060                       71.2    1e-12   
ref|XP_006306840.1|  hypothetical protein CARUB_v10008384mg           71.2    1e-12   
gb|KCW89781.1|  hypothetical protein EUGRSUZ_A02035                   71.2    1e-12   
ref|XP_004143785.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amyrin ...  71.6    1e-12   
ref|XP_006468103.1|  PREDICTED: beta-amyrin synthase-like             71.2    1e-12   
ref|XP_007153005.1|  hypothetical protein PHAVU_004G178500g           71.2    1e-12   
ref|XP_007147802.1|  hypothetical protein PHAVU_006G156200g           70.9    2e-12   
gb|KDP37001.1|  hypothetical protein JCGZ_06057                       70.9    2e-12   
gb|AGA17940.1|  beta-amyrin synthase                                  70.9    2e-12   
ref|XP_002887740.1|  hypothetical protein ARALYDRAFT_316749           70.9    2e-12   
ref|XP_006598332.1|  PREDICTED: beta-amyrin synthase-like             70.5    2e-12   
dbj|BAA86932.1|  lupeol synthase                                      70.5    2e-12   
gb|KHN33083.1|  Beta-amyrin synthase                                  70.5    2e-12   
ref|XP_002863840.1|  predicted protein                                70.5    3e-12   
ref|XP_004243674.1|  PREDICTED: lupeol synthase isoform X1            70.1    3e-12   
emb|CDY20917.1|  BnaC06g01370D                                        69.3    3e-12   
ref|XP_007148270.1|  hypothetical protein PHAVU_006G1942000g          69.7    3e-12   
ref|XP_004305790.1|  PREDICTED: beta-amyrin synthase-like             70.1    3e-12   
ref|XP_007148271.1|  hypothetical protein PHAVU_006G1942000g          70.1    3e-12   
ref|XP_006353758.1|  PREDICTED: lupeol synthase-like                  70.1    3e-12   
ref|XP_010245756.1|  PREDICTED: beta-amyrin synthase-like             70.1    3e-12   
ref|XP_002537149.1|  cycloartenol synthase, putative                  67.0    4e-12   
gb|KHN00954.1|  Lupeol synthase                                       69.7    4e-12   
ref|XP_006606308.1|  PREDICTED: lupeol synthase-like isoform X1       69.7    4e-12   
ref|XP_008368669.1|  PREDICTED: lupeol synthase-like                  68.9    4e-12   
ref|XP_010252186.1|  PREDICTED: lupeol synthase-like                  69.7    4e-12   
ref|XP_010656690.1|  PREDICTED: lupeol synthase isoform X3            69.7    4e-12   
ref|XP_010656689.1|  PREDICTED: lupeol synthase isoform X2            69.7    4e-12   
ref|XP_002269060.2|  PREDICTED: lupeol synthase isoform X1            69.7    4e-12   
emb|CAN60556.1|  hypothetical protein VITISV_020304                   69.7    4e-12   
ref|XP_006374735.1|  hypothetical protein POPTR_0014s003601g          69.3    4e-12   
ref|XP_010927166.1|  PREDICTED: cycloartenol synthase-like isofor...  69.7    4e-12   
ref|XP_010927164.1|  PREDICTED: cycloartenol Synthase-like isofor...  69.7    4e-12   
ref|XP_010927163.1|  PREDICTED: cycloartenol synthase-like isofor...  69.7    4e-12   
emb|CBI24038.3|  unnamed protein product                              69.7    4e-12   
ref|XP_002887743.1|  hypothetical protein ARALYDRAFT_477013           69.7    4e-12   
emb|CAA75588.1|  cycloartenol synthase                                68.9    4e-12   
ref|XP_007147812.1|  hypothetical protein PHAVU_006G156900g           69.3    5e-12   
emb|CAN62602.1|  hypothetical protein VITISV_041317                   69.3    5e-12   
gb|KEH27290.1|  beta-amyrin synthase                                  69.7    5e-12   
sp|A8C981.1|TARS_RHISY  RecName: Full=Taraxerol synthase; Short=RsM2  69.7    5e-12   
ref|XP_010449945.1|  PREDICTED: baruol synthase isoform X2            69.7    5e-12   
ref|XP_010434995.1|  PREDICTED: baruol synthase-like                  69.7    5e-12   
ref|XP_010449944.1|  PREDICTED: baruol synthase isoform X1            69.7    5e-12   
gb|KDP37003.1|  hypothetical protein JCGZ_06059                       68.2    5e-12   
ref|XP_002527335.1|  Cycloartenol synthase, putative                  69.3    5e-12   
ref|XP_007147805.1|  hypothetical protein PHAVU_006G156500g           69.3    5e-12   
ref|XP_010449947.1|  PREDICTED: baruol synthase isoform X3            69.3    5e-12   
gb|KDO47542.1|  hypothetical protein CISIN_1g0264001mg                64.3    6e-12   
sp|Q9LRH8.1|BAMS_PEA  RecName: Full=Beta-amyrin synthase              69.3    6e-12   
ref|XP_009364429.1|  PREDICTED: beta-amyrin synthase-like             69.3    6e-12   
ref|XP_007147811.1|  hypothetical protein PHAVU_006G156900g           69.3    7e-12   
ref|NP_199612.3|  thalianol synthase 1                                68.9    7e-12   
dbj|BAB11065.1|  cycloartenol synthase                                68.9    7e-12   
ref|NP_001078733.1|  thalianol synthase 1                             68.9    8e-12   
dbj|BAE99758.1|  cycloartenol synthase                                68.9    8e-12   
ref|XP_002445263.1|  hypothetical protein SORBIDRAFT_07g007030        68.9    9e-12   
ref|XP_009786280.1|  PREDICTED: lupeol synthase                       68.6    1e-11   
dbj|BAE53430.1|  lupeol synthase                                      68.6    1e-11   
gb|AHY94897.1|  cycloartenol synthase                                 68.6    1e-11   
gb|KEH25838.1|  beta-amyrin synthase                                  68.6    1e-11   
ref|XP_007160210.1|  hypothetical protein PHAVU_002G302200g           68.6    1e-11   
ref|XP_007147800.1|  hypothetical protein PHAVU_006G156000g           68.6    1e-11   
ref|XP_010545605.1|  PREDICTED: seco-amyrin synthase-like             68.2    1e-11   
ref|XP_008455450.1|  PREDICTED: LOW QUALITY PROTEIN: isomultiflor...  67.0    1e-11   
ref|XP_008465724.1|  PREDICTED: lupeol synthase-like                  67.8    1e-11   
gb|AGA17939.1|  lupeol synthase                                       68.2    1e-11   
ref|XP_010112462.1|  hypothetical protein L484_013846                 68.2    2e-11   
ref|XP_007147808.1|  hypothetical protein PHAVU_006G1566000g          67.8    2e-11   
ref|XP_004143825.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  67.8    2e-11   
ref|XP_007147807.1|  hypothetical protein PHAVU_006G1566000g          67.8    2e-11   
ref|NP_567462.1|  pentacyclic triterpene synthase 1                   67.8    2e-11   
ref|NP_001054993.2|  Os05g0237700                                     65.1    2e-11   
ref|XP_006598306.1|  PREDICTED: beta-amyrin synthase-like             67.4    2e-11   
ref|XP_002868209.1|  hypothetical protein ARALYDRAFT_493357           67.4    2e-11   
dbj|BAF33292.1|  arabidiol synthase                                   67.4    3e-11   
ref|XP_004166111.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  67.4    3e-11   
ref|NP_177971.1|  pentacyclic triterpene synthase 6                   67.4    3e-11   
gb|KHN38796.1|  Beta-amyrin synthase                                  67.0    3e-11   
ref|XP_002449432.1|  hypothetical protein SORBIDRAFT_05g011020        65.9    3e-11   
ref|XP_010554308.1|  PREDICTED: seco-amyrin synthase-like             66.2    3e-11   
ref|XP_006285622.1|  hypothetical protein CARUB_v10007073mg           67.0    4e-11   
gb|ABG22398.1|  Cycloartenol synthase, putative, expressed            66.6    4e-11   
gb|AAX95229.1|  Similar to cycloartenol synthase                      65.1    4e-11   
ref|NP_001176396.1|  Os11g0189600                                     66.6    5e-11   
gb|EEC78818.1|  hypothetical protein OsI_19100                        63.2    5e-11   
ref|XP_009623450.1|  PREDICTED: LOW QUALITY PROTEIN: lupeol synth...  65.9    5e-11   
sp|H2KWF1.1|PAKSY_ORYSJ  RecName: Full=Parkeol synthase               66.6    5e-11   
ref|XP_010669609.1|  PREDICTED: lupeol synthase-like                  66.6    6e-11   
gb|KHG17418.1|  Beta-Amyrin Synthase 1                                63.5    6e-11   
ref|XP_007134028.1|  hypothetical protein PHAVU_010G013200g           66.2    6e-11   
ref|XP_010313692.1|  PREDICTED: delta-amyrin synthase-like isofor...  66.2    7e-11   
ref|XP_010435607.1|  PREDICTED: seco-amyrin synthase-like isoform X6  66.2    8e-11   
ref|XP_004251564.1|  PREDICTED: beta-amyrin synthase-like isoform X1  66.2    8e-11   
sp|Q764T8.1|LUPS_GLYGL  RecName: Full=Lupeol synthase; Short=GgLUS1   66.2    8e-11   
dbj|BAL41371.1|  lupeol synthase                                      66.2    8e-11   
ref|XP_010435604.1|  PREDICTED: seco-amyrin synthase-like isoform X3  66.2    8e-11   
ref|XP_010450523.1|  PREDICTED: seco-amyrin synthase-like             65.9    8e-11   
ref|XP_010435606.1|  PREDICTED: seco-amyrin synthase-like isoform X5  65.9    8e-11   
ref|XP_010435605.1|  PREDICTED: seco-amyrin synthase-like isoform X4  65.9    8e-11   
ref|XP_007225523.1|  hypothetical protein PRUPE_ppa025507mg           65.9    9e-11   
ref|XP_010435602.1|  PREDICTED: seco-amyrin synthase-like isoform X1  65.9    9e-11   
gb|KHN32929.1|  Cycloartenol synthase                                 65.9    9e-11   
dbj|BAA23533.1|  cycloartenol synthase                                65.9    9e-11   
sp|Q9SXV6.1|CAS1_GLYGL  RecName: Full=Cycloartenol synthase           65.9    9e-11   
ref|XP_003610947.1|  Cycloartenol synthase                            65.9    9e-11   
ref|XP_010435603.1|  PREDICTED: seco-amyrin synthase-like isoform X2  65.9    9e-11   
gb|EYU26854.1|  hypothetical protein MIMGU_mgv1a003300mg              65.5    1e-10   
dbj|BAA84603.1|  oxidosqualene cyclase                                65.9    1e-10   
dbj|BAB83089.1|  putative oxidosqualene cyclase                       65.5    1e-10   
ref|XP_002887067.1|  predicted protein                                65.1    1e-10   
ref|XP_010472070.1|  PREDICTED: seco-amyrin synthase                  65.5    1e-10   
ref|XP_010112461.1|  hypothetical protein L484_013845                 65.5    1e-10   
emb|CDP17720.1|  unnamed protein product                              65.5    1e-10   
ref|XP_002453282.1|  hypothetical protein SORBIDRAFT_04g003190        65.5    1e-10   
ref|XP_003516849.1|  PREDICTED: cycloartenol synthase                 65.5    1e-10   
gb|AAT38891.1|  cycloartenol synthase                                 65.5    1e-10   
gb|AAT38889.1|  cycloartenol synthase                                 65.5    1e-10   
gb|AAT38887.1|  cycloartenol synthase                                 65.5    1e-10   
gb|AAT38892.1|  cycloartenol synthase                                 65.5    1e-10   



