BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49304_g1_i1 len=163 path=[1:0-162]

Length=163
                                                                      Score     E

ref|XP_007040948.1|  Uncharacterized protein TCM_016755               65.9    1e-10   
ref|XP_007031313.1|  Uncharacterized protein TCM_016763               65.1    2e-10   
ref|XP_009800650.1|  PREDICTED: uncharacterized protein LOC104246536  60.8    4e-10   
ref|XP_007031312.1|  Uncharacterized protein TCM_016762               63.9    6e-10   
emb|CDP11300.1|  unnamed protein product                              63.5    6e-10   
ref|XP_007031316.1|  Uncharacterized protein TCM_016767               63.5    7e-10   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               63.2    1e-09   
ref|XP_007052625.1|  Uncharacterized protein TCM_005953               62.8    2e-09   
ref|XP_009608741.1|  PREDICTED: uncharacterized protein LOC104102667  60.1    4e-09   
ref|XP_011081406.1|  PREDICTED: uncharacterized protein LOC105164454  60.8    4e-09   
ref|XP_011085143.1|  PREDICTED: uncharacterized protein LOC105167219  60.8    7e-09   
emb|CDP22005.1|  unnamed protein product                              57.0    1e-08   
ref|XP_009620919.1|  PREDICTED: uncharacterized protein LOC104112639  59.7    2e-08   
ref|XP_007011457.1|  Uncharacterized protein TCM_045622               59.7    2e-08   
ref|XP_009615408.1|  PREDICTED: uncharacterized protein LOC104108129  58.5    3e-08   
ref|XP_004231462.1|  PREDICTED: uncharacterized protein LOC101258709  57.8    8e-08   
ref|XP_009587917.1|  PREDICTED: uncharacterized protein LOC104085557  56.6    1e-07   
ref|XP_010315025.1|  PREDICTED: uncharacterized protein LOC104645339  56.6    2e-07   
ref|XP_007199601.1|  hypothetical protein PRUPE_ppa023095mg           56.2    2e-07   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330               56.2    3e-07   
emb|CCA66153.1|  hypothetical protein                                 55.8    3e-07   
ref|XP_011101896.1|  PREDICTED: uncharacterized protein LOC105179936  55.1    3e-07   
ref|XP_009759122.1|  PREDICTED: uncharacterized protein LOC104211723  55.5    4e-07   
ref|XP_011070160.1|  PREDICTED: uncharacterized protein LOC105155874  52.0    6e-07   
ref|XP_007044006.1|  Uncharacterized protein TCM_008802               53.9    8e-07   
ref|XP_007022832.1|  Uncharacterized protein TCM_026877               54.7    8e-07   
ref|XP_009760173.1|  PREDICTED: uncharacterized protein LOC104212570  53.9    1e-06   
emb|CDP19251.1|  unnamed protein product                              53.5    2e-06   
ref|XP_006364939.1|  PREDICTED: uncharacterized protein LOC102581051  53.9    2e-06   
ref|XP_007037663.1|  Uncharacterized protein TCM_014381               52.4    2e-06   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737               53.9    2e-06   
ref|XP_007014117.1|  Uncharacterized protein TCM_038852               53.1    2e-06   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752               53.5    2e-06   
emb|CAA73798.1|  reverse transcriptase                                52.8    3e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE52348.1|  hypothetical protein OsJ_34391                        51.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449295.1|  hypothetical protein SORBIDRAFT_05g007323        52.4    4e-06   Sorghum bicolor [broomcorn]
ref|XP_009796308.1|  PREDICTED: uncharacterized protein LOC104242893  52.4    4e-06   
gb|ABA94430.1|  retrotransposon protein, putative, unclassified       51.6    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABA97183.1|  retrotransposon protein, putative, unclassified       52.0    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009768841.1|  PREDICTED: uncharacterized protein LOC104219801  52.4    5e-06   
ref|XP_009758821.1|  PREDICTED: uncharacterized protein LOC104211459  50.4    7e-06   
ref|XP_010327351.1|  PREDICTED: uncharacterized protein LOC104649583  51.6    8e-06   
ref|XP_009758675.1|  PREDICTED: uncharacterized protein LOC104211329  51.6    8e-06   
ref|XP_009761621.1|  PREDICTED: uncharacterized protein LOC104213776  50.8    8e-06   
ref|XP_010319987.1|  PREDICTED: uncharacterized protein LOC104647107  51.6    1e-05   
ref|XP_007010390.1|  Retrotransposon, unclassified-like protein       51.6    1e-05   
ref|XP_010681251.1|  PREDICTED: uncharacterized protein LOC104896232  50.1    1e-05   
ref|XP_009595148.1|  PREDICTED: uncharacterized protein LOC104091498  50.8    1e-05   
ref|XP_007020079.1|  Uncharacterized protein TCM_036457               50.4    1e-05   
ref|XP_009616379.1|  PREDICTED: uncharacterized protein LOC104108929  51.2    1e-05   
ref|XP_009761667.1|  PREDICTED: uncharacterized protein LOC104213819  51.2    1e-05   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753  51.2    1e-05   
ref|XP_004233579.1|  PREDICTED: uncharacterized protein LOC101260201  51.2    1e-05   
ref|XP_007028283.1|  BZIP-like protein                                50.8    1e-05   
emb|CCA65974.1|  hypothetical protein                                 51.2    1e-05   
ref|XP_007036697.1|  Uncharacterized protein TCM_012582               50.8    2e-05   
ref|XP_010674085.1|  PREDICTED: uncharacterized protein LOC104890338  51.2    2e-05   
ref|XP_009786618.1|  PREDICTED: uncharacterized protein LOC104234707  50.8    2e-05   
ref|XP_009609484.1|  PREDICTED: uncharacterized protein LOC104103292  50.4    2e-05   
ref|XP_009774912.1|  PREDICTED: uncharacterized protein LOC104224892  49.7    3e-05   
ref|XP_010673150.1|  PREDICTED: uncharacterized protein LOC104889591  50.1    3e-05   
ref|XP_009792914.1|  PREDICTED: uncharacterized protein LOC104239880  50.1    3e-05   
ref|XP_010046460.1|  PREDICTED: RNA-directed DNA polymerase from ...  49.7    3e-05   
ref|XP_004248595.1|  PREDICTED: uncharacterized protein LOC101261371  50.1    3e-05   
ref|XP_009627442.1|  PREDICTED: uncharacterized protein LOC104117989  48.9    3e-05   
ref|XP_010666883.1|  PREDICTED: uncharacterized protein LOC104884000  49.7    4e-05   
ref|XP_009804541.1|  PREDICTED: uncharacterized protein LOC104249756  47.4    5e-05   
gb|EEE69144.1|  hypothetical protein OsJ_28268                        49.7    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ07996.1|  hypothetical protein OsI_30258                        49.3    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009790965.1|  PREDICTED: uncharacterized protein LOC104238338  49.7    5e-05   
ref|XP_009121302.1|  PREDICTED: putative ribonuclease H protein A...  48.9    6e-05   
ref|XP_007212886.1|  hypothetical protein PRUPE_ppa021750mg           49.3    6e-05   
ref|XP_008390125.1|  PREDICTED: uncharacterized protein LOC103452416  49.3    6e-05   
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027  49.3    7e-05   
ref|XP_010068386.1|  PREDICTED: uncharacterized protein LOC104455266  48.5    7e-05   
emb|CAB78008.1|  putative protein                                     48.9    7e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79789.1|  hypothetical protein VITISV_039779                   49.3    7e-05   Vitis vinifera
ref|XP_010327335.1|  PREDICTED: uncharacterized protein LOC104649568  48.5    7e-05   
ref|XP_007224290.1|  hypothetical protein PRUPE_ppa020085mg           48.9    7e-05   
emb|CDP18963.1|  unnamed protein product                              48.9    7e-05   
ref|XP_008347064.1|  PREDICTED: putative ribonuclease H protein A...  48.9    8e-05   
ref|XP_002465040.1|  hypothetical protein SORBIDRAFT_01g031070        48.5    8e-05   Sorghum bicolor [broomcorn]
ref|XP_007206246.1|  hypothetical protein PRUPE_ppa015607mg           48.9    8e-05   
emb|CAD41563.3|  OSJNBa0006A01.18                                     48.9    8e-05   Oryza sativa [red rice]
ref|XP_007201486.1|  hypothetical protein PRUPE_ppa016462mg           48.9    8e-05   
ref|XP_007212580.1|  hypothetical protein PRUPE_ppa015871mg           48.9    8e-05   
gb|AAP06925.1|  putative reverse transcriptase                        48.9    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009792450.1|  PREDICTED: uncharacterized protein LOC104239503  47.4    9e-05   
ref|XP_007214027.1|  hypothetical protein PRUPE_ppa016677mg           48.9    9e-05   
emb|CCA66180.1|  hypothetical protein                                 48.5    1e-04   
emb|CAN65201.1|  hypothetical protein VITISV_016555                   47.4    1e-04   Vitis vinifera
ref|XP_006584215.1|  PREDICTED: uncharacterized protein LOC102669059  47.4    1e-04   
gb|ABD28670.2|  RNA-directed DNA polymerase (Reverse transcriptase)   48.1    1e-04   Medicago truncatula
ref|XP_009783630.1|  PREDICTED: uncharacterized protein LOC104232192  47.8    1e-04   
emb|CAN61039.1|  hypothetical protein VITISV_018673                   48.5    1e-04   Vitis vinifera
emb|CAD40197.1|  OSJNBb0043H09.5                                      48.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010319606.1|  PREDICTED: uncharacterized protein LOC104646845  47.0    2e-04   
gb|AAD37021.1|  putative non-LTR retrolelement reverse transcriptase  47.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079190.1|  PREDICTED: uncharacterized protein LOC105162767  47.8    2e-04   
ref|XP_011079166.1|  PREDICTED: uncharacterized protein LOC105162745  47.4    2e-04   
ref|XP_010239032.1|  PREDICTED: uncharacterized protein LOC104584909  47.4    2e-04   
ref|XP_010495633.1|  PREDICTED: uncharacterized protein LOC104772751  47.8    2e-04   
ref|XP_009769452.1|  PREDICTED: uncharacterized protein LOC104220308  47.4    2e-04   
ref|XP_010039996.1|  PREDICTED: uncharacterized protein LOC104428743  47.8    2e-04   
emb|CCA66222.1|  hypothetical protein                                 47.4    2e-04   
ref|XP_007219138.1|  hypothetical protein PRUPE_ppa015983mg           47.4    3e-04   
ref|XP_010696208.1|  PREDICTED: uncharacterized protein LOC104908756  47.4    3e-04   
ref|XP_009796827.1|  PREDICTED: uncharacterized protein LOC104243350  47.0    3e-04   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified       47.4    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011102274.1|  PREDICTED: uncharacterized protein LOC105180303  47.0    3e-04   
ref|XP_010671205.1|  PREDICTED: uncharacterized protein LOC104888072  47.4    3e-04   
gb|AAM01179.2|AC113336_31  Putative retroelement                      47.4    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124161.1|  PREDICTED: uncharacterized protein LOC103849097  47.0    3e-04   
ref|XP_010683801.1|  PREDICTED: uncharacterized protein LOC104898413  47.0    3e-04   
ref|XP_002445957.1|  hypothetical protein SORBIDRAFT_07g028675        47.0    3e-04   Sorghum bicolor [broomcorn]
ref|XP_009787157.1|  PREDICTED: uncharacterized protein LOC104235159  47.0    3e-04   
ref|XP_011101240.1|  PREDICTED: uncharacterized protein LOC105179344  45.4    3e-04   
ref|XP_010484806.1|  PREDICTED: uncharacterized protein LOC104763089  47.4    3e-04   
emb|CAN77234.1|  hypothetical protein VITISV_010061                   47.4    3e-04   Vitis vinifera
gb|EAZ23960.1|  hypothetical protein OsJ_07686                        45.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004252203.1|  PREDICTED: uncharacterized protein LOC101264798  46.6    4e-04   
ref|XP_011101679.1|  PREDICTED: uncharacterized protein LOC105179730  46.6    4e-04   
ref|XP_010030447.1|  PREDICTED: uncharacterized protein LOC104420277  47.0    4e-04   
ref|XP_010026225.1|  PREDICTED: uncharacterized protein LOC104416548  46.6    4e-04   
emb|CAN65100.1|  hypothetical protein VITISV_039725                   47.0    4e-04   Vitis vinifera
emb|CAN77005.1|  hypothetical protein VITISV_027306                   46.2    5e-04   Vitis vinifera
emb|CAN82968.1|  hypothetical protein VITISV_021857                   46.6    5e-04   Vitis vinifera
emb|CAN74986.1|  hypothetical protein VITISV_008771                   46.6    5e-04   Vitis vinifera
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...  46.6    5e-04   
gb|EEE52042.1|  hypothetical protein OsJ_33770                        45.1    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010314994.1|  PREDICTED: uncharacterized protein LOC101245446  46.2    5e-04   
ref|XP_006574236.1|  PREDICTED: uncharacterized protein LOC102669276  45.8    6e-04   
ref|XP_010668002.1|  PREDICTED: uncharacterized protein LOC104884990  46.6    6e-04   
ref|XP_010674861.1|  PREDICTED: uncharacterized protein LOC104890940  46.2    6e-04   
ref|XP_010666564.1|  PREDICTED: uncharacterized protein LOC104883706  46.2    6e-04   
ref|XP_011083347.1|  PREDICTED: uncharacterized protein LOC105165891  46.2    6e-04   
ref|XP_009598913.1|  PREDICTED: uncharacterized protein LOC104094650  46.2    6e-04   
ref|XP_011079179.1|  PREDICTED: uncharacterized protein LOC105162756  46.2    6e-04   
ref|XP_004242524.1|  PREDICTED: uncharacterized protein LOC101258077  46.2    6e-04   
ref|XP_011094002.1|  PREDICTED: uncharacterized protein LOC105173820  44.3    6e-04   
ref|XP_011081488.1|  PREDICTED: uncharacterized protein LOC105164532  45.8    7e-04   
ref|XP_010684861.1|  PREDICTED: uncharacterized protein LOC104899382  45.4    7e-04   
ref|XP_011081181.1|  PREDICTED: uncharacterized protein LOC105164266  45.8    7e-04   
ref|XP_011100542.1|  PREDICTED: uncharacterized protein LOC105178709  45.8    8e-04   
ref|XP_007036030.1|  Uncharacterized protein TCM_021518               46.2    8e-04   
emb|CAN64551.1|  hypothetical protein VITISV_030815                   45.4    8e-04   Vitis vinifera
ref|XP_011102248.1|  PREDICTED: uncharacterized protein LOC105180271  45.8    8e-04   
ref|XP_009151561.1|  PREDICTED: putative ribonuclease H protein A...  45.8    9e-04   
gb|AAW56921.1|  hypothetical protein                                  45.4    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011101914.1|  PREDICTED: uncharacterized protein LOC105179953  45.1    0.001   
gb|AAQ56501.1|  putative transposon protein                           45.4    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630  45.8    0.001   
gb|AAX96619.1|  retrotransposon protein, putative, LINE sub-class     45.4    0.001   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74005.1|  hypothetical protein VITISV_006236                   45.4    0.001   Vitis vinifera



