BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c49062_g1_i1 len=182 path=[160:0-181]

Length=182
                                                                      Score     E

gb|KDP22272.1|  hypothetical protein JCGZ_26103                       50.1    2e-05   
gb|KDP30964.1|  hypothetical protein JCGZ_11340                       48.5    1e-04   
ref|XP_002511241.1|  Anthranilate N-benzoyltransferase protein, p...  47.0    3e-04   Ricinus communis



>gb|KDP22272.1| hypothetical protein JCGZ_26103 [Jatropha curcas]
Length=316

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +2

Query  2    VGRVVEAIDKVTNEYVREMHVEGGYLRAILAHSKEY-DNKDETKMLRITSVCKFPFGEVD  178
            VG + E+I++   EYVR++H EG Y   +  +S+E   N +  K+   +S C+FPF E D
Sbjct  241  VGNLRESIERKNKEYVRKIHAEGRYFEFLKKNSEELGKNPNLMKVFGFSSWCRFPFYEAD  300

Query  179  F  181
            F
Sbjct  301  F  301



>gb|KDP30964.1| hypothetical protein JCGZ_11340 [Jatropha curcas]
Length=423

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +2

Query  5    GRVVEAIDKVTNEYVREMHVEGGYLRAILAHSKEY-DNKDETKMLRITSVCKFPFGEVDF  181
            G + E+I+++ NEYVR++H  G Y   +   S+E   N +  K+   +S C+FPF E DF
Sbjct  305  GNLHESIERMNNEYVRKIHAGGRYFEFMKKKSEELGKNPNLMKVFGFSSWCRFPFYEADF  364



>ref|XP_002511241.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51843.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=435

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  5    GRVVEAIDKVTNEYVREMHVEGGYLRAILAHSKEYDNK-DETKMLRITSVCKFPFGEVDF  181
            G++ E+I K+ N +VR++H  GGY   +   ++E   + + T++   +S C+FPF E DF
Sbjct  317  GKLHESIGKMDNNFVRKIHAGGGYFHFLKKKAEELGRRPNLTRVFGFSSWCRFPFYEADF  376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508434916518