>emb|CDP17248.1| unnamed protein product [Coffea canephora]
 emb|CDP05547.1| unnamed protein product [Coffea canephora]
Length=139

 Score = 92.0 bits (227),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDFK M+RHFTKGSWTFSDQDQGLAVSDCTA+ALKCL+   ++  EIAGEK
Sbjct  70   KGDFKKMYRHFTKGSWTFSDQDQGLAVSDCTAEALKCLLRFSEMPQEIAGEK  121



>emb|CDP20865.1| unnamed protein product [Coffea canephora]
Length=303

 Score = 92.8 bits (229),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDFK M+RHFTKGSWTFSDQDQGLAVSDCTA+ALKCL+   ++  EIAGEK
Sbjct  234  KGDFKKMYRHFTKGSWTFSDQDQGLAVSDCTAEALKCLLRFSEMPQEIAGEK  285



>emb|CDP10664.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDFK M+RHFTKGSWTFSDQDQG  VSDCTA+ALKCL+L  Q+  EIAGEK
Sbjct  456  KGDFKKMYRHFTKGSWTFSDQDQGWVVSDCTAEALKCLLLFSQMPQEIAGEK  507



>emb|CDP12624.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDFKSM+RHFTKGSWTFSDQDQG  VSDCTA++LKCL++L Q+  EI+G+K
Sbjct  456  KGDFKSMYRHFTKGSWTFSDQDQGWVVSDCTAESLKCLLMLSQMPTEISGKK  507



>gb|EYU33367.1| hypothetical protein MIMGU_mgv1a001775mg [Erythranthe guttata]
Length=761

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDF+ M+RHFTKG+WTFSDQDQG  VSDCTA+ALKCL+LL Q+  EI+GEK
Sbjct  456  KGDFRGMYRHFTKGAWTFSDQDQGWVVSDCTAEALKCLLLLSQMPAEISGEK  507



>gb|EYU34015.1| hypothetical protein MIMGU_mgv1a021513mg [Erythranthe guttata]
Length=727

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGDF+ M+RHFTKG+WTFSDQDQG  VSDCTA+ALKCL+LL Q+  EI+GEK
Sbjct  456  KGDFRGMYRHFTKGAWTFSDQDQGWVVSDCTAEALKCLLLLSQMPTEISGEK  507



>ref|XP_011096562.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
 ref|XP_011096564.1| PREDICTED: dammarenediol II synthase-like [Sesamum indicum]
Length=761

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            KGD  +M+RHFTKG+WTFSDQDQG  VSDCTA+ALKCL+LL Q+  EIAGEK
Sbjct  456  KGDHTAMYRHFTKGAWTFSDQDQGWVVSDCTAEALKCLLLLSQMPTEIAGEK  507



>gb|AEX99665.1| amyrin synthase [Catharanthus roseus]
Length=762

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            K DFK+M+RHFTKGSWTFSDQDQG  VSDCTA+ALKCL++  Q+  ++AGEK
Sbjct  457  KEDFKAMYRHFTKGSWTFSDQDQGWVVSDCTAEALKCLLVCSQMPQDLAGEK  508



>gb|AFJ19235.1| mixed amyrin synthase [Catharanthus roseus]
Length=762

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            K DFK+M+RHFTKGSWTFSDQDQG  VSDCTA+ALKCL++  Q+  ++AGEK
Sbjct  457  KEDFKAMYRHFTKGSWTFSDQDQGWVVSDCTAEALKCLLVCSQMPQDLAGEK  508



>gb|AIS39793.1| mixed amyrin synthase 1 [Ilex asprella var. asprella]
Length=762

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD  +M+RHFTKGSWTFSDQDQG  VSDCTA+ALKCL++L Q+  E+AGEK
Sbjct  457  GDHMAMYRHFTKGSWTFSDQDQGWVVSDCTAEALKCLLVLSQMPQEMAGEK  507



>ref|XP_010053899.1| PREDICTED: beta-Amyrin Synthase 1-like [Eucalyptus grandis]
Length=494

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RHF+KGSWTFSDQDQG  +SDCTA+ L C +L  Q+ PEI GEK
Sbjct  193  GDFQSMYRHFSKGSWTFSDQDQGWQLSDCTAEGLTCCLLFSQMPPEIVGEK  243



>ref|XP_003531781.1| PREDICTED: beta-amyrin synthase-like isoform 1 [Glycine max]
Length=762

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA++LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLLSMLPPEIVGEK  508



>ref|XP_009344148.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA++LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLLSMMPPEIVGEK  508



>gb|KEH18380.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +SPEI GEK
Sbjct  458  GDFESMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLSPEIVGEK  508



>gb|AHF49822.1| bAS [Maesa lanceolata]
Length=760

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  VSDCTA+ LKC ++L Q+ PE+ GEK
Sbjct  459  GDFKKMFRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLMLSQLPPELVGEK  509



>ref|XP_008353811.1| PREDICTED: LOW QUALITY PROTEIN: beta-amyrin synthase-like [Malus 
domestica]
Length=547

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPEIVGEK  508



>gb|KHN38108.1| Beta-amyrin synthase [Glycine soja]
Length=783

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA++LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLLSMLPPEIVGEK  508



>gb|AAS01523.1| putative beta-amyrin synthase [Centella asiatica]
Length=760

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD+ SM R+FTKGSWTFSDQDQG  VSDCTA+ALKCL+ L Q+  EIAGEK
Sbjct  458  GDYASMCRYFTKGSWTFSDQDQGWVVSDCTAEALKCLLALSQMPEEIAGEK  508



>ref|XP_010091128.1| Beta-amyrin synthase [Morus notabilis]
 gb|EXB42563.1| Beta-amyrin synthase [Morus notabilis]
Length=877

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTADALKC ++   + PEI GEK
Sbjct  461  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTADALKCCLIFSLMPPEIVGEK  511



>gb|KCW78276.1| hypothetical protein EUGRSUZ_D02459 [Eucalyptus grandis]
Length=729

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RHF+KGSWTFSDQDQG  +SDCTA+ L C +L  Q+ PEI GEK
Sbjct  428  GDFQSMYRHFSKGSWTFSDQDQGWQLSDCTAEGLTCCLLFSQMPPEIVGEK  478



>ref|XP_010054896.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=732

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RHF+KGSWTFSDQDQG  +SDCTA+ L C +L  Q+ PEI GEK
Sbjct  431  GDFQSMYRHFSKGSWTFSDQDQGWQLSDCTAEGLTCCLLFSQMPPEIVGEK  481



>ref|XP_009347735.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=760

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPEIVGEK  508



>ref|XP_008362478.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=750

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPEIVGEK  508



>ref|XP_003627088.1| Beta-amyrin synthase [Medicago truncatula]
Length=472

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +SPEI GEK
Sbjct  59   GDFESMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLSPEIVGEK  109



>sp|Q9MB42.1|BAMS_GLYGL RecName: Full=Beta-amyrin synthase [Glycyrrhiza glabra]
 dbj|BAA89815.1| beta-amyrin synthase [Glycyrrhiza glabra]
Length=765