>ref|XP_007040948.1| Uncharacterized protein TCM_016755 [Theobroma cacao]
 gb|EOY25449.1| Uncharacterized protein TCM_016755 [Theobroma cacao]
Length=1245

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++HCW+++K D+  A LDFF G P+PR + S  +VL+PKK +   ++D+R
Sbjct  790  SSLFYQHCWDIIKQDLLEAVLDFFKGTPMPRGVTSTTLVLLPKKPNSCQWSDFR  843



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++HCW+++K+D+  A LDFF G P+PR + S  +VL+PKK +   +++YR
Sbjct  1215  SSLFYQHCWDIIKNDLLDAVLDFFRGSPLPRGVTSTTLVLLPKKPNACHWSEYR  1268



>ref|XP_009800650.1| PREDICTED: uncharacterized protein LOC104246536 [Nicotiana sylvestris]
Length=144

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G  ++ CWEV+K+D++   L FF G P+PR M SA +VL PK   P S  ++R
Sbjct  13   NGKIYQACWEVIKEDLFNVVLAFFRGCPMPRFMTSACLVLFPKVEFPNSIREFR  66



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++HCW+++K D++ A LDFF G P+PR + S  +VL+PK  +   ++++R
Sbjct  1302  SSLFYQHCWDIIKQDLFEAVLDFFKGSPLPRGITSTTLVLLPKTQNVSQWSEFR  1355



>emb|CDP11300.1| unnamed protein product [Coffea canephora]
Length=751

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            +G+FFRHCW++V  D   A  DF AG  +P+ +AS  IVLIPKK +P +   Y
Sbjct  152  TGTFFRHCWDIVALDALAATRDFLAGTLLPKGIASTLIVLIPKKPNPATVAPY  204



>ref|XP_007031316.1| Uncharacterized protein TCM_016767 [Theobroma cacao]
 gb|EOY02242.1| Uncharacterized protein TCM_016767 [Theobroma cacao]
Length=1707

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
             S  F++HCW+++K D+  A LDFF G P+PR + S  +VL+PKK +   ++DY
Sbjct  1172  SSLFYQHCWDIIKHDLLDAVLDFFRGSPLPRGVTSTTLVLLPKKPNACHWSDY  1224



