BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49254_g1_i1 len=108 path=[1:0-107]

Length=108
                                                                      Score     E

ref|XP_005552109.1|  PREDICTED: uncharacterized protein LOC102125345  55.1    6e-08   
gb|EAW64299.1|  EF-hand domain family, member B, isoform CRA_a        53.5    1e-06   



>ref|XP_005552109.1| PREDICTED: uncharacterized protein LOC102125345 [Macaca fascicularis]
Length=238

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  102  SFLDHKERGLGCWILVVLYQRV*HCLCAQG  13
            +FLD+KERG GCWILVVLYQ   HCLCAQG
Sbjct  193  AFLDYKERGPGCWILVVLYQHDQHCLCAQG  222



>gb|EAW64299.1| EF-hand domain family, member B, isoform CRA_a [Homo sapiens]
Length=1159

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  9    LTPERKGNVRHAGKGPLESSSPDPFLCGPEMR  104
            LT E KGNV HAGKGPLESSSP PFLCG E R
Sbjct  943  LTSEHKGNVGHAGKGPLESSSPGPFLCGQERR  974


 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  9    LTPERKGNVRHAGKGPLESSSPDPFLCGPE  98
            LTPE KGNV HAGKGPLESSSPD F CG E
Sbjct  882  LTPECKGNVGHAGKGPLESSSPDRFPCGQE  911



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584