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|ADE88148.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>ref|XP_010063691.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70924.1| hypothetical protein EUGRSUZ_F04039 [Eucalyptus grandis]
Length=761

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMRPEIVGEK  507



>gb|ACV21067.1| beta-amyrin synthase [Glycyrrhiza uralensis]
Length=762

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHVSKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|KHG28038.1| Beta-amyrin synthase [Gossypium arboreum]
Length=693

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  VSDCTA+ LKC +L+  + PEI GEK
Sbjct  393  GDFKQMFRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLMSMLPPEIVGEK  443



>ref|XP_008342939.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=389

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA  LKC +LL  + PE+ GEK
Sbjct  221  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAXGLKCCLLLSMMPPEMVGEK  271



>ref|XP_008365698.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=760

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  +SDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQLSDCTAEGLKCCLLLSMMPPEIVGEK  508



>gb|AET01567.2| beta-amyrin synthase [Medicago truncatula]
Length=728

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  424  GDFESMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  474



>sp|Q9LRH7.1|ABAMS_PEA RecName: Full=Mixed-amyrin synthase [Pisum sativum]
 dbj|BAA97559.1| mixed-amyrin synthase [Pisum sativum]
Length=764

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA++LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDKDHGWQVSDCTAESLKCCLLLSMLPPEIVGEK  508



>ref|XP_003627091.1| Beta-amyrin synthase [Medicago truncatula]
Length=718

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  414  GDFESMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  464



>gb|ADX01169.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=643

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            KGDF +M RHFTKG+WTFSDQDQG AVSDCTA+ LKCL+L+ Q+  E  GE
Sbjct  332  KGDFHAMHRHFTKGAWTFSDQDQGWAVSDCTAEGLKCLLLMSQMPNEARGE  382



>gb|KCW83375.1| hypothetical protein EUGRSUZ_B00308 [Eucalyptus grandis]
Length=706

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  402  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  452



>gb|AAO33578.1|AF478453_1 beta-amyrin synthase [Medicago truncatula]
Length=762

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>ref|XP_003604121.1| Beta-amyrin synthase [Medicago truncatula]
 emb|CAD23247.1| beta-amyrin synthase [Medicago truncatula]
 gb|AES86318.1| beta-amyrin synthase [Medicago truncatula]
Length=762

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>ref|XP_011031247.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
 ref|XP_011031248.1| PREDICTED: beta-amyrin synthase [Populus euphratica]
Length=760

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GE+
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPEIVGEQ  508



>ref|XP_006582958.1| PREDICTED: beta-amyrin synthase isoform X1 [Glycine max]
Length=762

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|KHN39383.1| Beta-amyrin synthase [Glycine soja]
Length=773

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|ADM86392.1| putative beta-amyrin synthase [Bacopa monnieri]
Length=764

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            KGDF +M RHFTKG+WTFSDQDQG AVSDCTA+ LKCL+L+ Q+  E  GE
Sbjct  453  KGDFHAMHRHFTKGAWTFSDQDQGWAVSDCTAEGLKCLLLMSQMPNEARGE  503



>ref|XP_010027785.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW83384.1| hypothetical protein EUGRSUZ_B00318 [Eucalyptus grandis]
Length=761

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>ref|XP_008362476.1| PREDICTED: beta-amyrin synthase-like, partial [Malus domestica]
Length=765

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G   SDCTA+ LKC +LL  + PEI GEK
Sbjct  595  GDFKSMYRHISKGSWTFSDQDHGWQXSDCTAEGLKCCLLLSMMPPEIVGEK  645



>ref|XP_010027664.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
Length=761

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>ref|NP_001236591.1| beta-amyrin synthase [Glycine max]
 gb|AAM23264.1| beta-amyrin synthase [Glycine max]
Length=739

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  435  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  485



>ref|XP_010027674.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=755

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>gb|AHI17180.1| beta-amyrin synthase, partial [Glycine max]
Length=762

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|KEH28511.1| beta-amyrin synthase [Medicago truncatula]
Length=764

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQDQG  +SDCTA+ LKC + L  + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDQGWQLSDCTAEGLKCCLHLSMLPPEIVGEK  508



>ref|XP_008228023.1| PREDICTED: beta-amyrin synthase [Prunus mume]
Length=761

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMRPEIIGEK  508



>gb|AEJ79821.1| beta-amyrin synthase AS2 [Eleutherococcus senticosus]
Length=408

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM R FTKGSW FSDQD G  VSDCTA+ALKCL+LL ++  EIAGEK
Sbjct  205  GDFESMCRLFTKGSWAFSDQDHGWVVSDCTAEALKCLLLLSRMPTEIAGEK  255



>emb|CDP15852.1| unnamed protein product [Coffea canephora]
Length=757

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KG+WTFSDQD G  VSDCTA+ALKC +L   + PEI GEK
Sbjct  455  GDFRSMYRHISKGAWTFSDQDHGWQVSDCTAEALKCCLLFSTMPPEIVGEK  505



>gb|AAS83468.1| beta-armyrin synthase [Bupleurum kaoi]
Length=762

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   +SPEI G+K
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMSPEIVGKK  508



>ref|XP_007214979.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
 gb|EMJ16178.1| hypothetical protein PRUPE_ppa001817mg [Prunus persica]
Length=761

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMRPEIIGEK  508



>gb|ADM89633.1| beta-amyrin synthase [Bupleurum chinense]
Length=762

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   +SPEI G+K
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMSPEIVGKK  508



>ref|XP_010065065.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=512

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  208  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  258



>ref|XP_007023608.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY26230.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=758

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC +L+  + PEI GEK
Sbjct  458  GDFKKMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLMSMLPPEIVGEK  508



>ref|XP_003604122.1| Beta-amyrin synthase [Medicago truncatula]
 gb|AES86319.1| beta-amyrin synthase [Medicago truncatula]
Length=670

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEIVGEK  508



>gb|ACA13386.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ALKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFATMPPEIVGEK  507



>gb|ACB87531.1| beta-amyrin synthase [Artemisia annua]
Length=761

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ALKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFATMPPEIVGEK  507



>ref|XP_008353809.1| PREDICTED: LOW QUALITY PROTEIN: beta-amyrin synthase-like [Malus 
domestica]
Length=699

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE  GEK
Sbjct  397  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPEXVGEK  447



>ref|XP_004488915.1| PREDICTED: beta-amyrin synthase-like [Cicer arietinum]
Length=762

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPEVVGEK  508



>gb|AHF22084.1| OSC2 [Artemisia annua]
Length=760

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF  M R FTKG+WTFSDQDQG  VSDCTA+ALKCL+LL Q+  EI+G+K
Sbjct  457  GDFSKMCRQFTKGAWTFSDQDQGWVVSDCTAEALKCLLLLSQMPEEISGKK  507



>ref|XP_009344015.1| PREDICTED: beta-amyrin synthase [Pyrus x bretschneideri]
Length=761

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  508



>ref|XP_009369010.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  508



>ref|XP_006380842.1| hypothetical protein POPTR_0007s15180g [Populus trichocarpa]
 gb|ERP58639.1| hypothetical protein POPTR_0007s15180g [Populus trichocarpa]
Length=625

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GE+
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEQ  508



>ref|XP_008380417.1| PREDICTED: beta-amyrin synthase-like [Malus domestica]
Length=599

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  328  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  378



>ref|XP_010696136.1| PREDICTED: beta-amyrin synthase-like [Beta vulgaris subsp. vulgaris]
Length=764

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC ++L  + PEI GEK
Sbjct  459  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLILSTMPPEIVGEK  509



>ref|XP_007214978.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
 gb|EMJ16177.1| hypothetical protein PRUPE_ppa001812mg [Prunus persica]
Length=761

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + P+I GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMRPDIVGEK  508



>ref|XP_009612988.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612989.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612990.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
 ref|XP_009612991.1| PREDICTED: beta-amyrin synthase [Nicotiana tomentosiformis]
Length=761

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ALKC +L   + PE+ GE
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSTMPPELVGE  506



>dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli]
Length=762

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  508



>gb|KCW70932.1| hypothetical protein EUGRSUZ_F04049 [Eucalyptus grandis]
Length=720

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI G+K
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGDK  507



>gb|KCW70935.1| hypothetical protein EUGRSUZ_F04052 [Eucalyptus grandis]
Length=710

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  480  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  530



>sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS [Bruguiera gymnorhiza]
 dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza]
Length=759

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GE
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGE  507



>ref|XP_002310349.1| beta-Amyrin synthase family protein [Populus trichocarpa]
 gb|EEE90799.1| beta-Amyrin synthase family protein [Populus trichocarpa]
Length=760

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GE+
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEQ  508



>ref|XP_009337925.1| PREDICTED: beta-amyrin synthase-like, partial [Pyrus x bretschneideri]
Length=722

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  508



>ref|XP_010063688.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70933.1| hypothetical protein EUGRSUZ_F04050 [Eucalyptus grandis]
Length=761

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD G  VSDCTA+ L+C +L   + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHGWQVSDCTAEGLRCCLLFSMMPPEIVGEK  507



>ref|XP_010063692.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 ref|XP_010063693.1| PREDICTED: beta-amyrin synthase [Eucalyptus grandis]
 gb|KCW70922.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
 gb|KCW70923.1| hypothetical protein EUGRSUZ_F04038 [Eucalyptus grandis]
Length=761

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>ref|XP_010065064.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=698

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  394  GDFQSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  444