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++HCW+++K D+  A LDFF G P+P+ + S  +VL+PKK +   ++D+R
Sbjct  1041  SSLFYQHCWDIIKQDLLEAVLDFFNGTPMPQGVTSTTLVLLPKKPNSCQWSDFR  1094



>ref|XP_007052625.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
 gb|EOX96782.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
Length=1659

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++HCW+++K D+  A LDFF G P+P+ + S  +VL+PKK +   ++D+R
Sbjct  938  SSLFYQHCWDIIKQDLLEAVLDFFNGAPMPQGVTSTTLVLLPKKPNSCQWSDFR  991



>ref|XP_009608741.1| PREDICTED: uncharacterized protein LOC104102667 [Nicotiana tomentosiformis]
Length=332

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F+  CWE++KDD+    LD+FAG  +PR+     +++IPK   P+ FT++R
Sbjct  82   SKKFYHTCWEIIKDDLLLMVLDYFAGTELPRSFTHTCLIMIPKVDCPQKFTEFR  135



>ref|XP_011081406.1| PREDICTED: uncharacterized protein LOC105164454 [Sesamum indicum]
Length=600

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S +F++ CW+ +  D++ A  DFF G P+PR+  +  IVL+PK   P+++ D+R
Sbjct  424  SSAFYQACWDFIAIDIFEAVKDFFHGTPMPRSFTATTIVLVPKVESPQTWNDFR  477



>ref|XP_011085143.1| PREDICTED: uncharacterized protein LOC105167219 [Sesamum indicum]
Length=1203

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+ CWE++  D+YGA LDF +G   P+   +  IVLIPK   P ++ D+R
Sbjct  418  SAHFFQCCWEIIGQDLYGAVLDFLSGSTPPKNFTTTTIVLIPKIEAPSTWKDFR  471



>emb|CDP22005.1| unnamed protein product [Coffea canephora]
Length=177

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKK  133
            +G FFRHCW++V  DV  A  D  A  PIP+ + S  IVLIPKK
Sbjct  23   TGLFFRHCWDIVGLDVLAATRDILAETPIPKGITSTLIVLIPKK  66



>ref|XP_009620919.1| PREDICTED: uncharacterized protein LOC104112639 [Nicotiana tomentosiformis]
Length=731

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            FF+HCW++V +D+Y     F+ G P+P+++    +VLIPK    ++F+D R
Sbjct  426  FFQHCWDIVGEDIYNMIQQFYTGSPLPKSITHTNLVLIPKVQQVQTFSDLR  476



>ref|XP_007011457.1| Uncharacterized protein TCM_045622 [Theobroma cacao]
 gb|EOY20267.1| Uncharacterized protein TCM_045622 [Theobroma cacao]
Length=1232

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++HCW+++K D+  A LDFF G  +PR + S  +VL+PK  +   ++D+R
Sbjct  654  SSLFYQHCWDIIKQDLLEAVLDFFKGSSLPRGVTSTTLVLLPKMPNACQWSDFR  707



>ref|XP_009615408.1| PREDICTED: uncharacterized protein LOC104108129 [Nicotiana tomentosiformis]
Length=552

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F++ CWE++ ++++   L FF G  +P+++    +V++PKK   ESF+D R
Sbjct  23   TGMFYKECWEIICNNIHNIVLHFFGGAALPKSITHTNLVMLPKKQRSESFSDLR  76



>ref|XP_004231462.1| PREDICTED: uncharacterized protein LOC101258709 [Solanum lycopersicum]
Length=845

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G FF+ C++++KDD+  A   FF G  +P+ M  A +VLIPK  HP    D+R
Sbjct  88   GKFFQVCFDIIKDDLLAAVQHFFNGFDMPKYMTHACLVLIPKVEHPNKLKDFR  140



>ref|XP_009587917.1| PREDICTED: uncharacterized protein LOC104085557 [Nicotiana tomentosiformis]
Length=553

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F+  CWE++++DV+   + FF G  +P+ +    +VL+PKK    +F D R
Sbjct  234  TGAFYHTCWEIIEEDVFAMVMAFFCGQQLPKCVTHTNLVLLPKKKEVNTFADMR  287



>ref|XP_010315025.1| PREDICTED: uncharacterized protein LOC104645339 [Solanum lycopersicum]
Length=847

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G FF+ C++++++D+  A   FF+G  +PR M  A +VL+PK  HP    DYR
Sbjct  689  GKFFQVCFDIIQEDLMAAVKSFFSGKVLPRYMTHACLVLLPKINHPNKLKDYR  741



>ref|XP_007199601.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica]
 gb|EMJ00800.1| hypothetical protein PRUPE_ppa023095mg, partial [Prunus persica]
Length=933

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G+F+   W ++ +D+ G   DFF G  IP+ + S QIVLIPK  +PE+ + +R
Sbjct  100  GTFYHKYWGIIHNDIQGFTADFFTGQAIPKPLNSTQIVLIPKIPNPEAVSQFR  152



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++ CW ++  D+  A  DFF G  IPR + S  ++L+PKK+    ++D+R
Sbjct  1336  SSYFYQQCWNIIAQDLLDAVRDFFHGANIPRGVTSTTLILLPKKSSASKWSDFR  1389



>emb|CCA66153.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1381

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  WEV+K+DVYG   +F+    +PR   +A I LIPK ++PE F D+R
Sbjct  455  FVKQAWEVIKEDVYGIVNEFWHSSRLPRGCNTALIALIPKISNPEGFKDFR  505



>ref|XP_011101896.1| PREDICTED: uncharacterized protein LOC105179936 [Sesamum indicum]
Length=437

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+ CW+++  D+Y A LDF +G   P+   +  IVLIPK   P ++ D+R
Sbjct  290  SAHFFQCCWDIIGQDLYDAVLDFLSGSTPPKNFTTTTIVLIPKVEVPSTWKDFR  343



>ref|XP_009759122.1| PREDICTED: uncharacterized protein LOC104211723 [Nicotiana sylvestris]
Length=979

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++ CWE++++DV G    FF G  +P+++    +VL+PKK    +F D R
Sbjct  38   TGAFYQTCWEIIEEDVVGMVKAFFCGQQLPKSVTHTNLVLLPKKKEVMTFADMR  91



>ref|XP_011070160.1| PREDICTED: uncharacterized protein LOC105155874 [Sesamum indicum]
Length=125

 Score = 52.0 bits (123),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHP  142
            S +FF+ CW  + +D+  A +DFF G  +PR+  +  I+LIPK   P
Sbjct  79   SSAFFQACWNTIAEDISTAVMDFFRGTLMPRSFTATSIILIPKNDSP  125



>ref|XP_007044006.1| Uncharacterized protein TCM_008802 [Theobroma cacao]
 gb|EOX99837.1| Uncharacterized protein TCM_008802 [Theobroma cacao]
Length=372

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CW++V +D   A +DFF G+ +PR + S  I+L+PK  +   ++D++
Sbjct  267  FYQQCWDIVANDFLDAVVDFFHGIDLPRGITSTTIMLLPKNNNAPKWSDFK  317



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++ CW ++  D+  A  DFF G  IPR + S  ++L+PKK     ++D+R
Sbjct  1508  SSYFYQQCWNIIAHDLLDAVRDFFHGANIPRGVTSTTLILLPKKPSASKWSDFR  1561



>ref|XP_009760173.1| PREDICTED: uncharacterized protein LOC104212570, partial [Nicotiana 
sylvestris]
Length=544

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++ CWE +++DV G    FF G  +P+++    +VL+PKK    +F D R
Sbjct  111  TGAFYQTCWETIEEDVVGMVRAFFCGQQLPKSVTHTNLVLLPKKKEVMTFADMR  164



>emb|CDP19251.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPK  130
            F++ CWE++K D+ GA  DFF GV  PR  +SA +VLIPK
Sbjct  161  FYQQCWEIIKADLLGAVQDFFKGVQQPRGFSSALLVLIPK  200



>ref|XP_006364939.1| PREDICTED: uncharacterized protein LOC102581051 [Solanum tuberosum]
Length=1946

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++ CW++++D++  A L +F+G  +P+ M+ + +V++PK  HP  F ++R
Sbjct  232  GKFYQACWDIIQDELLEAVLAYFSGHIMPKFMSHSCLVVLPKVEHPNRFNEFR  284



>ref|XP_007037663.1| Uncharacterized protein TCM_014381 [Theobroma cacao]
 gb|EOY22164.1| Uncharacterized protein TCM_014381 [Theobroma cacao]
Length=250

