BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4904_g1_i1 len=597 path=[157:0-474 78:475-596]

Length=597
                                                                      Score     E

gb|EYU33560.1|  hypothetical protein MIMGU_mgv1a011671mg                259   5e-83   
ref|XP_010060500.1|  PREDICTED: uncharacterized protein LOC104448399    250   1e-79   
ref|XP_009590154.1|  PREDICTED: uncharacterized protein LOC104087410    248   6e-79   
ref|XP_008386092.1|  PREDICTED: uncharacterized protein LOC103448604    248   1e-78   
ref|XP_002316935.2|  hypothetical protein POPTR_0011s12710g             248   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_009350026.1|  PREDICTED: uncharacterized protein LOC103941543    246   5e-78   
gb|KDP38951.1|  hypothetical protein JCGZ_00708                         245   9e-78   
ref|XP_008226719.1|  PREDICTED: uncharacterized protein LOC103326285    244   3e-77   
ref|XP_008366305.1|  PREDICTED: uncharacterized protein LOC103429950    244   3e-77   
ref|XP_009765063.1|  PREDICTED: uncharacterized protein LOC104216650    243   1e-76   
ref|XP_009377337.1|  PREDICTED: uncharacterized protein LOC103965958    242   2e-76   
ref|XP_007211808.1|  hypothetical protein PRUPE_ppa009905mg             242   3e-76   
ref|XP_004244184.1|  PREDICTED: uncharacterized protein LOC101267253    241   4e-76   
ref|XP_009334578.1|  PREDICTED: uncharacterized protein LOC103927387    241   5e-76   
ref|XP_010520891.1|  PREDICTED: uncharacterized protein LOC104799905    241   1e-75   
ref|XP_006360124.1|  PREDICTED: uncharacterized protein LOC102584127    240   2e-75   
ref|XP_002525765.1|  conserved hypothetical protein                     239   3e-75   Ricinus communis
ref|XP_003540028.1|  PREDICTED: uncharacterized protein LOC100779569    239   4e-75   
emb|CDP05849.1|  unnamed protein product                                238   5e-75   
ref|XP_004510014.1|  PREDICTED: uncharacterized protein LOC101489475    238   9e-75   
ref|XP_011095267.1|  PREDICTED: uncharacterized protein LOC105174777    237   2e-74   
ref|XP_011044527.1|  PREDICTED: uncharacterized protein LOC105139684    236   6e-74   
emb|CDY18312.1|  BnaC09g30620D                                          236   8e-74   
ref|XP_004294477.1|  PREDICTED: uncharacterized protein LOC101312706    235   9e-74   
ref|XP_007021251.1|  Uncharacterized protein isoform 1                  235   1e-73   
ref|XP_006401599.1|  hypothetical protein EUTSA_v10014333mg             235   1e-73   
ref|XP_011098364.1|  PREDICTED: uncharacterized protein LOC105177039    234   2e-73   
ref|XP_010101767.1|  hypothetical protein L484_018723                   234   3e-73   
emb|CDY14323.1|  BnaA10g07320D                                          234   3e-73   
ref|NP_200235.1|  uncharacterized protein                               233   9e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010904871.1|  PREDICTED: uncharacterized protein LOC105032189    232   2e-72   
ref|XP_009119958.1|  PREDICTED: uncharacterized protein LOC103844884    231   4e-72   
gb|KEH19601.1|  membrane lipoprotein lipid attachment site-like p...    230   7e-72   
ref|XP_002867508.1|  hypothetical protein ARALYDRAFT_492064             230   1e-71   
ref|XP_009127108.1|  PREDICTED: uncharacterized protein LOC103851983    230   1e-71   
ref|XP_010268858.1|  PREDICTED: uncharacterized protein LOC104605699    229   2e-71   
ref|XP_003539579.1|  PREDICTED: uncharacterized protein LOC100800264    229   2e-71   
ref|XP_010539256.1|  PREDICTED: uncharacterized protein LOC104813397    229   2e-71   
ref|XP_010482831.1|  PREDICTED: uncharacterized protein LOC104761448    229   3e-71   
ref|XP_010438626.1|  PREDICTED: uncharacterized protein LOC104722191    229   5e-71   
ref|XP_002866033.1|  predicted protein                                  229   5e-71   
ref|XP_010694437.1|  PREDICTED: uncharacterized protein LOC104907239    228   5e-71   
emb|CDY28788.1|  BnaA02g09800D                                          228   8e-71   
gb|KFK27041.1|  hypothetical protein AALP_AA8G326300                    228   1e-70   
ref|XP_010448148.1|  PREDICTED: uncharacterized protein LOC104730645    227   2e-70   
gb|AAM65012.1|  unknown                                                 226   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194465.1|  uncharacterized protein                               226   4e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66889.1|  hypothetical protein M569_07886                         225   8e-70   
ref|XP_006279675.1|  hypothetical protein CARUB_v10026913mg             225   1e-69   
ref|XP_010277977.1|  PREDICTED: uncharacterized protein LOC104612293    223   5e-69   
ref|XP_007132947.1|  hypothetical protein PHAVU_011G138400g             225   5e-69   
ref|XP_010446683.1|  PREDICTED: uncharacterized protein LOC104729440    223   5e-69   
gb|AAG40031.2|AF324680_1  AT4g27350                                     223   8e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146868.1|  PREDICTED: uncharacterized protein LOC101216671    222   1e-68   
ref|XP_008454626.1|  PREDICTED: uncharacterized protein LOC103494992    222   1e-68   
ref|XP_006413087.1|  hypothetical protein EUTSA_v10025946mg             222   2e-68   
ref|XP_006464666.1|  PREDICTED: uncharacterized protein LOC102623764    222   2e-68   
ref|XP_006452004.1|  hypothetical protein CICLE_v10009152mg             222   2e-68   
ref|XP_010433380.1|  PREDICTED: uncharacterized protein LOC104717502    222   2e-68   
ref|XP_010443000.1|  PREDICTED: uncharacterized protein LOC104725946    221   3e-68   
ref|XP_009412440.1|  PREDICTED: uncharacterized protein LOC103993925    221   4e-68   
ref|XP_006284150.1|  hypothetical protein CARUB_v10005286mg             221   7e-68   
ref|XP_010064913.1|  PREDICTED: uncharacterized protein LOC104452083    219   8e-68   
emb|CDY29300.1|  BnaC01g19520D                                          219   1e-67   
ref|XP_002281704.1|  PREDICTED: uncharacterized protein LOC100267563    219   2e-67   Vitis vinifera
emb|CDX89256.1|  BnaA01g16370D                                          218   8e-67   
ref|XP_009143344.1|  PREDICTED: uncharacterized protein LOC103867063    218   1e-66   
ref|XP_009417275.1|  PREDICTED: uncharacterized protein LOC103997696    211   2e-64   
ref|XP_009416064.1|  PREDICTED: uncharacterized protein LOC103996794    211   2e-64   
ref|XP_008812646.1|  PREDICTED: uncharacterized protein LOC103723499    209   1e-62   
ref|XP_006841846.1|  hypothetical protein AMTR_s00003p00270810          202   8e-61   
ref|XP_004958017.1|  PREDICTED: uncharacterized protein LOC101785046    192   4e-57   
gb|ACF84986.1|  unknown                                                 192   8e-57   Zea mays [maize]
gb|ACG40905.1|  uncharacterized secreted protein                        192   8e-57   Zea mays [maize]
gb|ABR16741.1|  unknown                                                 186   3e-54   Picea sitchensis
ref|XP_002463018.1|  hypothetical protein SORBIDRAFT_02g036300          185   3e-54   Sorghum bicolor [broomcorn]
ref|XP_003562894.1|  PREDICTED: uncharacterized protein LOC100835610    179   5e-52   
dbj|BAK01006.1|  predicted protein                                      177   3e-51   
ref|NP_001147369.1|  uncharacterized protein LOC100280977               177   4e-51   Zea mays [maize]
ref|NP_001059980.2|  Os07g0559400                                       176   1e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CDY41793.1|  BnaC02g13630D                                          151   1e-42   
gb|KHN47867.1|  hypothetical protein glysoja_036611                     152   2e-42   
gb|ACF87772.1|  unknown                                                 150   5e-42   Zea mays [maize]
ref|NP_001132600.1|  hypothetical protein                               149   2e-41   Zea mays [maize]
gb|KHN28014.1|  hypothetical protein glysoja_007746                     145   1e-39   
ref|XP_002969957.1|  hypothetical protein SELMODRAFT_67460              142   6e-38   
ref|XP_002981427.1|  hypothetical protein SELMODRAFT_57486              138   1e-36   
ref|XP_006370345.1|  hypothetical protein POPTR_0001s41850g             135   2e-36   
ref|XP_001765306.1|  predicted protein                                  135   3e-35   
ref|XP_002863162.1|  predicted protein                                  129   1e-34   
ref|WP_038324115.1|  hypothetical protein                               106   1e-24   
ref|WP_038073456.1|  hypothetical protein                               102   3e-23   
gb|KEO56495.1|  hypothetical protein TP2_02915                          103   5e-23   
ref|WP_038144034.1|  hypothetical protein                               102   8e-23   
ref|WP_033405572.1|  hypothetical protein                               100   1e-22   