>gb|KEH22226.1| beta-amyrin synthase [Medicago truncatula]
Length=704

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM RH +KG+WTFSDQD G  VSDCTAD LKC +LL  + PEI GE
Sbjct  393  GDFKSMHRHISKGAWTFSDQDHGWQVSDCTADGLKCCLLLSMLPPEIVGE  442



>sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; Short=StrBOS [Stevia 
rebaudiana]
 dbj|BAH23676.1| baccharis oxide synthase [Stevia rebaudiana]
Length=761

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH TKGSWTFSDQD G   SDCT + LKC +LL ++S EI GEK
Sbjct  457  GDFKSMYRHITKGSWTFSDQDHGWQTSDCTTEGLKCCLLLSKMSAEIVGEK  507



>gb|KCW70929.1| hypothetical protein EUGRSUZ_F04042 [Eucalyptus grandis]
Length=587

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM RH TKGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  283  GDFQSMHRHITKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  333



>gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica]
Length=760

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC ++L  + PEI GEK
Sbjct  459  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLVLSTMPPEIVGEK  509



>ref|XP_002527337.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF35089.1| Cycloartenol synthase, putative [Ricinus communis]
Length=741

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KG+WTFSD+DQG  VSDCTA++LKC +L   + PEI GEK
Sbjct  457  GDFRKMFRHISKGAWTFSDKDQGWQVSDCTAESLKCCLLFSMMPPEIVGEK  507



>sp|A8C980.1|GERS_RHISY RecName: Full=Germanicol synthase; Short=RsM1 [Rhizophora stylosa]
 dbj|BAF80441.1| multifunctional triterpene synthase [Rhizophora stylosa]
Length=759

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GE
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGE  507



>gb|ABC33922.1| beta-amyrin synthase, partial [Gypsophila paniculata]
Length=594

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC ++L  + PEI GEK
Sbjct  293  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLVLSTMPPEIVGEK  343



>sp|Q2XPU7.1|LUPS_RICCO RecName: Full=Lupeol synthase [Ricinus communis]
 gb|ABB76766.1| lupeol synthase [Ricinus communis]
Length=769

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KG+WTFSD+DQG  VSDCTA++LKC +L   + PEI GEK
Sbjct  457  GDFRKMFRHISKGAWTFSDKDQGWQVSDCTAESLKCCLLFSMMPPEIVGEK  507



>ref|XP_006374734.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
 gb|ERP52531.1| hypothetical protein POPTR_0014s00350g [Populus trichocarpa]
Length=762

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ +KC +L   + PEI G+K
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGMKCCLLFSMMPPEIVGQK  508



>ref|XP_010065062.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
 gb|KCW70925.1| hypothetical protein EUGRSUZ_F04040 [Eucalyptus grandis]
Length=761

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>gb|KHN38795.1| Beta-amyrin synthase [Glycine soja]
Length=630

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQDQG  VSDCTA+ L C +LL  +  EI GEK
Sbjct  326  GDFKSMYRHISKGSWTFSDQDQGWQVSDCTAETLNCCLLLSILPSEIVGEK  376



>ref|XP_009379199.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  +SDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQLSDCTAEGLKCCLLLSMMPPELVGEK  508



>gb|EYU38890.1| hypothetical protein MIMGU_mgv1a001796mg [Erythranthe guttata]
Length=758

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PE+ GEK
Sbjct  454  GDFRSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPELVGEK  504



>ref|XP_011085901.1| PREDICTED: beta-amyrin synthase-like [Sesamum indicum]
Length=763

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + P+I GEK
Sbjct  457  GDFRSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPDIVGEK  507



>gb|AIE17465.1| oxidosqualene cyclase [Centella asiatica]
Length=761

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKSMHRHVSKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>ref|XP_011093795.1| PREDICTED: beta-amyrin synthase [Sesamum indicum]
Length=763

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + P+I GEK
Sbjct  457  GDFRSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPDIVGEK  507



>gb|KEH33351.1| beta-amyrin synthase [Medicago truncatula]
Length=697

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + P+I GEK
Sbjct  397  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSVLPPKIVGEK  447



>emb|CBI18402.3| unnamed protein product [Vitis vinifera]
Length=355

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCT + LKC +L  +++P+I G K
Sbjct  187  GDFKSMYRHISKGSWTFSDQDHGCQVSDCTTEGLKCCLLFSRMAPKIVGMK  237



>ref|XP_002269328.2| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=773

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  461  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTK  511



>gb|AET01563.2| beta-amyrin synthase [Medicago truncatula]
Length=757

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD++SM+RH +KGSWTFSDQD G +VSDCTA+ LKC +LL  + PEI G++
Sbjct  452  GDYESMYRHMSKGSWTFSDQDHGWSVSDCTAEGLKCCLLLSMLPPEIVGKR  502



>emb|CDP08999.1| unnamed protein product [Coffea canephora]
Length=759

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFRSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSTMPPEIVGEK  507



>gb|AAO33580.1|AF478455_1 multifunctional beta-amyrin synthase [Lotus japonicus]
Length=762

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KG+WTFSDQD G  VSDCTA+  KC +LL  + PEI GEK
Sbjct  458  GDFKSMHRHISKGAWTFSDQDHGWQVSDCTAEGFKCCLLLSMLPPEIVGEK  508



>ref|XP_003521102.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Glycine max]
 ref|XP_006576766.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Glycine max]
Length=762

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQDQG  VSDCTA+ L C +LL  +  EI GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDQGWQVSDCTAETLNCCLLLSILPSEIVGEK  508



>gb|ACO24697.1| beta-amyrin synthase [Gentiana straminea]
Length=755

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GE+
Sbjct  457  GDFKSMYRHMSKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSTMPQEIVGER  507



>gb|AGS16975.1| dammarenediol synthase II [Panax vietnamensis]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|AGK62449.1| dammarenediol-II synthase [Panax quinquefolius]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>dbj|BAD15332.1| beta-amyrin synthase [Panax ginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|AED99864.1| DS synthase [Panax quinquefolius]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|AJC01928.1| dammarenediol synthase, partial [Panax ginseng]
Length=380

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  71   RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  122



>gb|AJC01930.1| dammarenediol synthase, partial [Panax ginseng]
Length=371

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  71   RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  122



>gb|AJC01929.1| dammarenediol synthase, partial [Panax ginseng]
Length=367

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  60   RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  111



>emb|CBI18395.3| unnamed protein product [Vitis vinifera]
Length=512

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  200  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMTPEIVGMK  250



>gb|AGI15962.1| dammarenediol synthase [Panax quinquefolius]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|KDP37005.1| hypothetical protein JCGZ_06061 [Jatropha curcas]
Length=317

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KG+W FSD+D G  VSDCTA++LKC +L   + PEI GEK
Sbjct  136  GDFKRMFRHISKGAWAFSDKDHGWQVSDCTAESLKCCLLFSMMPPEIVGEK  186



>gb|ACZ71036.1| dammarenediol synthase protein [Panax ginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>emb|CDP17993.1| unnamed protein product [Coffea canephora]
Length=299

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+F+ M+RH +KG+WTFSDQD G  VSDCTA+ALKC +L   + PEI GEK
Sbjct  66   GNFRRMYRHISKGAWTFSDQDHGWQVSDCTAEALKCCLLFSTLPPEIVGEK  116



>emb|CBI18407.3| unnamed protein product [Vitis vinifera]
Length=846

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI G K
Sbjct  546  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGVK  596



>ref|XP_002513298.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF48701.1| Cycloartenol synthase, putative [Ricinus communis]
Length=744

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   +  EI GEK
Sbjct  459  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPSEIVGEK  509



>gb|AIK21788.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|AGS79229.1| dammarenediol-II synthase [Panax notoginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>gb|AEO27862.1| dammarenediol synthase [Panax ginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>ref|XP_009779988.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779989.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
 ref|XP_009779990.1| PREDICTED: beta-amyrin synthase [Nicotiana sylvestris]
Length=761

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ALKC +L   + PE+ GE
Sbjct  457  GDFKGMYRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSTMPPELVGE  506



>gb|AJC01927.1| dammarenediol synthase, partial [Panax ginseng]
 gb|AJC01931.1| dammarenediol synthase, partial [Panax ginseng]
Length=380

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  71   RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  122



>ref|XP_002270934.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
 ref|XP_010655248.1| PREDICTED: beta-amyrin synthase [Vitis vinifera]
Length=757

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI G K
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGVK  507



>emb|CBI18382.3| unnamed protein product [Vitis vinifera]
Length=885

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  573  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGTK  623


 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 1/51 (2%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+R+  KGSWTF D+D G  VS+CT  +LKC  LL  + PEI GEK
Sbjct  18   GDFRSMYRYIFKGSWTFLDRDHGWQVSNCTTKSLKC-CLLSVMPPEIVGEK  67



>gb|AGI19258.1| dammarenediol synthase [Panax notoginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>sp|Q08IT1.1|DADIS_PANGI RecName: Full=Dammarenediol II synthase [Panax ginseng]
 dbj|BAF33291.1| dammarenediol-II synthase [Panax ginseng]
Length=769

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD G  VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHGCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>ref|XP_007214977.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
 gb|EMJ16176.1| hypothetical protein PRUPE_ppa001810mg [Prunus persica]
Length=761

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + P+I GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSTMRPDIVGEK  508



>emb|CAN65909.1| hypothetical protein VITISV_001242 [Vitis vinifera]
Length=729

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI G K
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGVK  507



