BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4944_g1_i1 len=733 path=[575:0-388 315:389-415 312:416-418
315:419-445 312:446-448 315:449-475 341:476-732]

Length=733
                                                                      Score     E

ref|XP_007895608.1|  PREDICTED: keratin-associated protein 6-2-like   53.9    1e-05   
ref|XP_003695051.1|  PREDICTED: uncharacterized protein LOC100868462  52.0    2e-04   
ref|XP_006560253.1|  PREDICTED: mucin-19-like isoform X1              51.6    4e-04   
ref|XP_006560257.1|  PREDICTED: mucin-19-like isoform X5              51.6    4e-04   
ref|XP_006560259.1|  PREDICTED: mucin-19-like isoform X7              51.2    4e-04   
ref|XP_001640022.1|  predicted protein                                50.1    8e-04   Nematostella vectensis



>ref|XP_007895608.1| PREDICTED: keratin-associated protein 6-2-like [Callorhinchus 
milii]
Length=186

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 8/73 (11%)
 Frame = -3

Query  527  SGDTCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACSWSSGYSCARSWP  348
             GD        G+   R+W+SGYT  G+W+SGYT  G+W+SGYT   +W+SGY+ A  W 
Sbjct  118  QGDGHLDIQGDGHQDTRAWASGYT--GAWASGYT--GAWASGYT--GAWASGYTGA--WA  169

Query  347  SGYSGRWSSSYTG  309
            SGY+G W+S YTG
Sbjct  170  SGYTGAWASGYTG  182



>ref|XP_003695051.1| PREDICTED: uncharacterized protein LOC100868462 [Apis florea]
Length=2245

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  518  TCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACSWSSGYSCARSWPSGY  339
            T  G  S+GY+     S+GYT+ G  S+GYT+ G  S+GYT+     +GY+     P+GY
Sbjct  822  TGIGQVSTGYTKPGQVSTGYTKPGQVSTGYTKPGQVSTGYTKPGQVFTGYTGTGQVPTGY  881

Query  338  --SGRWSSSYTG  309
              +G+ S+ YTG
Sbjct  882  TGTGQVSTGYTG  893



>ref|XP_006560253.1| PREDICTED: mucin-19-like isoform X1 [Apis mellifera]
 ref|XP_006560254.1| PREDICTED: mucin-19-like isoform X2 [Apis mellifera]
 ref|XP_006560255.1| PREDICTED: mucin-19-like isoform X3 [Apis mellifera]
Length=2438

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -3

Query  548   TSPRSCPSGDTCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACSWSSGY  369
             TSP    +G T  G  S+GY+     S+GYTR G  S+GYTR G  S+ YTR    S+GY
Sbjct  1070  TSPGQVSTGYTRPGEVSTGYTRPGQVSTGYTRPGQISTGYTRPGQVSTEYTRPGQVSTGY  1129

Query  368   SCARSWPSGYS--GRWSSSY--TGGAGR  297
             +      +GY+  G+ S+ Y  TGG G 
Sbjct  1130  TRPGQVSTGYTRPGQVSTGYSETGGLGH  1157



>ref|XP_006560257.1| PREDICTED: mucin-19-like isoform X5 [Apis mellifera]
 ref|XP_006560258.1| PREDICTED: mucin-19-like isoform X6 [Apis mellifera]
Length=2414

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -3

Query  548   TSPRSCPSGDTCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACSWSSGY  369
             TSP    +G T  G  S+GY+     S+GYTR G  S+GYTR G  S+ YTR    S+GY
Sbjct  1046  TSPGQVSTGYTRPGEVSTGYTRPGQVSTGYTRPGQISTGYTRPGQVSTEYTRPGQVSTGY  1105

Query  368   SCARSWPSGYS--GRWSSSY--TGGAGR  297
             +      +GY+  G+ S+ Y  TGG G 
Sbjct  1106  TRPGQVSTGYTRPGQVSTGYSETGGLGH  1133



>ref|XP_006560259.1| PREDICTED: mucin-19-like isoform X7 [Apis mellifera]
Length=2331

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -3

Query  548   TSPRSCPSGDTCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACSWSSGY  369
             TSP    +G T  G  S+GY+     S+GYTR G  S+GYTR G  S+ YTR    S+GY
Sbjct  963   TSPGQVSTGYTRPGEVSTGYTRPGQVSTGYTRPGQISTGYTRPGQVSTEYTRPGQVSTGY  1022

Query  368   SCARSWPSGYS--GRWSSSY--TGGAGR  297
             +      +GY+  G+ S+ Y  TGG G 
Sbjct  1023  TRPGQVSTGYTRPGQVSTGYSETGGLGH  1050



>ref|XP_001640022.1| predicted protein [Nematostella vectensis]
 gb|EDO47959.1| predicted protein [Nematostella vectensis]
Length=536

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = -3

Query  563  WRTIATSPRSCPSGDTCAGSWSSGYSCARSWSSGYTRAGSWSSGYTRAGSWSSGYTRACS  384
            W++  TS ++  S  T   +W S ++  ++W S +T   +W S +T   +W S +T   +
Sbjct  7    WKSFFTSFKNWKSFFTSFKNWKSFFTSFKNWKSFFTSLKNWKSFFTSFKNWKSFFTSFKN  66

Query  383  WSSGYSCARSWPSGYSGR-WSSSYTGGAG  300
            W S ++  ++W S ++ + W S +T    
Sbjct  67   WKSFFTSFKNWKSFFTFKNWKSFFTSFKN  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1251740039913