gb|KFE36361.1|  hypothetical protein DW2_03594                          102   1e-22   
ref|WP_008618083.1|  hypothetical protein                               101   2e-22   
ref|WP_007067245.1|  hypothetical protein                               100   4e-22   
ref|WP_012830500.1|  hypothetical protein                               100   4e-22   
ref|WP_019015184.1|  hypothetical protein                               100   5e-22   
gb|KEP71620.1|  hypothetical protein DL1_01005                        99.0    1e-21   
ref|WP_007668525.1|  hypothetical protein                             99.0    1e-21   
ref|WP_028068782.1|  hypothetical protein                             99.4    1e-21   
ref|WP_027287438.1|  hypothetical protein                             99.0    1e-21   
ref|WP_036553511.1|  hypothetical protein                             97.8    4e-21   
ref|WP_036489243.1|  hypothetical protein                             97.1    6e-21   
gb|KDB02257.1|  hypothetical protein U879_18225                       97.1    7e-21   
ref|WP_038129451.1|  hypothetical protein                             95.9    1e-20   
ref|WP_011524695.1|  hypothetical protein                             95.9    2e-20   
ref|WP_038061508.1|  hypothetical protein                             95.5    2e-20   
ref|WP_008504901.1|  protein of unknown function DUF1223              96.3    2e-20   
gb|KEO60646.1|  hypothetical protein DT23_13070                       96.3    2e-20   
ref|WP_035845785.1|  hypothetical protein                             95.1    2e-20   
ref|XP_002893600.1|  hypothetical protein ARALYDRAFT_890548           91.7    2e-20   
ref|WP_008235272.1|  hypothetical protein                             94.7    3e-20   
ref|WP_025142804.1|  hypothetical protein                             95.5    4e-20   
ref|WP_007093134.1|  hypothetical protein                             95.1    4e-20   
ref|WP_007680398.1|  hypothetical protein                             94.4    6e-20   
ref|WP_013665894.1|  hypothetical protein                             94.7    6e-20   
ref|WP_038013633.1|  hypothetical protein                             94.4    6e-20   
ref|WP_027298489.1|  hypothetical protein                             94.4    6e-20   
ref|WP_035215978.1|  hypothetical protein                             92.8    7e-20   
ref|WP_028094457.1|  hypothetical protein                             94.0    8e-20   
ref|WP_028958004.1|  hypothetical protein                             94.0    8e-20   
ref|WP_022704761.1|  hypothetical protein                             93.6    9e-20   
ref|WP_037925677.1|  hypothetical protein                             93.6    1e-19   
ref|WP_039140477.1|  hypothetical protein                             94.0    1e-19   
ref|WP_025048723.1|  hypothetical protein                             93.2    1e-19   
ref|WP_035247254.1|  hypothetical protein                             92.8    2e-19   
ref|WP_037910709.1|  hypothetical protein                             92.8    2e-19   
gb|KHD09326.1|  hypothetical protein OT06_23695                       92.4    2e-19   
ref|WP_007425820.1|  hypothetical protein                             92.4    3e-19   
ref|WP_014537692.1|  coproporphyrinogen III oxidase                   92.4    3e-19   
ref|WP_026756182.1|  hypothetical protein                             92.4    3e-19   
ref|WP_011048028.1|  hypothetical protein                             93.2    3e-19   
ref|WP_009805074.1|  hypothetical protein                             92.0    3e-19   
ref|WP_037248701.1|  hypothetical protein                             91.7    4e-19   
ref|WP_007120141.1|  hypothetical protein                             92.0    4e-19   
gb|KHQ52125.1|  hypothetical protein OA50_03140                       91.7    4e-19   
ref|WP_035024872.1|  hypothetical protein                             91.7    5e-19   
gb|ETX30655.1|  hypothetical protein RISW2_07520                      91.7    5e-19   
ref|WP_021096718.1|  putative secreted protein                        91.7    5e-19   
emb|CCQ72189.1|  conserved protein of unknown function                91.7    5e-19   
ref|WP_037944578.1|  MULTISPECIES: hypothetical protein               91.3    6e-19   
ref|WP_027244047.1|  hypothetical protein                             91.3    8e-19   
ref|XP_006658691.1|  PREDICTED: uncharacterized protein LOC102717452  90.9    8e-19   
ref|WP_039182615.1|  hypothetical protein                             90.9    9e-19   
ref|WP_025057928.1|  hypothetical protein                             90.9    9e-19   
ref|WP_035338263.1|  hypothetical protein                             90.1    1e-18   
gb|AJE46349.1|  hypothetical protein P73_1634                         90.9    1e-18   
ref|WP_037279533.1|  hypothetical protein                             90.9    1e-18   
ref|WP_008556148.1|  hypothetical protein                             90.5    1e-18   
ref|WP_005854265.1|  MULTISPECIES: hypothetical protein               90.5    1e-18   
ref|WP_037262183.1|  hypothetical protein                             90.5    1e-18   
ref|WP_009507168.1|  hypothetical protein                             90.5    1e-18   
ref|WP_037210033.1|  hypothetical protein                             90.5    1e-18   
gb|ETW14497.1|  hypothetical protein ATO8_01270                       90.1    2e-18   
ref|WP_025056523.1|  hypothetical protein                             90.1    2e-18   
ref|WP_008032401.1|  hypothetical protein                             90.1    2e-18   
ref|WP_013551837.1|  hypothetical protein                             90.5    2e-18   
ref|WP_027259167.1|  hypothetical protein                             90.1    2e-18   
ref|WP_039001300.1|  hypothetical protein                             89.7    2e-18   
ref|WP_023849651.1|  hypothetical protein                             89.7    2e-18   
ref|WP_007813633.1|  hypothetical protein                             89.7    3e-18   
ref|WP_015499829.1|  hypothetical protein                             89.7    3e-18   
ref|WP_011455765.1|  hypothetical protein                             89.7    3e-18   
ref|WP_039166169.1|  hypothetical protein                             89.7    3e-18   
ref|WP_012791253.1|  hypothetical protein                             90.1    3e-18   
ref|WP_027237873.1|  hypothetical protein                             89.4    3e-18   
dbj|GAK44247.1|  conserved protein                                    89.7    3e-18   
ref|WP_005863370.1|  hypothetical protein                             89.4    4e-18   
ref|WP_007799450.1|  hypothetical protein                             89.0    4e-18   
ref|WP_036636727.1|  hypothetical protein                             89.0    5e-18   
gb|KFE60609.1|  hypothetical protein DB31_5948                        89.0    5e-18   
ref|WP_039130065.1|  hypothetical protein                             88.6    6e-18   
ref|WP_028725961.1|  hypothetical protein                             89.0    7e-18   
ref|WP_014132407.1|  hypothetical protein                             88.6    7e-18   
ref|WP_008885521.1|  hypothetical protein                             88.6    8e-18   
ref|WP_028033747.1|  hypothetical protein                             88.6    9e-18   
ref|WP_019295463.1|  MULTISPECIES: hypothetical protein               88.2    9e-18   
ref|WP_014221593.1|  hypothetical protein                             88.2    1e-17   
ref|WP_021101873.1|  hypothetical protein that often co-occurs wi...  87.8    1e-17   
ref|WP_013421052.1|  hypothetical protein                             87.8    1e-17   
ref|WP_036564474.1|  hypothetical protein                             87.4    1e-17   
ref|WP_005982379.1|  hypothetical protein                             87.8    1e-17   
ref|WP_008207287.1|  hypothetical protein                             87.8    1e-17   
ref|WP_027261169.1|  hypothetical protein                             87.4    2e-17   
ref|WP_009571436.1|  hypothetical protein                             87.8    2e-17   
ref|WP_010520718.1|  hypothetical protein                             87.4    2e-17   
ref|WP_029877079.1|  hypothetical protein                             87.8    2e-17   
ref|WP_039146327.1|  hypothetical protein                             87.4    2e-17   
ref|WP_013579675.1|  hypothetical protein                             87.4    2e-17   
ref|WP_009819160.1|  hypothetical protein                             87.4    2e-17   
ref|WP_039169929.1|  hypothetical protein                             87.4    2e-17   
ref|WP_009207913.1|  hypothetical protein                             87.8    2e-17   
ref|WP_010442055.1|  hypothetical protein                             87.0    2e-17   