>gb|AAO33579.1|AF478454_1 putative beta-amyrin synthase [Lotus japonicus]
Length=750

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK+M RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + P+I GEK
Sbjct  446  GDFKNMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPDIVGEK  496



>emb|CAN60316.1| hypothetical protein VITISV_012054 [Vitis vinifera]
Length=664

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  364  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  414



>ref|XP_010655316.1| PREDICTED: beta-Amyrin Synthase 1-like [Vitis vinifera]
Length=518

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  206  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  256



>gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius]
Length=761

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GE
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSNMPPEIVGE  506



>gb|KCW70930.1| hypothetical protein EUGRSUZ_F04043 [Eucalyptus grandis]
Length=628

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD    V DCTA+ LKC +LL  + PEI GEK
Sbjct  343  GDFKSMHRHITKGSWTFSDQDHSWQVYDCTAEGLKCCLLLSMMRPEIVGEK  393



>ref|XP_009379200.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=756

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSD TAD LKC +LL  + PE+ GEK
Sbjct  453  GDFKSMHRHISKGSWTFSDQDHGWQVSDSTADGLKCCLLLSMMPPEMVGEK  503



>sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS [Kalanchoe daigremontiana]
 gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana]
Length=779

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PE+ GEK
Sbjct  477  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSLMPPELVGEK  527



>dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus]
Length=762

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK+M RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  + P+I GEK
Sbjct  458  GDFKNMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPDIVGEK  508



>ref|XP_006435524.1| hypothetical protein CICLE_v10010884mg, partial [Citrus clementina]
 gb|ESR48764.1| hypothetical protein CICLE_v10010884mg, partial [Citrus clementina]
Length=551

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  465  GDFKRMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEK  515



>ref|XP_010063690.1| PREDICTED: beta-amyrin synthase-like [Eucalyptus grandis]
Length=761

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH TKGSWTFSDQD    V DCTA+ LKC +LL  + PEI GEK
Sbjct  457  GDFKSMHRHITKGSWTFSDQDHSWQVYDCTAEGLKCCLLLSMMRPEIVGEK  507



>gb|AIK19223.1| triterpene synthase [Eugenia uniflora]
Length=761

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  457  GDFKRMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEIVGEK  507



>ref|XP_007023364.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY25986.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=761

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  VSDCTA++LKC +   ++ PE  GEK
Sbjct  457  GDFKRMFRHISKGSWTFSDQDHGWQVSDCTAESLKCCLYFSKMPPETVGEK  507



>ref|XP_007023369.1| Beta-Amyrin Synthase [Theobroma cacao]
 gb|EOY25991.1| Beta-Amyrin Synthase [Theobroma cacao]
Length=707

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  VSDCTA++LKC +   ++ PE  GEK
Sbjct  466  GDFKRMFRHISKGSWTFSDQDHGWQVSDCTAESLKCCLYFSKMPPETVGEK  516



>gb|KDO48982.1| hypothetical protein CISIN_1g006042mg [Citrus sinensis]
Length=663

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD+K  FRHF+KG+WTFSDQD G  VSDCTA+ LKC++ L  + PEI GEK
Sbjct  361  GDYKGNFRHFSKGAWTFSDQDHGWQVSDCTAEGLKCVLQLSLMPPEIVGEK  411



>gb|KHG20016.1| Lupeol synthase [Gossypium arboreum]
 gb|KHG22561.1| Lupeol synthase [Gossypium arboreum]
Length=355

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSD+D G  VSDCTA++LKC +    ++PE+ GEK
Sbjct  49   GDFKKMFRHISKGSWTFSDRDHGWQVSDCTAESLKCCLYFSMMAPEMVGEK  99



>emb|CBI18406.3| unnamed protein product [Vitis vinifera]
Length=910

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  598  GDFKSMYRHISKGSWTFSDKDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  648



>ref|XP_002299271.2| hypothetical protein POPTR_0001s14610g [Populus trichocarpa]
 gb|EEE84076.2| hypothetical protein POPTR_0001s14610g [Populus trichocarpa]
Length=750

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA+++KC +L   + PEI GEK
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESMKCCLLFSTMPPEIVGEK  507



>sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase [Betula platyphylla]
 dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla]
Length=779

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI GEK
Sbjct  458  GDFESMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSIMPPEIVGEK  508



>gb|KHG20017.1| Lupeol synthase [Gossypium arboreum]
 gb|KHG22562.1| Lupeol synthase [Gossypium arboreum]
Length=359

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSD+D G  VSDCTA++LKC +    ++PE+ GEK
Sbjct  49   GDFKKMFRHISKGSWTFSDRDHGWQVSDCTAESLKCCLYFSMMAPEMVGEK  99



>ref|XP_011034490.1| PREDICTED: lupeol synthase-like isoform X1 [Populus euphratica]
Length=759

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA+++KC +L   + PEI GEK
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESMKCCLLFSTMPPEIVGEK  507



>ref|XP_007216254.1| hypothetical protein PRUPE_ppa017215mg, partial [Prunus persica]
 gb|EMJ17453.1| hypothetical protein PRUPE_ppa017215mg, partial [Prunus persica]
Length=634

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSW FSDQD G  VSDCTA+ LKC +L   + P+I GEK
Sbjct  299  GDFKSMYRHISKGSWIFSDQDHGWQVSDCTAEGLKCCLLFSMMRPDIVGEK  349



>ref|XP_006488698.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=829

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  465  GDFKRMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEK  515



>ref|XP_006468116.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=761

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD+K  FRHF+KG+WTFSDQD G  VSDCTA+ LKC++ L  + PEI GEK
Sbjct  459  GDYKGNFRHFSKGAWTFSDQDHGWQVSDCTAEGLKCVLQLSLMPPEIVGEK  509



>ref|XP_006450022.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
 gb|ESR63262.1| hypothetical protein CICLE_v10013952mg [Citrus clementina]
Length=761

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD+K  FRHF+KG+WTFSDQD G  VSDCTA+ LKC++ L  + PEI GEK
Sbjct  459  GDYKGNFRHFSKGAWTFSDQDHGWQVSDCTAEGLKCVLQLSLMPPEIVGEK  509



>ref|XP_006488602.1| PREDICTED: beta-amyrin synthase-like [Citrus sinensis]
Length=781

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  475  GDFKRMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEK  525



>ref|XP_002530442.1| Cycloartenol synthase, putative [Ricinus communis]
 gb|EEF31912.1| Cycloartenol synthase, putative [Ricinus communis]
Length=757

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSMFRH +KGSWTFSD+DQG  VSDCTA+ LKC +L   +   I GEK
Sbjct  457  GDFKSMFRHISKGSWTFSDKDQGWQVSDCTAEGLKCCLLFSMMPSNIVGEK  507



>ref|XP_006425178.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
 gb|ESR38418.1| hypothetical protein CICLE_v10027855mg [Citrus clementina]
Length=785

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  465  GDFKRMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPTEIVGEK  515



>gb|KHG26534.1| Lupeol synthase [Gossypium arboreum]
Length=399

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSD+D G  VSDCTA++LKC +    ++PE+ GEK
Sbjct  82   GDFKKMFRHISKGSWTFSDRDHGWQVSDCTAESLKCCLYFSMMAPEMVGEK  132



>gb|AIS39794.1| mixed amyrin synthase 2 [Ilex asprella var. asprella]
Length=761

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   +  EI GEK
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSLMPQEIVGEK  507



>ref|XP_004510379.1| PREDICTED: mixed-amyrin synthase-like [Cicer arietinum]
Length=762

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KGSWTFSD+D G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  458  GDFRSMYRHISKGSWTFSDRDHGWQVSDCTAEGLKCCLLLSMLPSEIVGEK  508



>sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLUS [Bruguiera gymnorhiza]
 dbj|BAF80444.1| lupeol synthase [Bruguiera gymnorhiza]
Length=761

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA++LKC +L   + PE+ GEK
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESLKCCLLFSMMPPELVGEK  507



>ref|XP_010245751.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Nelumbo nucifera]
Length=667

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  +SDCTA+ALK  ++   + PEI GEK
Sbjct  361  GDFKRMFRHISKGSWTFSDQDHGWQISDCTAEALKACLMFSLMPPEIVGEK  411



>gb|AGG09939.1| beta-amyrin synthase [Panax quinquefolius]
 gb|AGK62450.1| beta-amyrin synthase [Panax quinquefolius]
Length=761

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ALKC +L  ++  EI G+K
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSRMPTEIVGDK  507



>gb|KHG26533.1| Lupeol synthase [Gossypium arboreum]
Length=388

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSD+D G  VSDCTA++LKC +    ++PE+ GEK
Sbjct  82   GDFKKMFRHISKGSWTFSDRDHGWQVSDCTAESLKCCLYFSMMAPEMVGEK  132



>ref|XP_010429761.1| PREDICTED: beta-amyrin synthase [Camelina sativa]
Length=759

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WTFSD+D G  VSDCTAD LKC +L   ++P+I G K
Sbjct  459  GDFKSMYRHISKGAWTFSDRDHGWQVSDCTADGLKCCLLFSMLAPDIVGPK  509



>ref|XP_010245750.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Nelumbo nucifera]
Length=736

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  +SDCTA+ALK  ++   + PEI GEK
Sbjct  457  GDFKRMFRHISKGSWTFSDQDHGWQISDCTAEALKACLMFSLMPPEIVGEK  507