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++HCW ++  D+      FF G  +P+ M S   VL+PK ++P +++D R
Sbjct  155  SSFFYKHCWSIISKDLLEVVTGFFQGATLPKGMTSTTPVLLPKNSNPLNWSDIR  208



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++ CW+++  D++ A  +FF G  IP+ M S  +VLIPK      ++++R
Sbjct  1301  SSHFYQQCWDIIAHDLFEAVKEFFHGADIPQGMTSTTLVLIPKTTSASKWSEFR  1354



>ref|XP_007014117.1| Uncharacterized protein TCM_038852 [Theobroma cacao]
 gb|EOY31736.1| Uncharacterized protein TCM_038852 [Theobroma cacao]
Length=456

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFT  154
            S  F++HCW+++ +D+  A LDFF G  +PR + S  +VL+ KK++  +++
Sbjct  108  SSFFYQHCWDILANDLIAAVLDFFQGTYLPRGITSTTLVLLSKKSNASAWS  158



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S  F++ CW  +  D+  A  DFF G  IPR + S  +VL+PKK+    ++++R
Sbjct  1338  SSYFYQQCWNTIAHDLLDAVRDFFHGANIPRGVTSTTLVLLPKKSSASKWSEFR  1391



>emb|CAA73798.1| reverse transcriptase [Beta vulgaris subsp. vulgaris]
Length=507

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  WEV+K D+Y    DF+A   +P    SA I LIPK  HP  F ++R
Sbjct  325  FIKSSWEVIKKDIYKIVEDFWASGSLPHGCNSAFIALIPKTQHPRGFNEFR  375



>gb|EEE52348.1| hypothetical protein OsJ_34391 [Oryza sativa Japonica Group]
Length=278

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++ +D Y  A  FF+G    + + ++ I L+PKK +PES  DYR
Sbjct  26   NGMFLKKCWHIISEDFYAMADQFFSGGISIQNLNNSFITLVPKKPNPESPNDYR  79



>ref|XP_002449295.1| hypothetical protein SORBIDRAFT_05g007323 [Sorghum bicolor]
 gb|EES08283.1| hypothetical protein SORBIDRAFT_05g007323 [Sorghum bicolor]
Length=531

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW +VK D Y    +F+ G+    ++ S+ I L+PKK +PE+  D+R
Sbjct  136  NGLFLKKCWHIVKQDFYSLCWNFYEGLVNLESINSSYITLVPKKENPETVNDFR  189



>ref|XP_009796308.1| PREDICTED: uncharacterized protein LOC104242893 [Nicotiana sylvestris]
Length=462

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+ CW+++ DD+      FF G  +PR +    +VL+PKK    +F+D R
Sbjct  323  TGCFFQFCWDIIGDDIVDMVKAFFNGCELPRYVTHTNLVLLPKKKEVITFSDMR  376



>gb|ABA94430.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=306

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++ +D Y  A  FF+G    + + ++ I L+PKK +PES  DYR
Sbjct  54   NGMFLKKCWHIISEDFYAMADQFFSGGISIQNLNNSFITLVPKKPNPESPNDYR  107



>gb|ABA97183.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=379

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++ +D Y  A  FF+G    + + ++ I LIPKK +PE+  DYR
Sbjct  54   NGLFLKKCWHIISEDFYSLAEHFFSGGSSIQNLNNSYITLIPKKPNPETPNDYR  107



>ref|XP_009768841.1| PREDICTED: uncharacterized protein LOC104219801 [Nicotiana sylvestris]
Length=574

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++ CWE++++DV      FF G  +P+++    +VL+PKK    +F D R
Sbjct  377  TGAFYQTCWEIIEEDVVRMVKAFFCGQQLPKSVMHTNMVLLPKKKEVTTFADMR  430



>ref|XP_009758821.1| PREDICTED: uncharacterized protein LOC104211459 [Nicotiana sylvestris]
Length=245

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++  W ++ +D++ A + FF G  +P+      +++IPK  HP+ F+D R
Sbjct  82   GCFYQRSWSIIANDLHRAVMAFFKGAILPKFYTHTCLIMIPKVDHPQKFSDLR  134



>ref|XP_010327351.1| PREDICTED: uncharacterized protein LOC104649583 [Solanum lycopersicum]
Length=733

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++ C+++++ D+      FF G  +PR M +A +VLIPK  HP    DYR
Sbjct  82   GKFYQVCFDIIQGDLMAVVNAFFNGNMLPRYMTNACLVLIPKVNHPNKLKDYR  134



>ref|XP_009758675.1| PREDICTED: uncharacterized protein LOC104211329, partial [Nicotiana 
sylvestris]
Length=590

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            + +FF  CW+++ DD+     DFF G   PR +    +VL+PKK    +F+D R
Sbjct  68   NSTFFHSCWDIIGDDIVDMVQDFFNGHEFPRFVTHTNLVLLPKKKEVVTFSDMR  121



>ref|XP_009761621.1| PREDICTED: uncharacterized protein LOC104213776 [Nicotiana sylvestris]
Length=334

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+ CW+++K+D+     D F+G  + +  +   +VLIPK   P SF+D R
Sbjct  182  NGKFFQSCWDIIKEDITDFVQDVFSGRRLTKFFSHTCLVLIPKVDSPNSFSDLR  235



>ref|XP_010319987.1| PREDICTED: uncharacterized protein LOC104647107 [Solanum lycopersicum]
Length=1448

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G FF+  ++++K+D+  A   FF+G  +PR M+ A +VL+PK  HP  F D+R
Sbjct  638  GKFFQVYFDIIKEDLLAAVKYFFSGNIMPRYMSHACLVLLPKVEHPCRFKDFR  690



>ref|XP_007010390.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
 gb|EOY19200.1| Retrotransposon, unclassified-like protein [Theobroma cacao]
Length=1368

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++ CW ++ +D+  A  DFF G   PR + S  +VL+ KK    +++D+R
Sbjct  422  SSFFYQQCWPIIAEDLLAAVRDFFKGAVFPRGVTSTTLVLLAKKPDAATWSDFR  475



>ref|XP_010681251.1| PREDICTED: uncharacterized protein LOC104896232 [Beta vulgaris 
subsp. vulgaris]
Length=247

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             ++HCWE+++DD+  A LDFF    I + +    + LIPK   PE+  ++R
Sbjct  149  LYKHCWEIIRDDISEAILDFFRTGKILKEINVTTLTLIPKVKCPENVIEFR  199



>ref|XP_009595148.1| PREDICTED: uncharacterized protein LOC104091498 [Nicotiana tomentosiformis]
Length=430

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +GSF++ CWE+V  D++     F+ G  +P+++    +VL+PKK   + F+D R
Sbjct  35   TGSFYQECWEIVCYDIHNMVRYFYGGTYLPKSIIHPNLVLLPKKPRVQIFSDLR  88



>ref|XP_007020079.1| Uncharacterized protein TCM_036457 [Theobroma cacao]
 gb|EOY17304.1| Uncharacterized protein TCM_036457 [Theobroma cacao]
Length=376

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAH  139
            S  F++ CW+++ DD+  A L+FF G  +P  + S  +VL+PKK +
Sbjct  304  SSYFYQQCWDILADDLLAAVLNFFKGAKLPCGITSTTLVLLPKKKY  349



>ref|XP_009616379.1| PREDICTED: uncharacterized protein LOC104108929 [Nicotiana tomentosiformis]
Length=865

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F++ CW +V  D++    D + G  +P+++    +VL+PKK   ++F+D R
Sbjct  301  TGLFYQKCWNIVGADIFMMVQDIYGGASLPKSITHTNLVLLPKKPQVQTFSDLR  354



>ref|XP_009761667.1| PREDICTED: uncharacterized protein LOC104213819 [Nicotiana sylvestris]
Length=866

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++ CWE++++DV      FF G  +P+++    +VL+PKK    +F D R
Sbjct  38   NGAFYQICWEIIEEDVVQMVKAFFCGQRLPKSVTHTNLVLLPKKKEVMTFVDMR  91



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            +G FF+  WE++K DV     DFF    +PR++    +VL+PK  HPES   Y
Sbjct  588  NGLFFQQHWEIIKADVIKTVRDFFTSGIMPRSLNRMILVLVPKVHHPESIDQY  640



>ref|XP_004233579.1| PREDICTED: uncharacterized protein LOC101260201 [Solanum lycopersicum]
Length=1531

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++ C++++++D+  A   FF+G  +PR M  A +VL+ K  HP    DYR
Sbjct  749  GKFYQECFDIIQEDMLAAVNSFFSGNIMPRYMTHACLVLLLKINHPNQLKDYR  801



>ref|XP_007028283.1| BZIP-like protein [Theobroma cacao]
 gb|EOY08785.1| BZIP-like protein [Theobroma cacao]
Length=539