ref|WP_009831103.1|  hypothetical protein                             87.0    2e-17   
ref|WP_036538700.1|  hypothetical protein                             87.0    2e-17   
ref|WP_020041922.1|  hypothetical protein                             87.0    3e-17   
ref|WP_015331335.1|  hypothetical protein                             86.7    3e-17   
ref|WP_035176823.1|  hypothetical protein                             87.0    3e-17   
ref|WP_029558748.1|  hypothetical protein                             86.7    3e-17   
ref|WP_022831038.1|  hypothetical protein                             87.0    3e-17   
ref|WP_027240054.1|  hypothetical protein                             86.7    3e-17   
ref|WP_009158408.1|  hypothetical protein                             86.3    4e-17   
ref|WP_024089872.1|  hypothetical protein                             86.3    4e-17   
gb|KFI24994.1|  hypothetical protein CG51_16910                       87.0    4e-17   
gb|EPX76266.1|  hypothetical protein that often co-occurs with ac...  86.7    4e-17   
gb|KFI31758.1|  hypothetical protein CN97_04835                       87.0    4e-17   
ref|WP_009814277.1|  hypothetical protein                             85.9    4e-17   
gb|KGM47984.1|  hypothetical protein ATO9_15425                       85.9    5e-17   
ref|WP_035348996.1|  hypothetical protein                             85.1    5e-17   
ref|WP_038542233.1|  hypothetical protein                             85.9    5e-17   
ref|WP_035747153.1|  hypothetical protein                             85.9    5e-17   
ref|WP_035706811.1|  hypothetical protein                             85.9    6e-17   
ref|WP_026355687.1|  hypothetical protein                             86.3    6e-17   
ref|WP_025061645.1|  hypothetical protein                             85.9    6e-17   
gb|ESW61370.1|  hypothetical protein Q27BPR15_06745                   85.9    6e-17   
gb|KGK80878.1|  hypothetical protein PM03_02840                       85.9    6e-17   
ref|WP_015494449.1|  hypothetical protein                             85.9    6e-17   
ref|WP_035261428.1|  hypothetical protein                             85.5    7e-17   
ref|WP_026595430.1|  hypothetical protein                             85.9    7e-17   
ref|WP_038005220.1|  MULTISPECIES: hypothetical protein               85.5    7e-17   
ref|WP_014283173.1|  hypothetical protein                             85.5    7e-17   
ref|WP_036386721.1|  hypothetical protein                             84.7    7e-17   
ref|WP_035099101.1|  hypothetical protein                             85.5    8e-17   
ref|WP_012178522.1|  hypothetical protein                             85.5    8e-17   
ref|WP_037269199.1|  hypothetical protein                             85.5    8e-17   
ref|WP_008227708.1|  hypothetical protein                             85.5    8e-17   
ref|WP_024351881.1|  hypothetical protein                             85.5    9e-17   
ref|WP_009808550.1|  hypothetical protein                             85.5    9e-17   
ref|WP_034837103.1|  hypothetical protein                             85.1    9e-17   
ref|WP_035238144.1|  hypothetical protein                             84.7    1e-16   
ref|WP_035084865.1|  hypothetical protein                             85.5    1e-16   
ref|WP_008550708.1|  hypothetical protein                             85.5    1e-16   
ref|WP_011907522.1|  hypothetical protein                             85.1    1e-16   
ref|WP_020602772.1|  hypothetical protein                             85.1    1e-16   
ref|WP_005626489.1|  hypothetical protein                             84.7    1e-16   
ref|WP_008597248.1|  hypothetical protein                             85.1    1e-16   
ref|WP_039372559.1|  hypothetical protein                             85.1    1e-16   
gb|EDM30647.1|  hypothetical protein RTM1035_11580                    84.3    2e-16   Roseovarius sp. TM1035
ref|WP_025052568.1|  hypothetical protein                             84.3    2e-16   
ref|WP_037298533.1|  hypothetical protein                             84.3    2e-16   
ref|WP_027381749.1|  hypothetical protein                             84.3    2e-16   
ref|WP_008560466.1|  hypothetical protein                             84.3    2e-16   
ref|WP_011582668.1|  hypothetical protein                             84.3    2e-16   
ref|WP_036355554.1|  hypothetical protein                             84.0    3e-16   
ref|WP_036744864.1|  hypothetical protein                             84.0    3e-16   
ref|WP_039536311.1|  hypothetical protein                             84.0    3e-16   
ref|WP_008329322.1|  hypothetical protein                             84.0    3e-16   
ref|WP_035666741.1|  hypothetical protein                             84.0    3e-16   
ref|WP_036700742.1|  hypothetical protein                             83.6    4e-16   
ref|WP_038012856.1|  hypothetical protein                             83.2    4e-16   
ref|WP_003580034.1|  hypothetical protein                             83.6    4e-16   
ref|WP_019938936.1|  hypothetical protein                             83.6    4e-16   
ref|WP_033418248.1|  hypothetical protein                             83.2    4e-16   
ref|WP_028098272.1|  hypothetical protein                             83.6    4e-16   
ref|WP_024510508.1|  signal peptide protein                           83.2    4e-16   
ref|WP_009451054.1|  hypothetical protein                             83.6    5e-16   
ref|WP_012110297.1|  hypothetical protein                             83.6    5e-16   
ref|WP_033402868.1|  hypothetical protein                             83.6    5e-16   
ref|WP_009179127.1|  hypothetical protein                             83.2    5e-16   
ref|WP_039683211.1|  hypothetical protein                             83.2    5e-16   
ref|WP_039018180.1|  hypothetical protein                             83.2    5e-16   
ref|WP_012927082.1|  hypothetical protein                             83.2    5e-16   
ref|WP_029923001.1|  hypothetical protein                             83.2    5e-16   
ref|WP_029041197.1|  hypothetical protein                             83.2    6e-16   
ref|WP_008678632.1|  secreted protein containing DUF1223              83.2    6e-16   
gb|EMT03029.1|  hypothetical protein F775_43252                       82.8    6e-16   
ref|WP_028348487.1|  hypothetical protein                             83.2    6e-16   
ref|WP_027278829.1|  hypothetical protein                             83.2    6e-16   
ref|WP_026985326.1|  hypothetical protein                             83.2    7e-16   
ref|WP_036559915.1|  hypothetical protein                             82.8    7e-16   
ref|WP_014880252.1|  hypothetical protein                             82.8    7e-16   
gb|ERL97251.1|  uncharacterized secreted protein                      82.8    7e-16   
ref|WP_018114535.1|  hypothetical protein                             82.8    7e-16   
ref|WP_035831018.1|  hypothetical protein                             82.4    8e-16   
ref|WP_024096958.1|  putative secreted protein                        82.8    8e-16   
ref|WP_029058100.1|  hypothetical protein                             82.8    9e-16   
ref|WP_039188188.1|  hypothetical protein                             82.8    9e-16   
ref|WP_037094969.1|  hypothetical protein                             82.4    9e-16   
ref|WP_009490848.1|  hypothetical protein                             82.4    9e-16   
ref|WP_034659688.1|  hypothetical protein                             82.0    9e-16   
ref|WP_039529822.1|  hypothetical protein                             82.4    1e-15   
ref|WP_022717364.1|  hypothetical protein                             82.4    1e-15   
ref|WP_034656924.1|  hypothetical protein                             82.0    1e-15   
ref|WP_009093858.1|  secreted protein containing DUF1223              82.8    1e-15   
ref|WP_038508472.1|  hypothetical protein                             82.0    1e-15   
ref|WP_036790977.1|  hypothetical protein                             82.4    1e-15   
gb|AJD43157.1|  hypothetical protein RGR602_CH03858                   82.0    1e-15   
ref|WP_037186351.1|  hypothetical protein                             82.0    1e-15   
ref|WP_037122782.1|  hypothetical protein                             81.6    1e-15   
ref|WP_025614761.1|  hypothetical protein                             82.0    1e-15   
ref|WP_014874905.1|  hypothetical protein                             82.0    1e-15   
ref|WP_020601724.1|  hypothetical protein                             82.0    1e-15   
ref|WP_033315546.1|  hypothetical protein                             82.0    1e-15   
ref|WP_037107734.1|  hypothetical protein                             82.0    1e-15   