>ref|XP_006368910.1| hypothetical protein POPTR_0001s146002g, partial [Populus trichocarpa]
 gb|ERP65479.1| hypothetical protein POPTR_0001s146002g, partial [Populus trichocarpa]
Length=665

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA+++KC +L   + PEI GEK
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESMKCCLLFSTMPPEIVGEK  507



>ref|XP_010245749.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Nelumbo nucifera]
Length=763

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KGSWTFSDQD G  +SDCTA+ALK  ++   + PEI GEK
Sbjct  457  GDFKRMFRHISKGSWTFSDQDHGWQISDCTAEALKACLMFSLMPPEIVGEK  507



>gb|KDP25031.1| hypothetical protein JCGZ_22566 [Jatropha curcas]
Length=1170

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153   GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
             GDFKSM RH +KGSWTFSDQDQ   VSDCTA+ LKC +L   + PEI G+K
Sbjct  991   GDFKSMHRHISKGSWTFSDQDQEWQVSDCTAEGLKCCLLFSMMPPEIVGDK  1041


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEI  13
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +L   + PEI
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMPPEI  504



>sp|O82146.1|BAMS2_PANGI RecName: Full=Beta-Amyrin Synthase 2 [Panax ginseng]
 dbj|BAA33722.1| beta-Amyrin Synthase [Panax ginseng]
Length=761

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ALKC +L  ++  EI G+K
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSRMPTEIVGDK  507



>gb|AGG09938.1| beta-amyrin synthase, partial [Panax quinquefolius]
 gb|AGK27803.1| beta-amyrin synthase, partial [Panax quinquefolius]
Length=692

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQDQG  VSDCTA+ LKC ++  ++  EI G++
Sbjct  388  GDFKSMYRHISKGSWTFSDQDQGWQVSDCTAEGLKCCLIFSRMPEEIVGKR  438



>ref|XP_002271333.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655244.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655245.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
 ref|XP_010655246.1| PREDICTED: beta-Amyrin Synthase 1 isoform X1 [Vitis vinifera]
Length=769

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  457  GDFKSMYRHISKGSWTFSDKDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  507



>ref|XP_010655247.1| PREDICTED: beta-Amyrin Synthase 1 isoform X2 [Vitis vinifera]
Length=735

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  457  GDFKSMYRHISKGSWTFSDKDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  507



>emb|CAN77299.1| hypothetical protein VITISV_033299 [Vitis vinifera]
Length=755

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  443  GDFKSMYRHISKGSWTFSDKDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  493



>gb|AIK21791.1| beta-amyrin synthase, partial [Panax notoginseng]
Length=709

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQDQG  VSDCTA+ LKC ++  ++  EI G++
Sbjct  405  GDFKSMYRHISKGSWTFSDQDQGWQVSDCTAEGLKCCLIFSRMPEEIVGKR  455



>ref|XP_010531942.1| PREDICTED: beta-amyrin synthase-like [Tarenaya hassleriana]
Length=760

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH ++G+WTFSDQD G  VSDCTA+ +KC +LL  +SPE+ G K
Sbjct  459  GDFKGMYRHISRGAWTFSDQDHGWQVSDCTAEGIKCCLLLSMMSPEVVGPK  509



>ref|XP_006368912.1| hypothetical protein POPTR_0001s14610g [Populus trichocarpa]
 gb|ERP65481.1| hypothetical protein POPTR_0001s14610g [Populus trichocarpa]
Length=767

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA+++KC +L   + PEI GEK
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESMKCCLLFSTMPPEIVGEK  507



>gb|KDP36999.1| hypothetical protein JCGZ_06055 [Jatropha curcas]
Length=546

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KG+W FSD+D G  VSDCTA++LKC +L   + PEI GEK
Sbjct  258  GDFKRMFRHISKGAWAFSDKDHGWQVSDCTAESLKCCLLFSMMPPEIVGEK  308



>ref|XP_010052732.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052734.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052735.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 ref|XP_010052736.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Eucalyptus grandis]
 gb|KCW76806.1| hypothetical protein EUGRSUZ_D01163 [Eucalyptus grandis]
Length=761

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+FKSM RH +KGSWTFSDQD G  VSDCTA++LKC +L   + P+I GEK
Sbjct  457  GNFKSMHRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLFSMMPPDIVGEK  507



>ref|XP_010655243.1| PREDICTED: beta-Amyrin Synthase 1 [Vitis vinifera]
 emb|CBI18392.3| unnamed protein product [Vitis vinifera]
Length=769

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++P+I G K
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPKIVGMK  507



>gb|ACM89978.1| putative beta amyrin synthase [Malus domestica]
Length=762

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSD TAD LKC +LL  + PE+ GE+
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDSTADGLKCCLLLSMMPPEMVGEQ  508



>sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS [Kalanchoe daigremontiana]
 gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana]
Length=765

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KG+WTFSDQD G  VSDCTA+ LKC +L   + PE+ GE
Sbjct  458  GDFKGMYRHISKGAWTFSDQDHGWQVSDCTAEGLKCCLLFSMMQPEVVGE  507



>gb|AAD05032.1| lupeol synthase [Arabidopsis thaliana]
Length=757

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KG+WTFSD+D G  VSDCTA+ALKC +LL  +S +I G+K
Sbjct  456  GDFRSMYRHISKGAWTFSDRDHGWQVSDCTAEALKCCLLLSMMSADIGGQK  506



>gb|AIE17466.1| oxidosqualene cyclase [Centella asiatica]
Length=764

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ALKC +L  ++  EI G K
Sbjct  460  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSRMPSEIVGNK  510



>ref|NP_178018.1| lupeol synthase 1 [Arabidopsis thaliana]
 ref|NP_849903.1| lupeol synthase 1 [Arabidopsis thaliana]
 sp|Q9C5M3.1|LUP1_ARATH RecName: Full=Lupeol synthase 1; Short=AtLUP1; AltName: Full=Lupan-3-beta,20-diol 
synthase [Arabidopsis thaliana]
 gb|AAK25857.1|AF360147_1 putative lupeol synthase [Arabidopsis thaliana]
 gb|AAK96549.1| At1g78970/YUP8H12R_28 [Arabidopsis thaliana]
 gb|AAN13216.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36186.1| lupeol synthase 1 [Arabidopsis thaliana]
 gb|AEE36187.1| lupeol synthase 1 [Arabidopsis thaliana]
Length=757

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KG+WTFSD+D G  VSDCTA+ALKC +LL  +S +I G+K
Sbjct  456  GDFRSMYRHISKGAWTFSDRDHGWQVSDCTAEALKCCLLLSMMSADIVGQK  506



>emb|CBI18386.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAG  7
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC +L   ++PEI G
Sbjct  82   GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVG  130



>gb|AAC17055.1| Strong similarity to lupeol synthase gb|U49919 from A. thaliana, 
Landsberg strain. The cDNA gb|ATU49919 may come from this 
gene. EST gb|T22249 and gb|N96338 come from this gene (first 
gene in a series of three) [Arabidopsis thaliana]
Length=830

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH +KG+WTFSD+D G  VSDCTA+ALKC +LL  +S +I G+K
Sbjct  529  GDFRSMYRHISKGAWTFSDRDHGWQVSDCTAEALKCCLLLSMMSADIVGQK  579



>gb|KDO47541.1| hypothetical protein CISIN_1g0264001mg, partial [Citrus sinensis]
Length=90

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF+SMFRH +KG WTFSD+D GL VSDC++++  C + L  + PEI GEK
Sbjct  22   QGDFRSMFRHISKGGWTFSDKDHGLPVSDCSSESFVCCLHLSTMPPEIVGEK  73



>ref|XP_004507562.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Cicer arietinum]
Length=762

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH  KGSWTFSDQD G  ++D TA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHICKGSWTFSDQDHGWQITDGTAEGLKCCLLLSMLPPEIVGEK  508



>gb|KFK40207.1| hypothetical protein AALP_AA3G344300 [Arabis alpina]
Length=763

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSD+D G  VSDCTA+ALKC +LL  +  ++ G+K
Sbjct  459  GDFKSMYRHISKGSWTFSDRDHGWQVSDCTAEALKCCMLLSMMPSDVVGQK  509



>ref|XP_010052737.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Eucalyptus grandis]
Length=672

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+FKSM RH +KGSWTFSDQD G  VSDCTA++LKC +L   + P+I GEK
Sbjct  457  GNFKSMHRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLFSMMPPDIVGEK  507



>ref|XP_010052738.1| PREDICTED: beta-amyrin synthase-like isoform X3 [Eucalyptus grandis]
Length=666

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+FKSM RH +KGSWTFSDQD G  VSDCTA++LKC +L   + P+I GEK
Sbjct  457  GNFKSMHRHISKGSWTFSDQDHGWQVSDCTAESLKCCLLFSMMPPDIVGEK  507



>ref|XP_007135871.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
 gb|ESW07865.1| hypothetical protein PHAVU_010G165100g [Phaseolus vulgaris]
Length=763

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  458  GDFKGMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSTLPQEIVGEK  508



>ref|XP_002888561.1| hypothetical protein ARALYDRAFT_475791 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64820.1| hypothetical protein ARALYDRAFT_475791 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG WT SDQDQG  VSDCTA+A KC +LL  + P++ G+K
Sbjct  460  GDFKSMYRHISKGGWTLSDQDQGWQVSDCTAEAAKCCMLLSTMPPDVIGKK  510