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  F++ CW ++ DD+  A  D F    +PR + S  +VL+ KK+  ES++D+R
Sbjct  291  SSLFYQQCWHIIADDLLIAVRDSFTSSTMPRGVTSTSLVLLAKKSIAESWSDFR  344



>emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1379

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F ++ WE +K+DVY    +F+A   +P+   S  I LIPK  +PE+F D+R
Sbjct  455  FIKNAWETIKEDVYTLVREFWATSKLPKGSNSTFITLIPKIDNPENFKDFR  505



>ref|XP_007036697.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
 gb|EOY21198.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
Length=947

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 17/45 (38%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +2

Query  29   EVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +++ DD++ A LDFF G+ +PR + S  ++L+PKK++  +++D+R
Sbjct  723  DILADDLFAAVLDFFQGMCLPRGITSTTLILLPKKSNASAWSDFR  767



>ref|XP_010674085.1| PREDICTED: uncharacterized protein LOC104890338 [Beta vulgaris 
subsp. vulgaris]
Length=1568

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  WE+VK D+Y    +F+A   +P+   +A I LIPK  +P S  DYR
Sbjct  642  FIKSAWEIVKHDIYEIVHNFWASAHLPKGCNTAYITLIPKVENPTSLKDYR  692



>ref|XP_009786618.1| PREDICTED: uncharacterized protein LOC104234707 [Nicotiana sylvestris]
Length=672

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F+  CW+++ DD+Y      F G  +P+ +    +VLIPKK    +F+D R
Sbjct  18   TGKFYHSCWDLIGDDLYDMVRALFNGHELPKCVTHTNLVLIPKKKEVTTFSDLR  71



>ref|XP_009609484.1| PREDICTED: uncharacterized protein LOC104103292 [Nicotiana tomentosiformis]
Length=595

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+ CW+++ +D++     F+ G  +P++     +VL+P K   ++FTD R
Sbjct  309  TGIFFQECWDIIGEDIHEMLKLFYGGSSLPKSTTHTNLVLLPNKQQVQTFTDLR  362



>ref|XP_009774912.1| PREDICTED: uncharacterized protein LOC104224892 [Nicotiana sylvestris]
Length=425

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTD  157
            +GSFF  CWE + DDV      FF G  +P+ +    +VL+PKK    +F+D
Sbjct  302  NGSFFHACWETIGDDVVEMVKAFFNGHELPKFITHTNLVLLPKKKEVITFSD  353



>ref|XP_010673150.1| PREDICTED: uncharacterized protein LOC104889591 [Beta vulgaris 
subsp. vulgaris]
Length=1295

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  WE +K DVYG   DF+A   +P+    A I LI K  HP+   DYR
Sbjct  367  FIKEVWETIKHDVYGIVADFWASGRLPKGSNVAFIALIAKCEHPDGLKDYR  417



>ref|XP_009792914.1| PREDICTED: uncharacterized protein LOC104239880 [Nicotiana sylvestris]
Length=947

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+FF+ CWE+++ +V     DFF G  + +  +   +VLIPK  +P +F D+R
Sbjct  144  NGTFFQSCWEIIEREVIAFVKDFFKGKGLTKFYSHTCLVLIPKIDNPVTFYDFR  197



>ref|XP_010046460.1| PREDICTED: RNA-directed DNA polymerase from mobile element jockey-like 
[Eucalyptus grandis]
Length=506

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F+R  WE++K D++ A   FF    +P ++ S  I LIPK  +PES   YR
Sbjct  343  NGLFYRSHWEIIKVDIHRAVQQFFQYGILPPSLNSTAITLIPKTPNPESMDQYR  396



>ref|XP_004248595.1| PREDICTED: uncharacterized protein LOC101261371 [Solanum lycopersicum]
Length=1246

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++ C++++K+D+  A   F+ G  +PR +  A ++L+PK  HP    D+R
Sbjct  361  GKFYQVCFDIIKEDLLAAVKYFYIGNSMPRYLTHASLILLPKTDHPCRLKDFR  413



>ref|XP_009627442.1| PREDICTED: uncharacterized protein LOC104117989 [Nicotiana tomentosiformis]
Length=318

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF  CW+++ DD++     FF G  +P+ +    + L+PKK    +F+D R
Sbjct  68   TGCFFHSCWDIIGDDIFDTVKAFFNGQELPQFVTHTNLFLLPKKKEVITFSDMR  121



>ref|XP_010666883.1| PREDICTED: uncharacterized protein LOC104884000 [Beta vulgaris 
subsp. vulgaris]
Length=1485

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +  F++HCWE V D+V  A  DFF    + +A+    + LIPK   PE+ T++R
Sbjct  854  NSKFYKHCWEYVGDEVTEAIQDFFRTGKLLKAINITTLTLIPKVKSPENVTEFR  907



>ref|XP_009804541.1| PREDICTED: uncharacterized protein LOC104249756 [Nicotiana sylvestris]
Length=190

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            FF+  W V+K+++Y A  +FFA   +P+A+    + L+PK  +P +  DY
Sbjct  100  FFKKAWTVIKENIYEAISEFFATDVMPKAINYTTVTLLPKITNPTNIKDY  149



>gb|EEE69144.1| hypothetical protein OsJ_28268 [Oryza sativa Japonica Group]
Length=1256

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++  W ++KDD+  A  +FF+   +P  +    IVLIPK   P+   D+R
Sbjct  532  GRFYQRNWAILKDDIVRAVQEFFSSGTMPSGVNETAIVLIPKTEQPQELKDFR  584



>gb|EAZ07996.1| hypothetical protein OsI_30258 [Oryza sativa Indica Group]
Length=633

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++  W ++KDD+  A  +FF+   +P  +    IVLIPK   P+   D+R
Sbjct  532  GRFYQRNWAILKDDIVRAVQEFFSSGTMPSGVNETAIVLIPKTEQPQELKDFR  584



>ref|XP_009790965.1| PREDICTED: uncharacterized protein LOC104238338 [Nicotiana sylvestris]
Length=1302

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F+  CW+++ DD+Y     FF G  +P+ +    +VL+PKK    +F++ R
Sbjct  111  TGKFYHSCWDLIGDDLYDMVRAFFNGHELPKFVTHTNLVLLPKKKEVTTFSNLR  164



>ref|XP_009121302.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=530

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (53%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F+  CWE V D V    L+FF    +P     A +VLIPK   PES T +R
Sbjct  87   FYHRCWETVGDSVVRFVLNFFETGTLPEGTNDALVVLIPKILKPESITQFR  137



>ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica]
 gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica]
Length=922

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  195  SMSFFQSCWEVVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYR  248



>ref|XP_008390125.1| PREDICTED: uncharacterized protein LOC103452416 [Malus domestica]
Length=1072

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F+   W+++  +V G  +DF  G    R++ S  IVLIPK  HPES + YR
Sbjct  456  GIFYHXFWDIIVAEVNGLVMDFMQGEGNTRSLNSTYIVLIPKVPHPESVSQYR  508



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F+++ WE++K D+     DFF    +PR +    I LIPK  HP+S   YR
Sbjct  776  NGLFYQNHWEIIKYDLLRLVEDFFNSGSLPRQLNKTIIALIPKTNHPQSLEQYR  829



>ref|XP_010068386.1| PREDICTED: uncharacterized protein LOC104455266 [Eucalyptus grandis]
Length=441

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F+R  WE++K D++ A   FF    +P ++ S  I LIPK  +PES   YR
Sbjct  347  NGLFYRSRWEIIKVDIHRAVQQFFQYGILPPSLNSTAITLIPKTPNPESMDQYR  400



>emb|CAB78008.1| putative protein [Arabidopsis thaliana]
 emb|CAB82119.1| putative protein [Arabidopsis thaliana]
Length=947

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CWEVV + V   ALDFF+   +P     A +VLIPK   PE    +R
Sbjct  213  FYQSCWEVVGNSVIRFALDFFSSGILPPQTNDALVVLIPKVPKPERMNQFR  263



>emb|CAN79789.1| hypothetical protein VITISV_039779 [Vitis vinifera]
Length=1566

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F++ CW+ VKD++ G   DFF      R++ S  +VL+PKK   E   DYR
Sbjct  851  AFWQFCWDFVKDEIMGLFKDFFERGKFVRSLNSTFLVLVPKKXGAEDLRDYR  902



>ref|XP_010327335.1| PREDICTED: uncharacterized protein LOC104649568 [Solanum lycopersicum]
Length=481

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+ CW ++K D+ G    F +G  IP+  + + I+L+PK ++ + F ++R
Sbjct  346  NGYFFQKCWHIIKHDLMGVVNAFISGQMIPKYFSHSCIILLPKVSNLKKFNEFR  399



>ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica]
 gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica]
Length=1117