ref|WP_037309996.1|  hypothetical protein                             81.6    1e-15   
ref|WP_034241957.1|  hypothetical protein                             82.0    2e-15   
ref|WP_038585907.1|  hypothetical protein                             81.6    2e-15   
ref|WP_007772937.1|  hypothetical protein                             81.6    2e-15   
ref|WP_012404240.1|  signal peptide protein                           81.6    2e-15   
gb|EZH73896.1|  hypothetical protein ATO12_13490                      81.6    2e-15   
ref|WP_034668798.1|  hypothetical protein                             81.3    2e-15   
ref|WP_018902262.1|  hypothetical protein                             81.6    2e-15   
ref|WP_018899351.1|  hypothetical protein                             81.3    2e-15   
gb|EJJ28619.1|  putative secreted protein                             81.3    2e-15   
ref|WP_037071452.1|  hypothetical protein                             81.3    2e-15   
ref|WP_011439191.1|  hypothetical protein                             81.6    2e-15   
ref|WP_009031555.1|  hypothetical protein                             81.3    2e-15   
ref|WP_014131948.1|  hypothetical protein                             81.3    2e-15   
ref|WP_027316751.1|  hypothetical protein                             81.3    3e-15   
ref|WP_028746408.1|  hypothetical protein                             81.3    3e-15   
ref|WP_037132008.1|  hypothetical protein                             81.3    3e-15   
ref|WP_028364651.1|  signal peptide protein                           80.9    3e-15   
ref|WP_018301599.1|  hypothetical protein                             80.9    3e-15   
ref|WP_010178727.1|  hypothetical protein                             80.9    3e-15   
ref|WP_030332952.1|  hypothetical protein                             80.9    3e-15   
ref|WP_028751339.1|  hypothetical protein                             80.9    3e-15   
ref|WP_008183814.1|  hypothetical protein                             80.9    3e-15   
ref|WP_020949687.1|  hypothetical protein                             82.8    3e-15   
ref|WP_017965053.1|  hypothetical protein                             80.9    4e-15   
ref|WP_035997924.1|  signal peptide protein                           80.9    4e-15   
gb|AII87359.1|  hypothetical protein RCA23_c18280                     80.5    4e-15   
emb|CDP53451.1|  hypothetical protein that often co-occurs with a...  80.9    4e-15   
ref|WP_002978016.1|  hypothetical protein                             80.9    4e-15   
ref|WP_034697285.1|  hypothetical protein                             80.9    4e-15   
gb|ETZ24121.1|  hypothetical protein N824_16410                       80.9    4e-15   
ref|WP_035037142.1|  MULTISPECIES: hypothetical protein               80.5    4e-15   
ref|WP_009340115.1|  hypothetical protein                             80.5    5e-15   
ref|WP_037238877.1|  hypothetical protein                             80.5    5e-15   
ref|WP_002650966.1|  hypothetical protein                             79.0    5e-15   
ref|WP_007528227.1|  hypothetical protein                             80.5    5e-15   
ref|WP_007253984.1|  hypothetical protein                             80.1    5e-15   
ref|WP_027666934.1|  hypothetical protein                             80.5    5e-15   
ref|WP_036157988.1|  hypothetical protein                             80.1    6e-15   
ref|WP_018855807.1|  MULTISPECIES: hypothetical protein               80.1    6e-15   
ref|WP_035092287.1|  hypothetical protein                             80.1    6e-15   
ref|WP_024315305.1|  hypothetical protein                             80.1    6e-15   
ref|WP_007794324.1|  hypothetical protein                             80.1    6e-15   
ref|WP_024517851.1|  signal peptide protein                           80.1    6e-15   
ref|WP_037196859.1|  hypothetical protein                             80.1    6e-15   
ref|WP_036485577.1|  hypothetical protein                             80.1    6e-15   
gb|EUC16986.1|  protein of unknown function DUF1223                   79.3    6e-15   
gb|KFB08610.1|  putative secreted protein precursor                   80.1    7e-15   
ref|WP_034509028.1|  hypothetical protein                             80.1    7e-15   
ref|WP_016556641.1|  hypothetical protein                             80.1    7e-15   
ref|WP_012493976.1|  hypothetical protein                             80.1    7e-15   
ref|WP_029375476.1|  hypothetical protein                             79.7    7e-15   
ref|WP_026607304.1|  hypothetical protein                             80.1    7e-15   
ref|WP_035096840.1|  hypothetical protein                             79.7    8e-15   
ref|WP_035128162.1|  hypothetical protein                             79.7    8e-15   
ref|WP_013081229.1|  hypothetical protein                             79.7    8e-15   
ref|WP_034481631.1|  hypothetical protein                             79.7    8e-15   
ref|WP_009464348.1|  hypothetical protein                             80.1    8e-15   
ref|WP_037116401.1|  hypothetical protein                             79.7    8e-15   
ref|WP_035689890.1|  hypothetical protein                             79.7    8e-15   
ref|WP_027511758.1|  hypothetical protein                             79.7    9e-15   
ref|WP_028204560.1|  signal peptide protein                           79.3    9e-15   
ref|WP_011155769.1|  hypothetical protein                             79.7    1e-14   
ref|WP_037059138.1|  hypothetical protein                             79.7    1e-14   
ref|WP_027540672.1|  hypothetical protein                             79.7    1e-14   
ref|WP_027820643.1|  signal peptide protein                           79.3    1e-14   
ref|WP_011336996.1|  hypothetical protein                             79.3    1e-14   
ref|WP_004617304.1|  putative secreted protein                        79.7    1e-14   
ref|WP_019400856.1|  hypothetical protein                             79.7    1e-14   
ref|WP_029062646.1|  hypothetical protein                             79.3    1e-14   
ref|WP_012172981.1|  hypothetical protein                             80.1    1e-14   
ref|WP_006609306.1|  hypothetical protein                             79.7    1e-14   
gb|EWY38424.1|  signal peptide protein                                79.7    1e-14   
ref|WP_012025979.1|  hypothetical protein                             79.3    1e-14   
ref|WP_037181894.1|  hypothetical protein                             79.3    1e-14   
ref|WP_026310165.1|  hypothetical protein                             79.3    1e-14   
ref|WP_031352791.1|  hypothetical protein                             79.3    1e-14   
ref|WP_037457243.1|  hypothetical protein                             79.3    1e-14   
ref|WP_025089819.1|  MULTISPECIES: hypothetical protein               79.3    1e-14   
ref|WP_011661762.1|  hypothetical protein                             79.3    1e-14   
gb|ERI15048.1|  hypothetical protein O206_04945                       79.3    1e-14   
ref|WP_028133285.1|  hypothetical protein                             79.3    1e-14   
ref|WP_017962441.1|  hypothetical protein                             79.0    1e-14   
ref|WP_003543652.1|  hypothetical protein                             79.0    1e-14   
ref|WP_007560013.1|  signal peptide protein                           79.0    1e-14   
ref|WP_016845075.1|  hypothetical protein                             79.0    1e-14   
ref|WP_010685371.1|  hypothetical protein                             79.0    1e-14   
ref|WP_008127234.1|  putative secreted protein                        79.3    1e-14   
ref|WP_021697298.1|  hypothetical protein that often co-occurs wi...  79.0    1e-14   
ref|WP_036762637.1|  hypothetical protein                             80.1    2e-14   
ref|WP_011509002.1|  hypothetical protein                             79.0    2e-14   
ref|WP_011682105.1|  hypothetical protein                             79.0    2e-14   
ref|WP_036393908.1|  hypothetical protein                             78.6    2e-14   
ref|WP_011313656.1|  hypothetical protein                             79.0    2e-14   
ref|WP_026868385.1|  hypothetical protein                             78.6    2e-14   
ref|WP_008384232.1|  hypothetical protein that often co-occurs wi...  79.7    2e-14   
ref|WP_013651010.1|  hypothetical protein                             79.0    2e-14   
ref|WP_007840212.1|  MULTISPECIES: hypothetical protein               79.0    2e-14   
ref|WP_007580134.1|  signal peptide protein                           78.6    2e-14   
ref|WP_007693744.1|  MULTISPECIES: hypothetical protein               79.0    2e-14   
emb|CDX34108.1|  conserved exported hypothetical protein              78.6    2e-14   
ref|WP_007460034.1|  hypothetical protein                             79.0    2e-14   