>sp|E2IUA7.1|GLUTS_KALDA RecName: Full=Glutinol synthase; Short=KdGLS [Kalanchoe daigremontiana]
 gb|ADK35124.1| glutinol synthase [Kalanchoe daigremontiana]
Length=767

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDF+SM+RH +KGSWTFSDQD G  +SDCTA+ LKC +L   + PE+ GE
Sbjct  458  GDFRSMYRHISKGSWTFSDQDHGWQLSDCTAEGLKCCLLFSLMQPEVVGE  507



>emb|CAN72474.1| hypothetical protein VITISV_009966 [Vitis vinifera]
Length=578

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTF DQD G  VSDCTA+ LKC +L   ++PEI G K
Sbjct  294  GDFKSMYRHISKGSWTFLDQDHGWQVSDCTAEGLKCCLLFSMMAPEIVGMK  344



>ref|XP_004305793.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=769

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  E  GEK
Sbjct  460  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPSETVGEK  510



>gb|AGC82084.1| beta amyrn synthase [Azadirachta indica]
Length=760

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD+ S FRHF+KG+WTFSDQD G  VSDCTA++LKC +    + PEI GEK
Sbjct  459  GDYTSNFRHFSKGAWTFSDQDHGWQVSDCTAESLKCCLHFSMLPPEIVGEK  509



>ref|XP_004507563.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Cicer arietinum]
Length=670

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH  KGSWTFSDQD G  ++D TA+ LKC +LL  + PEI GEK
Sbjct  458  GDFKSMYRHICKGSWTFSDQDHGWQITDGTAEGLKCCLLLSMLPPEIVGEK  508



>ref|XP_009344016.1| PREDICTED: beta-amyrin synthase-like [Pyrus x bretschneideri]
Length=761

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  +SD TA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWTLSDSTAEGLKCCLLLSMMPPELVGEK  508



>ref|XP_004305792.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=764

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M RH +KGSWTFSDQD G  VSDCTA+ LKC +LL  +  EI GEK
Sbjct  461  GDFKCMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSMMPSEIVGEK  511



>gb|AED99865.1| DS synthase [Panax notoginseng]
Length=769

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF  M R FTKG+WTFSDQD    VSDCTA+ALKCL+LL Q+  +I GEK
Sbjct  460  RGDFLKMCRQFTKGAWTFSDQDHXCVVSDCTAEALKCLLLLSQMPQDIVGEK  511



>sp|O82140.1|BAMS1_PANGI RecName: Full=Beta-Amyrin Synthase 1 [Panax ginseng]
 dbj|BAA33461.1| beta-Amyrin Synthase [Panax ginseng]
Length=763

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC ++   +  EI G+K
Sbjct  459  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKK  509



>ref|XP_008365649.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGS TFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSXTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  508



>ref|XP_008380418.1| PREDICTED: beta-amyrin synthase [Malus domestica]
Length=761

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGS TFSDQD G  VSDCTA+ LKC +LL  + PE+ GEK
Sbjct  458  GDFKSMHRHISKGSXTFSDQDHGWQVSDCTAEGLKCCLLLSMMPPELVGEK  508



>dbj|BAF35580.1| multifunctional triterpene synthase [Kandelia candel]
Length=761

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+ MFRH +KGSWTFSD+D G  VSDCTA++LKC +L   + PE+ G K
Sbjct  457  GDFRRMFRHISKGSWTFSDKDHGWQVSDCTAESLKCCLLFSMMPPELVGRK  507



>sp|E2IUA8.1|FRIES_KALDA RecName: Full=Friedelin synthase; Short=KdFRS [Kalanchoe daigremontiana]
 gb|ADK35125.1| friedelin synthase [Kalanchoe daigremontiana]
Length=767

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDF+SM+RH +KG+WTFSDQD G  +SDCTA+ LKC +L   + PE+ GE
Sbjct  458  GDFRSMYRHISKGAWTFSDQDHGWQLSDCTAEGLKCCLLFSLMQPEVVGE  507



>gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus]
Length=763

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC ++   +  EI G+K
Sbjct  459  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKK  509



>ref|NP_001234597.1| delta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN64.1|DAMS_SOLLC RecName: Full=Delta-amyrin synthase; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 2; Short=SlTTS2 [Solanum lycopersicum]
 gb|ADU52575.1| multifunctional triterpenoid synthase [Solanum lycopersicum]
Length=763

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSW F+DQD G  VSDCTA+ALKC +L   + PEI GE
Sbjct  457  GDFKVMYRHISKGSWAFADQDLGWQVSDCTAEALKCCLLFSTMPPEIVGE  506



>ref|XP_010313624.1| PREDICTED: beta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=761

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ALKC +LL  +  E+ G+
Sbjct  457  GDFKGMYRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLLSTMPRELVGQ  506



>ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum]
 sp|E7DN63.1|BAMS_SOLLC RecName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid 
synthase 1; Short=SlTTS1 [Solanum lycopersicum]
 gb|ADU52574.1| beta-amyrin synthase [Solanum lycopersicum]
Length=761

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ALKC +LL  +  E+ G+
Sbjct  457  GDFKGMYRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLLSTMPRELVGQ  506



>emb|CDX79277.1| BnaC06g20260D [Brassica napus]
Length=687

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D GL VSDCTA+ALKC +LL  +  E+ G++
Sbjct  379  GDFKSMYRHISKGAWTLSDRDHGLQVSDCTAEALKCCLLLSTMPSEVVGQQ  429



>gb|KFK42272.1| hypothetical protein AALP_AA2G234400 [Arabis alpina]
Length=759

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WTFSD+D G  VSDCTA  LKC +LL  ++P I G K
Sbjct  459  GDFKSMYRHISKGAWTFSDRDHGWQVSDCTAHGLKCCLLLSMMAPNIVGPK  509



>gb|AAB94341.1| 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana]
Length=757

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF+SM+RH  KG+WTFSD+D G  VSDCTA+ALKC +LL  +S +I G+K
Sbjct  456  GDFRSMYRHIWKGAWTFSDRDHGWQVSDCTAEALKCCLLLSMMSADIVGQK  506



>ref|XP_010313621.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010313622.1| PREDICTED: delta-amyrin synthase isoform X1 [Solanum lycopersicum]
Length=768

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSW F+DQD G  VSDCTA+ALKC +L   + PEI GE
Sbjct  457  GDFKVMYRHISKGSWAFADQDLGWQVSDCTAEALKCCLLFSTMPPEIVGE  506



>gb|AEJ79820.1| beta-amyrin synthase AS1 [Eleutherococcus senticosus]
Length=407

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSDCTA+ LKC ++   +  EI G+K
Sbjct  205  GDFKSMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLIFSTMPEEIFGKK  255



>gb|KEH17471.1| beta-amyrin synthase [Medicago truncatula]
Length=763

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  VSD TA+ LKC +LL    P   GEK
Sbjct  458  GDFKSMYRHISKGSWTFSDQDHGWQVSDSTAEGLKCCLLLSMFPPATVGEK  508



>ref|XP_008228019.1| PREDICTED: beta-amyrin synthase-like [Prunus mume]
Length=763

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDF S FRH +KG+WTFSDQD G  VSDCTA+ LKC +LL  + P++ GE+
Sbjct  460  GDFLSHFRHISKGAWTFSDQDHGWQVSDCTAEGLKCCLLLSMLPPQLVGEQ  510



>ref|XP_004309763.1| PREDICTED: beta-amyrin synthase-like [Fragaria vesca subsp. vesca]
Length=765

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  +SD TA+ LKC +LL  +  EI GEK
Sbjct  462  GDFKSMYRHISKGSWTFSDQDHGWQISDGTAEGLKCCLLLSMMPSEIVGEK  512



>dbj|BAF01935.1| putative lupeol synthase [Arabidopsis thaliana]
Length=555

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G+K
Sbjct  251  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCMLLSMMPAEVVGQK  301



>sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=AtaSHS [Aster tataricus]
 dbj|BAK52535.1| shionone synthase [Aster tataricus]
Length=761

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KGSWTFSDQD G  +SDCT   L C +LL  + PE  GEK
Sbjct  457  GDFKSMYRHISKGSWTFSDQDHGWQLSDCTTIGLTCCLLLSTMPPETVGEK  507



>ref|XP_006468105.1| PREDICTED: beta-amyrin synthase-like isoform X2 [Citrus sinensis]
Length=637

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF+SMFRH +KG WTFSD+D GL VSDC++++  C + L  + PEI GEK
Sbjct  459  QGDFRSMFRHISKGGWTFSDKDHGLPVSDCSSESFVCCLHLSTMPPEIVGEK  510



>gb|KDP25033.1| hypothetical protein JCGZ_22568 [Jatropha curcas]
Length=766

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK MFRH +KG+W FSDQD G  VSDCTA+ LKCL+   ++  EI GEK
Sbjct  456  GDFKGMFRHISKGAWPFSDQDHGWQVSDCTAEGLKCLLYASELPTEIIGEK  506



>ref|XP_002887764.1| hypothetical protein ARALYDRAFT_477065 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64023.1| hypothetical protein ARALYDRAFT_477065 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFKSM+RH +KG+WTFSD+D G  VSDCTA+ALKC +LL  +  +I G+
Sbjct  456  GDFKSMYRHISKGAWTFSDRDHGWQVSDCTAEALKCCLLLSMMPADIVGQ  505



>ref|XP_006468104.1| PREDICTED: beta-amyrin synthase-like isoform X1 [Citrus sinensis]
Length=761