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  438  SMSFFQSCWEVVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYR  491



>emb|CDP18963.1| unnamed protein product [Coffea canephora]
Length=677

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPK  130
            F++ CWE++KDD+  +  DFF GV  P+  +S+ IVL+PK
Sbjct  152  FYQKCWEIIKDDLVKSIHDFFRGVSQPQGWSSSLIVLVPK  191



>ref|XP_008347064.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=821

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F+   W+++  +V G  +DF  G    R++ S  IVLIPK  HPES + YR
Sbjct  117  GIFYHXFWDIIVAEVNGLVMDFMQGEGNTRSLNSTYIVLIPKVPHPESVSQYR  169



>ref|XP_002465040.1| hypothetical protein SORBIDRAFT_01g031070 [Sorghum bicolor]
 gb|EER92038.1| hypothetical protein SORBIDRAFT_01g031070 [Sorghum bicolor]
Length=446

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F+R  W  +K+D++    +F+    +P ++ + +IVLIPKK H    TDYR
Sbjct  36   AFYRAAWPWIKNDIHKLITNFYINGRLPASLNATEIVLIPKKIHANLVTDYR  87



>ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica]
 gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica]
Length=928

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  202  SLSFFQSCWEVVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYR  255



>emb|CAD41563.3| OSJNBa0006A01.18 [Oryza sativa Japonica Group]
Length=1189

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 9/59 (15%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRA-----MASAQIVLIPKKAHPESFTDYR  163
            +G+FF+ CWE++KDD+    L  F+ +   R      + SA IVLIPKK   ES +DYR
Sbjct  463  TGAFFKVCWEIIKDDI----LLVFSSIYNLRCAHLNLLNSANIVLIPKKDGAESVSDYR  517



>ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica]
 gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica]
Length=983

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  344  SMSFFQSCWEVVKGDLMKVMQDFFHSGIVNGVTNETFICLIPKKANSVKVTDYR  397



>ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
 gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica]
Length=1499

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  751  SMSFFQSCWEVVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYR  804



>gb|AAP06925.1| putative reverse transcriptase [Oryza sativa Japonica Group]
 gb|ABF95199.1| retrotransposon protein, putative, LINE subclass [Oryza sativa 
Japonica Group]
Length=870

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 9/59 (15%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRA-----MASAQIVLIPKKAHPESFTDYR  163
            +G+FF+ CWE++KDD+    L  F+ +   R      + SA IVLIPKK   ES +DYR
Sbjct  463  TGAFFKVCWEIIKDDI----LLVFSSIYNLRCAHLNLLNSANIVLIPKKDGAESVSDYR  517



>ref|XP_009792450.1| PREDICTED: uncharacterized protein LOC104239503 [Nicotiana sylvestris]
Length=236

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPR  94
            +G FF  CWEV+K+D+    L FF G+P+PR
Sbjct  206  NGKFFEACWEVIKEDLLNVVLSFFKGIPMPR  236



>ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica]
 gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica]
Length=1421

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S SFF+ CWEVVK D+     DFF    +        I LIPKKA+    TDYR
Sbjct  728  SMSFFQSCWEVVKGDLMKVMQDFFQSGIVNGVTNETFICLIPKKANSVKVTDYR  781



>emb|CCA66180.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  W+++K D+YG   DF+    +P+   +A I LIPK  +P S  DYR
Sbjct  456  FVKSAWDIIKTDIYGIVNDFWETGCLPQGCNTAYIALIPKIDNPSSLKDYR  506



>emb|CAN65201.1| hypothetical protein VITISV_016555 [Vitis vinifera]
Length=246

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F++ CWE VKD++ G   DF+      R++ S  +VL+PKK   +   DYR
Sbjct  79   AFWQFCWEFVKDEIIGFFKDFYERGKFVRSLNSTFLVLVPKKGRTDDLRDYR  130



>ref|XP_006584215.1| PREDICTED: uncharacterized protein LOC102669059 [Glycine max]
Length=252

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            + +FF+ CW +V  DV     +FF    +P+A+ ++ I LIPK+ +P    D+
Sbjct  106  NSNFFKECWSIVGKDVCDRVHEFFCNTELPKAIIASFITLIPKQDYPLGLADF  158



>gb|ABD28670.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=642

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            FF+  W +VK DVY A LDFF    +P    +  I+LIPK  + +S   YR
Sbjct  204  FFQIYWNIVKKDVYEAVLDFFKNGWLPNNFNANSIILIPKTPNADSVDQYR  254



>ref|XP_009783630.1| PREDICTED: uncharacterized protein LOC104232192 [Nicotiana sylvestris]
Length=335

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +FF+ CW+++KDD+     + F G  + +  +   +VLIPK   P SF++ R
Sbjct  206  TFFQKCWDIIKDDITNFVQEIFNGKRLTKFFSQTCLVLIPKVKSPNSFSELR  257



>emb|CAN61039.1| hypothetical protein VITISV_018673 [Vitis vinifera]
Length=1941

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S +F + CW+ VKD++ G   DFF      R++ +  +VLIPKK   E  +D+R
Sbjct  1539  SLAFLQFCWDFVKDEIMGFFKDFFERGKFVRSLNTTFLVLIPKKGXAEDLSDFR  1592



>emb|CAD40197.1| OSJNBb0043H09.5 [Oryza sativa Japonica Group]
Length=858

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++ +D Y  A +FF      + + ++ I LIPKK+ PE+  DYR
Sbjct  300  NGMFMKKCWNIIAEDFYKLAREFFGLQSSIQNLNNSFICLIPKKSSPETANDYR  353



>ref|XP_010319606.1| PREDICTED: uncharacterized protein LOC104646845 [Solanum lycopersicum]
Length=262

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            G F++ C++++++D+  A   FF G  +PR M  A +VL+PK  H     DY
Sbjct  211  GKFYQVCFDIIQEDMLAAVSSFFNGNVMPRYMTHACLVLLPKIDHLNKLKDY  262



>gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=732

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CW++V D V    LDFFA   +P     A +VLI K   PE  T +R
Sbjct  16   FYQDCWDIVGDSVSRFVLDFFASGKLPEGTNDAIVVLIAKVLKPERITQFR  66



>ref|XP_011079190.1| PREDICTED: uncharacterized protein LOC105162767 [Sesamum indicum]
Length=603

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 28/54 (52%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    IVL+PK  H  S  DYR
Sbjct  293  SSCFFKKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIIVLVPKSDHSTSVADYR  346



>ref|XP_011079166.1| PREDICTED: uncharacterized protein LOC105162745 [Sesamum indicum]
Length=568

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W VV D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  429  SSCFFKKAWNVVGDQVCRAVLDFFRNGRMLRQLNHTVIALVPKSEHSSSVADYR  482



>ref|XP_010239032.1| PREDICTED: uncharacterized protein LOC104584909 [Brachypodium 
distachyon]
Length=621

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++K+++Y    DFF+     +A+  + I LIPKK  PE+  D+R
Sbjct  349  NGLFSKLCWHIIKEEIYALCEDFFSRKIGLKALNDSFITLIPKKLDPETTNDFR  402



>ref|XP_010495633.1| PREDICTED: uncharacterized protein LOC104772751 [Camelina sativa]
Length=803

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FFRHCW +V ++V  A L+FF    +  +  S  + +I K ++ E+  DYR
Sbjct  141  TGEFFRHCWGIVGEEVTAAVLNFFTHGKMEPSWNSTAVSMIAKVSNAETVGDYR  194



>ref|XP_009769452.1| PREDICTED: uncharacterized protein LOC104220308 [Nicotiana sylvestris]
Length=552

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            SFF+ CW+++ DD+       F G   PR +    +VL+PKK    +F+D R
Sbjct  442  SFFQTCWDIIGDDIVDMVKALFNGHDFPRYVTHTNLVLLPKKKEVVTFSDVR  493



>ref|XP_010039996.1| PREDICTED: uncharacterized protein LOC104428743 [Eucalyptus grandis]
Length=1237

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+  WE++K +V     DFF    +PRA+    +VL+PK  H ES   YR
Sbjct  328  NGLFFQQHWEIIKANVIKTVRDFFTLGIMPRALNRTILVLVPKVHHLESIDQYR  381



>emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1383

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F +  WEV+K DVY     F+    +P+   +A I LIPK   P SF DYR
Sbjct  454  NFIKSAWEVIKQDVYDMVRRFWNTGYLPKGCNTAFIALIPKVESPMSFKDYR  505



>ref|XP_007219138.1| hypothetical protein PRUPE_ppa015983mg, partial [Prunus persica]
 gb|EMJ20337.1| hypothetical protein PRUPE_ppa015983mg, partial [Prunus persica]
Length=574