gb|ELT46932.1|  hypothetical protein D584_22126                       79.0    2e-14   
ref|WP_013961910.1|  hypothetical protein                             78.6    2e-14   
gb|AHF86025.1|  hypothetical protein RLEG3_31230                      78.6    2e-14   
dbj|GAK71432.1|  hypothetical protein RRU01S_17_00320                 78.6    2e-14   
ref|WP_034468193.1|  hypothetical protein                             78.6    2e-14   
gb|EJG02519.1|  hypothetical protein FF52_04830                       78.6    2e-14   
ref|WP_012386388.1|  hypothetical protein                             78.6    2e-14   
gb|AHM05533.1|  hypothetical protein that often co-occurs with ac...  78.6    2e-14   
ref|WP_009798322.1|  hypothetical protein                             78.2    2e-14   
ref|WP_014267243.1|  hypothetical protein                             78.6    2e-14   
ref|WP_035533137.1|  hypothetical protein                             78.6    2e-14   
ref|WP_012643485.1|  hypothetical protein                             78.2    2e-14   
gb|EGJ23261.1|  hypothetical protein RSWS8N_14275                     78.2    2e-14   
ref|WP_035365087.1|  hypothetical protein                             78.6    2e-14   
emb|CEJ68872.1|  hypothetical protein BN1195_01163                    78.6    3e-14   
ref|WP_028216473.1|  signal peptide protein                           78.2    3e-14   
gb|ETR77634.1|  hypothetical protein X566_08270                       78.2    3e-14   
ref|WP_035690832.1|  hypothetical protein                             78.2    3e-14   
ref|WP_029003639.1|  hypothetical protein                             78.6    3e-14   
ref|WP_039476549.1|  hypothetical protein                             78.6    3e-14   
gb|ERF82062.1|  branched-chain amino acid transport system substr...  78.2    3e-14   
ref|WP_035651270.1|  hypothetical protein                             78.2    3e-14   
ref|WP_011470686.1|  hypothetical protein                             78.2    3e-14   
ref|WP_027580850.1|  hypothetical protein                             78.2    3e-14   
ref|WP_025743156.1|  hypothetical protein                             78.2    3e-14   
emb|CDX25118.1|  conserved hypothetical protein                       78.2    3e-14   
ref|WP_025897656.1|  hypothetical protein                             78.2    3e-14   
ref|WP_028194775.1|  signal peptide protein                           78.2    3e-14   
gb|AII53144.1|  hypothetical protein N008_14320                       78.2    3e-14   
ref|WP_009759245.1|  hypothetical protein                             78.2    3e-14   
ref|WP_026790573.1|  hypothetical protein                             78.2    3e-14   
ref|WP_026304302.1|  hypothetical protein                             78.2    3e-14   
ref|WP_036346769.1|  hypothetical protein                             78.2    3e-14   
ref|WP_030100357.1|  signal peptide protein                           77.8    3e-14   
ref|WP_036034321.1|  signal peptide protein                           77.8    3e-14   
ref|WP_013568777.1|  hypothetical protein                             78.2    3e-14   
ref|WP_036207546.1|  hypothetical protein                             77.8    3e-14   
ref|WP_023431439.1|  hypothetical protein                             77.8    3e-14   
gb|AHI31327.1|  hypothetical protein AU15_08265                       77.8    3e-14   
ref|WP_015663556.1|  hypothetical protein                             78.2    4e-14   
ref|WP_035128461.1|  hypothetical protein                             77.8    4e-14   
ref|WP_034735240.1|  hypothetical protein                             77.8    4e-14   
ref|WP_036254948.1|  MULTISPECIES: hypothetical protein               77.8    4e-14   
ref|WP_011923623.1|  hypothetical protein                             77.8    4e-14   
ref|WP_027373415.1|  hypothetical protein                             77.8    4e-14   
ref|WP_006465821.1|  hypothetical protein                             77.8    4e-14   
gb|ERM01087.1|  hypothetical protein Q644_23600                       77.8    4e-14   
ref|WP_008968105.1|  signal peptide protein                           77.4    4e-14   
ref|WP_034817452.1|  hypothetical protein                             76.6    4e-14   
ref|WP_007152177.1|  uncharacterized secreted protein                 77.8    4e-14   
ref|WP_009563728.1|  hypothetical protein that often co-occurs wi...  77.4    4e-14   
gb|KFC62919.1|  hypothetical protein FG93_06021                       77.8    5e-14   
ref|WP_012288980.1|  hypothetical protein                             77.4    5e-14   
ref|WP_037149088.1|  hypothetical protein                             77.8    5e-14   
ref|WP_012427012.1|  signal peptide protein                           77.4    5e-14   
ref|WP_035988665.1|  signal peptide protein                           77.4    5e-14   
gb|ENN89641.1|  hypothetical protein RHSP_37137                       77.4    5e-14   
ref|WP_013528826.1|  MULTISPECIES: hypothetical protein               77.8    5e-14   
ref|WP_029081316.1|  hypothetical protein                             77.4    5e-14   
ref|WP_010970510.1|  hypothetical protein                             77.8    5e-14   
ref|WP_038384699.1|  hypothetical protein                             77.4    5e-14   
ref|WP_028336299.1|  hypothetical protein                             77.4    5e-14   
ref|WP_010392475.1|  hypothetical protein                             79.0    5e-14   
ref|WP_028340823.1|  hypothetical protein                             77.4    5e-14   
ref|WP_029375846.1|  MULTISPECIES: hypothetical protein               77.4    5e-14   
ref|WP_013188369.1|  hypothetical protein                             77.4    5e-14   
ref|WP_008963821.1|  hypothetical protein                             77.4    6e-14   
ref|WP_031250434.1|  hypothetical protein                             77.0    6e-14   
ref|WP_038036336.1|  hypothetical protein                             77.4    6e-14   
ref|WP_013696905.1|  signal peptide protein                           77.0    6e-14   
ref|WP_014784321.1|  hypothetical protein                             77.4    6e-14   
gb|ESY76721.1|  hypothetical protein X740_27410                       77.0    6e-14   
gb|ETY81456.1|  putative protein that often co-occurs with aconitase  77.0    6e-14   
ref|WP_019953879.1|  hypothetical protein                             77.0    6e-14   
ref|WP_011538350.1|  hypothetical protein                             77.0    6e-14   
ref|WP_011750526.1|  hypothetical protein                             78.6    7e-14   
ref|WP_035524838.1|  signal peptide protein                           77.0    7e-14   
ref|WP_028166228.1|  hypothetical protein                             77.0    7e-14   
ref|WP_015341459.1|  hypothetical protein                             77.0    7e-14   
ref|WP_036052482.1|  signal peptide protein                           77.0    7e-14   
ref|WP_025098127.1|  signal peptide protein                           77.0    7e-14   
ref|WP_027487020.1|  hypothetical protein                             77.0    7e-14   
ref|WP_039711287.1|  hypothetical protein                             76.6    7e-14   
ref|WP_025976491.1|  hypothetical protein                             77.0    8e-14   
ref|WP_012115823.1|  hypothetical protein                             77.0    8e-14   
ref|WP_022698621.1|  hypothetical protein                             76.6    8e-14   
ref|WP_024583247.1|  hypothetical protein                             77.0    8e-14   
ref|WP_035081036.1|  hypothetical protein                             77.0    8e-14   
ref|WP_024265989.1|  conserved hypothetical secreted protein          77.0    8e-14   
ref|WP_012561747.1|  hypothetical protein                             77.0    8e-14   
ref|WP_010921493.1|  hypothetical protein                             77.0    8e-14   
ref|WP_026729636.1|  hypothetical protein                             77.0    8e-14   
ref|WP_036720511.1|  hypothetical protein                             76.6    8e-14   
ref|WP_027392723.1|  hypothetical protein                             76.6    8e-14   
ref|WP_011568730.1|  hypothetical protein                             76.6    8e-14   
ref|WP_029417452.1|  hypothetical protein                             76.6    9e-14   
ref|WP_011500951.1|  hypothetical protein                             77.0    9e-14   
ref|WP_023811305.1|  hypothetical protein                             77.0    9e-14   
ref|WP_007632453.1|  hypothetical protein                             76.6    9e-14   
ref|WP_029583119.1|  hypothetical protein                             76.6    9e-14   
ref|WP_038949863.1|  hypothetical protein                             76.6    1e-13   