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF+SMFRH +KG WTFSD+D GL VSDC++++  C + L  + PEI GEK
Sbjct  459  QGDFRSMFRHISKGGWTFSDKDHGLPVSDCSSESFVCCLHLSTMPPEIVGEK  510



>gb|AAC17070.1| Strong similarity to lupeol synthase gb|U49919 from A. thaliana 
(second gene in a series of three with similar homologies) 
[Arabidopsis thaliana]
Length=795

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G+K
Sbjct  459  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCMLLSMMPAEVVGQK  509



>gb|AAC98864.1| pentacyclic triterpene synthase, partial [Arabidopsis thaliana]
Length=683

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G+K
Sbjct  379  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCMLLSMMPAEVVGQK  429



>ref|NP_178017.2| lupeol synthase 2 [Arabidopsis thaliana]
 sp|Q8RWT0.1|LUP2_ARATH RecName: Full=Amyrin synthase LUP2; AltName: Full=Alpha-amyrin 
synthase; AltName: Full=Beta-amyrin synthase; AltName: Full=Lupeol 
synthase 2; Short=AtLUP2 [Arabidopsis thaliana]
 gb|AAM14080.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AAM45087.1| putative lupeol synthase [Arabidopsis thaliana]
 gb|AEE36185.1| lupeol synthase 2 [Arabidopsis thaliana]
Length=763

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G+K
Sbjct  459  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCMLLSMMPAEVVGQK  509



>gb|ADK12003.1| beta-amyrin synthase [Aralia elata]
Length=763

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ LKC ++   +  EI G+K
Sbjct  459  GDFKGMYRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKK  509



>gb|KDO39700.1| hypothetical protein CISIN_1g048587mg, partial [Citrus sinensis]
Length=150

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
             GDF+SMFRH +KG WTFS++D G  VSDCTA+AL C +    + PEI GEK
Sbjct  48   PGDFESMFRHTSKGGWTFSNKDHGWPVSDCTAEALLCCLYFSMLPPEIVGEK  99



>dbj|BAE43643.1| putative oxidosqulene cyclase [Euphorbia tirucalli]
Length=766

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GD KSMFRH +KG+WTFSD+D G  VSDCTA++LKC +L   +  EI GEK
Sbjct  457  GDHKSMFRHISKGAWTFSDKDHGWQVSDCTAESLKCCLLFSLMPSEIVGEK  507



>gb|KDO41126.1| hypothetical protein CISIN_1g031897mg [Citrus sinensis]
Length=151

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  KGDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            +GDF+SMFRH +KG WTFS++D G  VSDCTA+AL C +    + PEI GEK
Sbjct  48   QGDFRSMFRHISKGGWTFSNKDHGWQVSDCTAEALLCCLHFSMMRPEIVGEK  99



>ref|XP_007023363.1| Terpenoid cyclases family protein [Theobroma cacao]
 gb|EOY25985.1| Terpenoid cyclases family protein [Theobroma cacao]
Length=1130

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  150  DFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            DFK MFRH +KGSWTFSD+D G  VSDCTA++LKC +    + PE+ GEK
Sbjct  458  DFKRMFRHISKGSWTFSDRDHGWQVSDCTAESLKCCLYFAMMPPEMVGEK  507



>gb|AAG41762.1|AF099968_1 pentacyclic triterpene synthase [synthetic construct]
Length=763

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G+K
Sbjct  459  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCMLLSMMPAEVVGQK  509



>ref|XP_006389936.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
 gb|ESQ27222.1| hypothetical protein EUTSA_v10018166mg [Eutrema salsugineum]
Length=765

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+A+KC +LL  +  E+ G+K
Sbjct  464  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEAMKCCMLLSMMPAEVVGQK  514



>ref|XP_002887124.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63383.1| ATLUP2 [Arabidopsis lyrata subsp. lyrata]
Length=759

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G K
Sbjct  459  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCLLLSMMPAEVVGHK  509



>ref|XP_006364890.1| PREDICTED: beta-amyrin synthase-like [Solanum tuberosum]
Length=761

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSWTFSDQD G  VSDCTA+ALKC +L   +  E+ G+
Sbjct  457  GDFKGMYRHISKGSWTFSDQDHGWQVSDCTAEALKCCLLFSTMPRELVGQ  506



>ref|XP_006364889.1| PREDICTED: delta-amyrin synthase-like [Solanum tuberosum]
Length=760

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KGSW F+DQD G  VSDCTA+AL C +L   + PE+ GE
Sbjct  456  GDFKGMYRHISKGSWAFADQDHGWQVSDCTAEALTCCLLFSTMPPELVGE  505



>ref|XP_010531947.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=762

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  150  DFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            DFKSM+RH +KG+WTFSD+D G  VSDCTAD LKC ++L  + P++ G K
Sbjct  461  DFKSMYRHISKGAWTFSDRDHGWQVSDCTADGLKCCLMLSTMPPDMVGPK  510



>gb|ABA01561.1| beta-amyrin synthase [Bupleurum falcatum]
Length=214

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFK+M RH +KGSWTFSDQD G  VSDCTA+ LKC +LL ++  +I G K
Sbjct  64   GDFKNMHRHISKGSWTFSDQDHGWQVSDCTAEGLKCCLLLSRMPTDIVGSK  114



>gb|AFF27505.1| beta-amyrin synthase [Barbarea vulgaris]
 gb|AFF27506.1| beta-amyrin synthase [Barbarea vulgaris]
Length=762

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH +KG+WT SD+D G  VSDCTA+ALKC +LL  +  E+ G K
Sbjct  459  GDFKSMYRHISKGAWTLSDRDHGWQVSDCTAEALKCCLLLSMMPAEVVGHK  509



>gb|KHN16704.1| Lupeol synthase [Glycine soja]
Length=729

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+FK+M RH +KG+WTFS QDQG  VSDCTA+ LK  +LL Q+SP++ GEK
Sbjct  461  GNFKAMHRHISKGAWTFSMQDQGWQVSDCTAEGLKAALLLSQMSPDLIGEK  511



>ref|XP_010539601.1| PREDICTED: camelliol C synthase-like isoform X4 [Tarenaya hassleriana]
Length=645

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH ++G+WTFS++D G  VSDCTA+ LKC +LL  + P++ G K
Sbjct  334  GDFKSMYRHISRGAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPK  384



>ref|XP_003530475.1| PREDICTED: lupeol synthase isoform 1 [Glycine max]
Length=763

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            G+FK+M RH +KG+WTFS QDQG  VSDCTA+ LK  +LL Q+SP++ GEK
Sbjct  455  GNFKAMHRHISKGAWTFSMQDQGWQVSDCTAEGLKAALLLSQMSPDLIGEK  505



>ref|XP_010531948.1| PREDICTED: camelliol C synthase-like isoform X2 [Tarenaya hassleriana]
Length=729

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  150  DFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            DFKSM+RH +KG+WTFSD+D G  VSDCTAD LKC ++L  + P++ G K
Sbjct  428  DFKSMYRHISKGAWTFSDRDHGWQVSDCTADGLKCCLMLSTMPPDMVGPK  477



>ref|XP_010539600.1| PREDICTED: camelliol C synthase-like isoform X3 [Tarenaya hassleriana]
Length=683

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH ++G+WTFS++D G  VSDCTA+ LKC +LL  + P++ G K
Sbjct  372  GDFKSMYRHISRGAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPK  422



>ref|XP_010539599.1| PREDICTED: camelliol C synthase-like isoform X2 [Tarenaya hassleriana]
Length=709

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH ++G+WTFS++D G  VSDCTA+ LKC +LL  + P++ G K
Sbjct  408  GDFKSMYRHISRGAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPK  458



>gb|AHX97777.1| beta-amyrin synthase [Gentiana straminea]
Length=758

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LK  +    + PEI GEK
Sbjct  457  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKVCLHFSTMPPEIVGEK  507



>ref|XP_010539597.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010539598.1| PREDICTED: camelliol C synthase-like isoform X1 [Tarenaya hassleriana]
Length=719

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH ++G+WTFS++D G  VSDCTA+ LKC +LL  + P++ G K
Sbjct  408  GDFKSMYRHISRGAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPK  458



>gb|ABL07607.1| beta-amyrin synthase [Polygala tenuifolia]
Length=762

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM RH +KGSWTFSDQD G  VSDCTA+ LK  + +  + PEI GEK
Sbjct  458  GDFKSMHRHISKGSWTFSDQDHGWQVSDCTAEGLKVCLQMSLLPPEIVGEK  508



>ref|XP_008465828.1| PREDICTED: LOW QUALITY PROTEIN: beta-amyrin synthase-like [Cucumis 
melo]
Length=533

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGE  4
            GDFK M+RH +KG WTFSDQD G  VSDCT++ L C ++L  +SPEI G+
Sbjct  461  GDFKRMYRHISKGGWTFSDQDHGXQVSDCTSENLVCCLMLSTMSPEIVGD  510



>ref|XP_010539602.1| PREDICTED: camelliol C synthase-like isoform X5 [Tarenaya hassleriana]
Length=770

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  153  GDFKSMFRHFTKGSWTFSDQDQGLAVSDCTADALKCLVLLGQISPEIAGEK  1
            GDFKSM+RH ++G+WTFS++D G  VSDCTA+ LKC +LL  + P++ G K
Sbjct  469  GDFKSMYRHISRGAWTFSERDHGWQVSDCTAEGLKCCLLLSMMPPDVVGPK  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520930743318