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            G F+++ WE+V  D+ G   +FFAG     A+ S  IVLIPK  +P++ ++Y
Sbjct  238  GIFYQNYWEIVHYDIQGTVEEFFAGRTSLGALNSTNIVLIPKVPNPKNVSEY  289



>ref|XP_010696208.1| PREDICTED: uncharacterized protein LOC104908756 [Beta vulgaris 
subsp. vulgaris]
Length=1168

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F +  WEV+K DVY     F+    +P+   +A I L+PK   P SF DYR
Sbjct  239  NFVKTAWEVIKQDVYDMVRRFWNTAKLPKGCNNAFIALVPKIETPTSFKDYR  290



>ref|XP_009796827.1| PREDICTED: uncharacterized protein LOC104243350 [Nicotiana sylvestris]
Length=408

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKK  133
            +G F+  CW+++ DD+Y     FF G  +P+ +    +VL+PKK
Sbjct  358  TGKFYHSCWDIIGDDLYDMVRAFFNGHELPKCVTHTNLVLLPKK  401



>gb|ABB46931.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1853

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  5     GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             G F++  W ++KDD+  A  +FF+   +P  +    IVLIPK   P+   D+R
Sbjct  989   GRFYQRNWAILKDDIVRAVQEFFSLGTMPSGVNETAIVLIPKTEQPQELKDFR  1041



>ref|XP_011102274.1| PREDICTED: uncharacterized protein LOC105180303 [Sesamum indicum]
Length=575

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FFR  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  444  SSCFFRKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIIALVPKSDHSTSVADYR  497



>ref|XP_010671205.1| PREDICTED: uncharacterized protein LOC104888072 [Beta vulgaris 
subsp. vulgaris]
Length=1592

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  W++VK D+Y     F+A   +P+    A I LIPK  +P SF D+R
Sbjct  666  FIKSAWDIVKHDIYEMVHKFWASSQLPQGCNVAYIALIPKIDNPSSFKDFR  716



>gb|AAM01179.2|AC113336_31 Putative retroelement [Oryza sativa Japonica Group]
Length=1888

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  5     GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             G F++  W ++KDD+  A  +FF+   +P  +    IVLIPK   P+   D+R
Sbjct  1024  GRFYQRNWAILKDDIVRAVQEFFSLGTMPSGVNETAIVLIPKTEQPQELKDFR  1076



>ref|XP_009124161.1| PREDICTED: uncharacterized protein LOC103849097 [Brassica rapa]
Length=610

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +  FF+  WEV+ DDV  A   FF    +P+ + S  + LIPKK   +   DYR
Sbjct  186  TSEFFKEAWEVIGDDVIVAIQSFFVKGFLPKGVNSTILALIPKKEESKMMKDYR  239



>ref|XP_010683801.1| PREDICTED: uncharacterized protein LOC104898413 [Beta vulgaris 
subsp. vulgaris]
Length=515

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +2

Query  5    GSFF-RHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            GSF+ +  W ++ D+V    LDFF    + +A+ + QI+LIPK A P++ +D+R
Sbjct  414  GSFYYKDAWTIMGDEVTDVVLDFFEHGKMLKALNTTQIILIPKIACPKNVSDFR  467



>ref|XP_002445957.1| hypothetical protein SORBIDRAFT_07g028675 [Sorghum bicolor]
 gb|EES15452.1| hypothetical protein SORBIDRAFT_07g028675 [Sorghum bicolor]
Length=587

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 7/58 (12%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFF----AGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+FF+ CWE++KDD+  A    F     G+     + SA IVL+PKK      TDYR
Sbjct  413  TGAFFKACWEIIKDDLTEAINSLFHLNSQGLEF---LNSANIVLLPKKTDALKITDYR  467



>ref|XP_009787157.1| PREDICTED: uncharacterized protein LOC104235159 [Nicotiana sylvestris]
Length=698

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++ CWE++K+DV       F G  + +++    +VL+PKK    +F D R
Sbjct  139  TGAFYQTCWEIIKEDVVRMVKALFCGQQLLKSVTHTNLVLLPKKKEVTTFADMR  192



>ref|XP_011101240.1| PREDICTED: uncharacterized protein LOC105179344 [Sesamum indicum]
Length=205

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 26/54 (48%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W VV D V  A LDFF    + R +    I L+PK  H     DYR
Sbjct  96   SSCFFKKAWNVVGDQVCRAVLDFFKSGRMLRQLNHTIIALVPKSEHSTYIADYR  149



>ref|XP_010484806.1| PREDICTED: uncharacterized protein LOC104763089 [Camelina sativa]
Length=1130

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++HCW++V   V    LDFF    +PR +  A +VLI K   PE+   +R
Sbjct  375  FYQHCWDMVGTSVTRFVLDFFETGVLPRELNDALVVLIAKVVKPENMAQFR  425



>emb|CAN77234.1| hypothetical protein VITISV_010061 [Vitis vinifera]
Length=3216

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2     SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
             S +F++ CW+ VKD+V G   DF+      R++ S  +VLIPKK   E   D+R
Sbjct  1016  SLAFWQFCWDFVKDEVLGFFKDFYERGKFVRSLNSTFLVLIPKKCGAEDLXDFR  1069



>gb|EAZ23960.1| hypothetical protein OsJ_07686 [Oryza sativa Japonica Group]
Length=192

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++  D Y  A  F  G    +++ ++ I L+PKK  PE+  D+R
Sbjct  46   NGVFLKRCWHIIAQDFYRLAAHFHLGCTDLQSLNNSFITLVPKKNSPETVNDFR  99



>ref|XP_004252203.1| PREDICTED: uncharacterized protein LOC101264798 [Solanum lycopersicum]
Length=547

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+ CW ++K+ +       F G  IP+  + + IVL+PK  +P  FT++R
Sbjct  197  NGYFFQKCWNIIKEYLMEVLHALFNGKIIPKYFSHSCIVLLPKVNNPNKFTEFR  250



>ref|XP_011101679.1| PREDICTED: uncharacterized protein LOC105179730 [Sesamum indicum]
Length=577

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 28/54 (52%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W++V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  255  SSCFFKKAWDIVGDQVCRAVLDFFRSGRMLRQLNHTIIALVPKSDHSTSVADYR  308



>ref|XP_010030447.1| PREDICTED: uncharacterized protein LOC104420277 [Eucalyptus grandis]
Length=1110

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F++  WE +KDD+     DFF    +   +  A IVLIPK   PE+ + +R
Sbjct  414  NGTFYQQSWERIKDDLAQLVQDFFQKGVLDNRLNQAHIVLIPKVKSPENISQFR  467



>ref|XP_010026225.1| PREDICTED: uncharacterized protein LOC104416548 [Eucalyptus grandis]
Length=724

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F++  W++V+ D++    +FF+   +P+ +    +VLIPK  HPES   +R
Sbjct  375  NGLFYQTHWDIVQHDIFRLVQEFFSSGVLPKDLNKTVLVLIPKINHPESLDQFR  428



>emb|CAN65100.1| hypothetical protein VITISV_039725 [Vitis vinifera]
Length=1022

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDY  160
            +F+  CW+ VKD++ G   DFF      R++ +  +VLIPKK   E  TD+
Sbjct  363  AFWHFCWDFVKDEIMGFFKDFFERGKFVRSLNTTFLVLIPKKGGAEDLTDF  413



>emb|CAN77005.1| hypothetical protein VITISV_027306 [Vitis vinifera]
Length=549

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F+++CWE+VK+DV     +F+      R++    +VLIPKK   E   DYR
Sbjct  18   FWQNCWEIVKEDVLDMFKEFYEQNSFIRSLNHTFLVLIPKKGGAEDLDDYR  68



>emb|CAN82968.1| hypothetical protein VITISV_021857 [Vitis vinifera]
Length=1122

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F++ CW+ VKD++ G   DFF      R++ S  +VL+PKK   +   DYR
Sbjct  372  AFWQFCWDFVKDEIMGFFKDFFERGKFVRSLNSTFLVLVPKKGGVKELRDYR  423



>emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera]
Length=1971

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CW+VVK+++ G  L+F       R++ S  +VLIPKKA  E   D+R
Sbjct  768  FWQFCWDVVKEEIMGFLLEFHERGRFVRSLNSTFLVLIPKKAGAEDLRDFR  818



>ref|XP_008234850.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=1009

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+FF++ W VV DDV+     FF    +PR +    I LIPK  +P +   +R
Sbjct  84   TGAFFQNHWSVVGDDVFRVVQSFFHSGKLPRRLNHTHITLIPKVLNPRNMKQWR  137



>gb|EEE52042.1| hypothetical protein OsJ_33770 [Oryza sativa Japonica Group]
Length=222