>gb|EYU33560.1| hypothetical protein MIMGU_mgv1a011671mg [Erythranthe guttata]
Length=274

 Score =   259 bits (662),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 149/196 (76%), Gaps = 4/196 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaae--eegeaaRDGPVVVELFSSQGCATSPEA  187
            MAP LF C G+   S  +      DD AA       E  R GPVVVELFSSQGC TSPEA
Sbjct  1    MAPRLFSCFGRGGGSTTSSSDPKHDDKAATADLSAEEQRRGGPVVVELFSSQGCGTSPEA  60

Query  188  ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTM  367
            ELLFSRLGRGDF+L+   P+VLLAFHVDYWDYTGWKDPFG SQWTVRQK YVE+L LDTM
Sbjct  61   ELLFSRLGRGDFNLD--APVVLLAFHVDYWDYTGWKDPFGSSQWTVRQKAYVEALNLDTM  118

Query  368  FTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKV  547
            FTP +VVQ +  CVGND +A+++ I SAPRFP  SFQATFEKP+PD+L+V+LTG LR KV
Sbjct  119  FTPQIVVQGRAHCVGNDDEALISCIASAPRFPAPSFQATFEKPSPDSLQVTLTGALRTKV  178

Query  548  DSNGVDIKVVLFESGL  595
            D  G++I V L+ESGL
Sbjct  179  DHEGLNIMVALYESGL  194



>ref|XP_010060500.1| PREDICTED: uncharacterized protein LOC104448399 [Eucalyptus grandis]
 gb|KCW67283.1| hypothetical protein EUGRSUZ_F01074 [Eucalyptus grandis]
Length=268

 Score =   250 bits (639),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 148/194 (76%), Gaps = 6/194 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G  S  AV++ +    D        E  R G V+VELFSSQGCATSPEAE+
Sbjct  1    MAPHLFACFGTSSRRAVHEKQAATAD----MSAEEQRRGGAVLVELFSSQGCATSPEAEV  56

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDF+LE   P+++LA HVDYWDY GWKDPFG S+ TVRQK YVE+L+LDTMFT
Sbjct  57   LISRLGRGDFELE--APVIVLAHHVDYWDYVGWKDPFGSSRSTVRQKAYVEALRLDTMFT  114

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P  VVQ + QCVG DQ+ +L++I SAPRFP L+F+ATF++P+PDTL+V+L G LR+KVDS
Sbjct  115  PQAVVQGRAQCVGTDQEGLLSAIASAPRFPALTFKATFQRPSPDTLQVTLAGALRSKVDS  174

Query  554  NGVDIKVVLFESGL  595
             GV+I V L+ESGL
Sbjct  175  QGVNIMVALYESGL  188



>ref|XP_009590154.1| PREDICTED: uncharacterized protein LOC104087410 [Nicotiana tomentosiformis]
Length=273

 Score =   248 bits (634),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 153/195 (78%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaa-eeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MA  LF C GK SS + +      +DNA A     E  R GPVVVELFSSQGCATSPEAE
Sbjct  1    MARRLFTCFGKGSSHSSSKQHQTSNDNATADLTAEEQKRCGPVVVELFSSQGCATSPEAE  60

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LLFSR+GRGDF+LE   P++LLA+HVDYWDY GWKDPFG S WTV+QK YVE+L LDTMF
Sbjct  61   LLFSRIGRGDFNLEM--PVILLAYHVDYWDYMGWKDPFGSSLWTVKQKAYVEALNLDTMF  118

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +VVQ + QCV N+QDA+ + IKSAPRFP  SFQATFE+PTP++L+VSL G+LRNKVD
Sbjct  119  TPQIVVQGRAQCVANEQDALFSCIKSAPRFPAPSFQATFERPTPESLQVSLLGSLRNKVD  178

Query  551  SNGVDIKVVLFESGL  595
            +NGV+I + L+E GL
Sbjct  179  NNGVNIMIALYECGL  193



>ref|XP_008386092.1| PREDICTED: uncharacterized protein LOC103448604 [Malus domestica]
 ref|XP_008386093.1| PREDICTED: uncharacterized protein LOC103448604 [Malus domestica]
Length=272