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 27/51 (53%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++  W V+K DV  A  +FF+   +P  +    IVLIPK   P    DYR
Sbjct  141  FYQRNWGVIKADVIRAVKEFFSSGEMPEGINDTAIVLIPKTQQPLEMKDYR  191



>ref|XP_010314994.1| PREDICTED: uncharacterized protein LOC101245446, partial [Solanum 
lycopersicum]
Length=665

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G+F+ H WE +K  +     DFF      ++M    + LIPK A P   +DYR
Sbjct  242  TGAFYHHYWEDIKQSIMAEVHDFFEKGIFDKSMNHTNLCLIPKPASPRHMSDYR  295



>ref|XP_006574236.1| PREDICTED: uncharacterized protein LOC102669276 [Glycine max]
Length=323

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F +  WE++K D      +F A    PR   ++ I LIPK  HP+SF DYR
Sbjct  232  FIKEFWEMMKTDFRRFVDEFHAHDSFPRGSNASFIALIPKTKHPQSFDDYR  282



>ref|XP_010668002.1| PREDICTED: uncharacterized protein LOC104884990 [Beta vulgaris 
subsp. vulgaris]
Length=1509

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F ++ W+++K+D+Y    +F+    +P+   +A + LIPK   P  F D+R
Sbjct  583  FIKNSWDLIKEDIYAIVFEFWQTSHLPKGCNTALVALIPKTNPPNGFKDFR  633



>ref|XP_010674861.1| PREDICTED: uncharacterized protein LOC104890940 [Beta vulgaris 
subsp. vulgaris]
Length=470

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CWE+V D+V  A LDFF    + + +    + LIPK   P + T++R
Sbjct  372  FYKKCWEIVGDEVTEAILDFFKTGKLLKVINITTLTLIPKTHCPSNVTEFR  422



>ref|XP_010666564.1| PREDICTED: uncharacterized protein LOC104883706 [Beta vulgaris 
subsp. vulgaris]
Length=1112

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+  W ++K+D+Y A  +FF    I + +    I LIPKK +     DYR
Sbjct  503  NGVFFKKTWHIIKNDIYDAVFEFFEQAFIHQPVNCTAITLIPKKDNALYAKDYR  556



>ref|XP_011083347.1| PREDICTED: uncharacterized protein LOC105165891 [Sesamum indicum]
Length=513

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  402  SSCFFKKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIIALVPKSDHSTSVADYR  455



>ref|XP_009598913.1| PREDICTED: uncharacterized protein LOC104094650 [Nicotiana tomentosiformis]
Length=780

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G FF+  W+++++D+Y   L+   G  + + +    +VLIPK  +P+SF + R
Sbjct  403  NGRFFQQTWDIIEEDIYNMVLEVMNGRELSKFITHTCLVLIPKVENPQSFFELR  456



>ref|XP_011079179.1| PREDICTED: uncharacterized protein LOC105162756 [Sesamum indicum]
Length=652

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  268  SSCFFKKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIITLVPKSNHSTSVADYR  321



>ref|XP_004242524.1| PREDICTED: uncharacterized protein LOC101258077 [Solanum lycopersicum]
Length=1454

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F++ C++++K D+  A   F+ G  +P+ M  A ++L+PK  HP    ++R
Sbjct  527  GKFYQTCFDIIKKDLLAAVNYFYIGNSMPKYMTHACLILLPKVEHPCKLKEFR  579



>ref|XP_011094002.1| PREDICTED: uncharacterized protein LOC105173820 [Sesamum indicum]
Length=173

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+    VV D V  A LDFF    + R +    I L+PK  H  S TDYR
Sbjct  96   SSCFFKKARNVVGDQVCKAVLDFFRSGRMLRQLNHTIIALVPKSEHSTSVTDYR  149



>ref|XP_011081488.1| PREDICTED: uncharacterized protein LOC105164532 [Sesamum indicum]
Length=537

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 26/54 (48%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W VV D V    LDFF    + R +    I L+PK  H  S  DYR
Sbjct  386  SSCFFKKAWNVVGDQVCRVVLDFFRNGRMLRQLNHTVIALVPKSEHSSSVADYR  439



>ref|XP_010684861.1| PREDICTED: uncharacterized protein LOC104899382 [Beta vulgaris 
subsp. vulgaris]
Length=388

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W+VV  ++  A LDFF    + + + +  + LIPK   PES T +R
Sbjct  319  SSGFFKDAWDVVGPEITNAVLDFFRIGKLLKQLNATNLCLIPKVEQPESVTQFR  372



>ref|XP_011081181.1| PREDICTED: uncharacterized protein LOC105164266 [Sesamum indicum]
Length=808

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  173  SSCFFKKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIIALVPKSDHSTSVADYR  226



>ref|XP_011100542.1| PREDICTED: uncharacterized protein LOC105178709 [Sesamum indicum]
Length=547

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  465  SSCFFKKAWNIVGDQVCRAVLDFFRSGRMLRQLNHTIIALVPKSDHSTSVADYR  518



>ref|XP_007036030.1| Uncharacterized protein TCM_021518 [Theobroma cacao]
 gb|EOY06956.1| Uncharacterized protein TCM_021518 [Theobroma cacao]
Length=1702

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPR  94
            S  F++HCW+++K D+  A LDFF G P+P+
Sbjct  697  SSLFYQHCWDIIKQDLLEAVLDFFKGTPMPQ  727



>emb|CAN64551.1| hypothetical protein VITISV_030815 [Vitis vinifera]
Length=350

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F++ CW+ VKDD+ G   DFF      R+  S  +VL+PKK   +   DYR
Sbjct  222  AFWQFCWDFVKDDLMGFFKDFFERGKFVRSPNSTFLVLVPKKGGADDLRDYR  273



>ref|XP_011102248.1| PREDICTED: uncharacterized protein LOC105180271 [Sesamum indicum]
Length=1096

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W VV D V  A L+FF    + R +    I L+PK  H  S  DYR
Sbjct  465  SSCFFKKAWNVVADQVCRAVLNFFRNGRMLRQLNHTVIALVPKSEHSSSVADYR  518



>ref|XP_009151561.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1204

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 27/51 (53%), Gaps = 0/51 (0%)
 Frame = +2

Query  11   FFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            F++ CWE V   V    L FF    +P     A +VLIPK + PES T +R
Sbjct  293  FYQRCWETVGPSVISFILRFFEVGKLPENTNDALVVLIPKVSKPESITQFR  343



>gb|AAW56921.1| hypothetical protein [Oryza sativa Japonica Group]
Length=552

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F   CW+++K D Y  A  FF+       +  + I LIPKK  PE+  D+R
Sbjct  13   NGLFLNKCWDIIKQDFYELAYQFFSNNISLENVNHSFITLIPKKLSPETANDFR  66



>ref|XP_011101914.1| PREDICTED: uncharacterized protein LOC105179953 [Sesamum indicum]
Length=327

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            S  FF+  W +V D V  A LDFF    + R +    I L+PK  H  S  DYR
Sbjct  216  SSCFFKKAWNIVGDQVCRAVLDFFRCGRMLRQLNHTIIALVPKSDHSTSVADYR  269



>gb|AAQ56501.1| putative transposon protein [Oryza sativa Japonica Group]
Length=766

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F   CW ++K D Y  A  FF        +  + I LIPKK  PE+  D+R
Sbjct  196  NGLFLNKCWSIIKQDFYELAFQFFTNNVSLENLNHSFITLIPKKPTPETANDFR  249



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score = 45.8 bits (107),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    GSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            G F+   W  + DDV G   D+  GV  P+ + S  IVL+PK ++P+S   +R
Sbjct  373  GIFYHSFWNSLMDDVNGIVQDYMLGVSDPQRLNSTHIVLVPKISNPDSVGQFR  425



>gb|AAX96619.1| retrotransposon protein, putative, LINE sub-class [Oryza sativa 
Japonica Group]
 gb|ABA92975.1| retrotransposon protein, putative, LINE subclass [Oryza sativa 
Japonica Group]
Length=660

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    SGSFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +G F + CW ++  D Y  A  F A     + + S+ I L+PKK  PE+  DYR
Sbjct  465  NGFFMKKCWHIIAQDYYRLAAYFHAECTNLKILNSSYITLVPKKNSPETVNDYR  518



>emb|CAN74005.1| hypothetical protein VITISV_006236 [Vitis vinifera]
Length=533

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  8    SFFRHCWEVVKDDVYGAALDFFAGVPIPRAMASAQIVLIPKKAHPESFTDYR  163
            +F++ CW  VKD++ G   DFF      R++ +  +VLIPK    E  +D+R
Sbjct  63   AFWQFCWNFVKDEIMGFFKDFFERGKFVRSLNTTFLVLIPKIGRAEDLSDFR  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618