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  L  C G +  S  + +K      A    E +  R GPV+VELFSSQGC+TSP AEL
Sbjct  1    MARGLLACFGSKGGSRTSHEKPAAGATAHVSAEEQQ-RSGPVLVELFSSQGCSTSPVAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDFD  ++PP+V+LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDTMFT
Sbjct  60   LVSRLGRGDFDGTDLPPVVVLAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTMFT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A+LTSIK APR+P  +FQATF++P+PD+ +VSLTG+LR+KVD+
Sbjct  120  PQIVLQGRAQCVGNDEAALLTSIKDAPRYPAPAFQATFQRPSPDSXQVSLTGSLRSKVDN  179

Query  554  NGVDIKVVLFESGL  595
             GV++ V L+E+GL
Sbjct  180  YGVNVMVALYENGL  193



>ref|XP_002316935.2| hypothetical protein POPTR_0011s12710g [Populus trichocarpa]
 gb|EEE97547.2| hypothetical protein POPTR_0011s12710g [Populus trichocarpa]
Length=271

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 3/194 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C GKR+S + + ++   +       E +  R G V+VELFSSQGCATSP AEL
Sbjct  1    MAPRLLSCFGKRNSDSSSKNQNHANVTVDVSAEEQR-RGGAVLVELFSSQGCATSPAAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDF LE   P+++LAFHVDYWDY GWKDP+G SQWTVRQK YVESL+LDTMFT
Sbjct  60   LVSRLGRGDFQLEM--PVIILAFHVDYWDYMGWKDPYGGSQWTVRQKAYVESLKLDTMFT  117

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VVQ + QCVGND++A+L+SI +APRFP  +FQATF +PT D+L+VS++G LR KVD 
Sbjct  118  PQIVVQGRTQCVGNDEEALLSSIVNAPRFPSPTFQATFLRPTTDSLQVSMSGALRAKVDH  177

Query  554  NGVDIKVVLFESGL  595
            NGV++ V L+ESGL
Sbjct  178  NGVNVMVALYESGL  191



>ref|XP_009350026.1| PREDICTED: uncharacterized protein LOC103941543 [Pyrus x bretschneideri]
 ref|XP_009350027.1| PREDICTED: uncharacterized protein LOC103941543 [Pyrus x bretschneideri]
Length=272

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 149/194 (77%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  L  C G +  S  + +K      A    E +  R GPV+VELFSSQGC+ SP AEL
Sbjct  1    MARGLLACFGSKGGSRTSHEKHAAGATAHVSAEEQQ-RSGPVLVELFSSQGCSPSPVAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDFD  ++PP+V+LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDTMFT
Sbjct  60   LVSRLGRGDFDGTDLPPVVVLAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTMFT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A+LTSIK APR+P  + QATF++P+PD+L+VSLTG+LR+KVD+
Sbjct  120  PQIVLQGRAQCVGNDESALLTSIKDAPRYPAPALQATFQRPSPDSLQVSLTGSLRSKVDN  179

Query  554  NGVDIKVVLFESGL  595
             GV++ V L+E+GL
Sbjct  180  YGVNVMVALYENGL  193



>gb|KDP38951.1| hypothetical protein JCGZ_00708 [Jatropha curcas]
Length=273

 Score =   245 bits (626),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 150/195 (77%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   MAPSLFCCCGK-RSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP LF C GK   +S  N +     +  A     E  R G ++VELFSSQGCATSPEAE
Sbjct  1    MAPRLFACFGKCNLASPDNGNVSKTSNGTADATVEEQRRAGAILVELFSSQGCATSPEAE  60

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LL SRLGRGDF LE   P+++LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L+LDTMF
Sbjct  61   LLVSRLGRGDFALE--TPVIVLAFHVDYWDYMGWKDPYGASQWTVRQKAYVEALKLDTMF  118

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +V+Q ++QCV N+++A+L++I SA +FP  SFQAT+E+PTP++L VSL+G LR+KVD
Sbjct  119  TPQVVIQGREQCVANEEEALLSAIMSASKFPSPSFQATYERPTPESLRVSLSGALRSKVD  178

Query  551  SNGVDIKVVLFESGL  595
            SNG +I V L+E+GL
Sbjct  179  SNGANIMVALYENGL  193



>ref|XP_008226719.1| PREDICTED: uncharacterized protein LOC103326285 [Prunus mume]
Length=271

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G +       +K  G    A     E  R GPV+VELFSSQGC TSP AEL
Sbjct  1    MARGLFACFGSKGVEGTPREKHAG--ATADISAEEQRRSGPVLVELFSSQGCTTSPVAEL  58

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDF+  ++PP+V+LA+HVDYWDY GWKDPFG SQWTVRQK YVE+L LDTMFT
Sbjct  59   LVSRLGRGDFNEMDLPPVVVLAYHVDYWDYMGWKDPFGSSQWTVRQKAYVEALGLDTMFT  118

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A+L+SI+ APR+   +FQATFE+P+PD+L+VSLTG+LR+KVDS
Sbjct  119  PQIVLQGRAQCVGNDESALLSSIRDAPRYTAPTFQATFERPSPDSLQVSLTGSLRSKVDS  178

Query  554  NGVDIKVVLFESGL  595
             G ++ V L+E+GL
Sbjct  179  YGANVMVALYENGL  192



>ref|XP_008366305.1| PREDICTED: uncharacterized protein LOC103429950 [Malus domestica]
Length=272

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  L  C G +  S  + +K      A    E +  R GPV+VELFSSQGC TSP AEL
Sbjct  1    MARGLLSCFGSKGGSGTSHEKHAAGATAHVSAEEQQ-RSGPVLVELFSSQGCTTSPVAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDFD  ++PP+V+LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDTMFT
Sbjct  60   LVSRLGRGDFDGTDLPPVVVLAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTMFT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A+LTSIK APR+P  +FQATF++P+  +L+VSLTG+LR+KVDS
Sbjct  120  PQIVLQGRAQCVGNDESALLTSIKDAPRYPAPAFQATFQRPSLASLQVSLTGSLRSKVDS  179

Query  554  NGVDIKVVLFESGL  595
             G ++ V L+E+GL
Sbjct  180  YGANVMVALYENGL  193



>ref|XP_009765063.1| PREDICTED: uncharacterized protein LOC104216650 [Nicotiana sylvestris]
Length=273

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 152/195 (78%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaa-eeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MA  LF C GK SS + +      +DNA A     E  R GPVVVELFSSQGCATSPEAE
Sbjct  1    MARRLFTCFGKGSSHSSSKHHQTSNDNATADLTAEEQKRCGPVVVELFSSQGCATSPEAE  60

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LLFSR+GRGDF+LE   P++LLA+HVDYWDY GWKDPFG S WTV+QK YVE+L LDTMF
Sbjct  61   LLFSRIGRGDFNLEM--PVILLAYHVDYWDYMGWKDPFGSSLWTVKQKAYVEALNLDTMF  118

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +VVQ + QCV N+Q+A+ + IKSAPRFP  SFQATFE+PT ++L+VSL G+LR+KVD
Sbjct  119  TPQIVVQGRAQCVANEQEALFSCIKSAPRFPAPSFQATFERPTAESLQVSLLGSLRSKVD  178

Query  551  SNGVDIKVVLFESGL  595
            +NGV+I + L+E GL
Sbjct  179  NNGVNIMIALYECGL  193



>ref|XP_009377337.1| PREDICTED: uncharacterized protein LOC103965958 [Pyrus x bretschneideri]
 ref|XP_009377338.1| PREDICTED: uncharacterized protein LOC103965959 [Pyrus x bretschneideri]
Length=272

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  L  C G +  S  + +K      A    E +  R GPV+VELFSSQGC TSP AEL
Sbjct  1    MARGLLSCFGSKGGSGTSHEKHAAGATAHVSAEEQQ-RSGPVLVELFSSQGCTTSPVAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDFD  ++P +V LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDTMFT
Sbjct  60   LVSRLGRGDFDGTDLPLVVALAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTMFT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A++TSIK APR+P  +FQATF+KP+P +L+VSLTG+LR+KVD+
Sbjct  120  PQIVLQGRAQCVGNDESALITSIKDAPRYPAPTFQATFQKPSPASLQVSLTGSLRSKVDN  179

Query  554  NGVDIKVVLFESGL  595
             G ++ V L+E+GL
Sbjct  180  YGANVMVALYENGL  193



>ref|XP_007211808.1| hypothetical protein PRUPE_ppa009905mg [Prunus persica]
 gb|EMJ13007.1| hypothetical protein PRUPE_ppa009905mg [Prunus persica]
Length=272

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 149/195 (76%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSS-SAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MA  LF C G +        +K  G    A     E  R GPV+VELFSSQGC TSP A+
Sbjct  1    MARGLFACFGSKGVVEGTPREKHAG--ATADISAEEQRRSGPVLVELFSSQGCTTSPVAD  58

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LL SRLGRGDF+  ++PP+V+LA+HVDYWDY GWKDPFG SQWTVRQK YVE+L LDTMF
Sbjct  59   LLVSRLGRGDFNEMDLPPVVVLAYHVDYWDYMGWKDPFGSSQWTVRQKAYVEALGLDTMF  118

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +V+Q +DQCVGND+ A+L+SI++APR+   +FQATFE+P+PD+L+VSLTG+LR+KVD
Sbjct  119  TPQIVLQGRDQCVGNDESALLSSIRAAPRYTAPTFQATFERPSPDSLQVSLTGSLRSKVD  178

Query  551  SNGVDIKVVLFESGL  595
            S G ++ V L+E+GL
Sbjct  179  SYGANVMVALYENGL  193



>ref|XP_004244184.1| PREDICTED: uncharacterized protein LOC101267253 [Solanum lycopersicum]
Length=275

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R GPVVVELFSSQGCATSPEAELLFSR+GRGDF+LE   P++LLA+HVDYWDY GWKDPF
Sbjct  41   RCGPVVVELFSSQGCATSPEAELLFSRIGRGDFNLEM--PVILLAYHVDYWDYMGWKDPF  98

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G S WTV+QK YVE+L LDTMFTP +VVQ + QCVGN+QDAV + IKSAPRF   SFQAT
Sbjct  99   GSSLWTVKQKAYVETLNLDTMFTPQIVVQGRAQCVGNEQDAVFSCIKSAPRFAAPSFQAT  158

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            FE+PTP++L+VSL G+LR+KVD++G ++ + L+E GL
Sbjct  159  FERPTPESLQVSLLGSLRSKVDNDGANVMIALYEGGL  195



>ref|XP_009334578.1| PREDICTED: uncharacterized protein LOC103927387 [Pyrus x bretschneideri]
Length=272

 Score =   241 bits (615),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  L  C G +  S  + +K      A    E +  R GPV+VELFSSQGC TSP AEL
Sbjct  1    MARGLLSCFGSKGGSGTSHEKHTAWATAHVSAEEQQ-RSGPVLVELFSSQGCTTSPVAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDFD  ++P +V LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDTMFT
Sbjct  60   LVSRLGRGDFDGTDLPTVVALAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTMFT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCVGND+ A++TSIK APR+P  +FQATF+KP+P +L+VSLTG+LR+KVD+
Sbjct  120  PQIVLQGRAQCVGNDESALITSIKDAPRYPAPAFQATFQKPSPASLQVSLTGSLRSKVDN  179

Query  554  NGVDIKVVLFESGL  595
             G ++ V L+E+GL
Sbjct  180  YGANVMVALYENGL  193



>ref|XP_010520891.1| PREDICTED: uncharacterized protein LOC104799905 [Tarenaya hassleriana]
Length=280

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 147/200 (74%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G R S+        G+++AA       + DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MARRLFACFGGRGSATSTGKSSAGNNSAAVVSADVPSGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            + SRLGRGDFD +         P+V+L FHVDYWDY GWKDP+G SQWTVRQK YVE+L+
Sbjct  61   MVSRLGRGDFDGQIGGGSGSPSPVVMLVFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALR  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
            LDTMFTP +VVQ +  CVGN+++ +L +I  APRFP  +F+ATF++PT +TL+VSLTG+L
Sbjct  121  LDTMFTPQVVVQGRSHCVGNEEETILKAIVDAPRFPSPAFRATFQRPTSETLQVSLTGSL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDSNGVD+ V L+E+ L
Sbjct  181  RTKVDSNGVDVMVALYENSL  200



>ref|XP_006360124.1| PREDICTED: uncharacterized protein LOC102584127 [Solanum tuberosum]
Length=275

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R GPVVVELFSSQGCATSPEAELLFSR+GRGDF+LE   P++LLA+HVDYWDY GWKDPF
Sbjct  41   RCGPVVVELFSSQGCATSPEAELLFSRIGRGDFNLEM--PVILLAYHVDYWDYMGWKDPF  98

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G S WTV+QK YVE+L LDTMFTP +VVQ + QCVGN+QDAV + I SAPRF   SFQAT
Sbjct  99   GSSLWTVKQKAYVEALNLDTMFTPQIVVQGRAQCVGNEQDAVFSCINSAPRFAAPSFQAT  158

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            FE+PTP++L+VSL G+LR+KVD++G ++ + L+E GL
Sbjct  159  FERPTPESLQVSLLGSLRSKVDNDGANVMIALYEGGL  195



>ref|XP_002525765.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36601.1| conserved hypothetical protein [Ricinus communis]
Length=276

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 6/198 (3%)
 Frame = +2

Query  14   MAPSLFCCCGK---RSSSAVNDDKGCGDDNaaa-eeegeaaRDGPVVVELFSSQGCATSP  181
            MAP LF C GK    SSS+     G G  N        E  R G V+VELFSSQGC TSP
Sbjct  1    MAPRLFSCFGKCNSSSSSSSTSMHGKGKSNVTVDASAEEQRRGGAVLVELFSSQGCVTSP  60

Query  182  EAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            EAELL SRLGRGDF LE   P+++L FHVDYWDY GWKDPFG SQWTVRQK YVE+L+LD
Sbjct  61   EAELLVSRLGRGDFALE--TPVIVLGFHVDYWDYMGWKDPFGSSQWTVRQKAYVEALKLD  118

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            TMFTP +VVQ + QCVGN+++++L+SI +AP+FP  +FQATF++PT ++L+VSL+G LR 
Sbjct  119  TMFTPQVVVQGRAQCVGNEEESLLSSIMNAPKFPSPTFQATFQRPTSESLQVSLSGALRT  178

Query  542  KVDSNGVDIKVVLFESGL  595
            KVDSNG ++   L+ESGL
Sbjct  179  KVDSNGANVMAALYESGL  196



>ref|XP_003540028.1| PREDICTED: uncharacterized protein LOC100779569 [Glycine max]
Length=278

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R GPVVVE+FSSQGCATSP AEL+ SRLGRGDF+LE   P+V+LAFHVDYWDY GWKDPF
Sbjct  44   RGGPVVVEMFSSQGCATSPAAELVLSRLGRGDFELEA--PVVVLAFHVDYWDYMGWKDPF  101

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G SQWTVRQK YVE+L LDT+FTP +VVQ + QCVGND++A++++I SAPRFP  +FQAT
Sbjct  102  GASQWTVRQKAYVEALGLDTIFTPQVVVQGKAQCVGNDENALVSAITSAPRFPAPTFQAT  161

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            F +P PD+L+VSLTG LR KVDS+G ++ V L+E+GL
Sbjct  162  FTRPAPDSLQVSLTGALRTKVDSDGANVMVALYENGL  198



>emb|CDP05849.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   238 bits (608),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 146/194 (75%), Gaps = 3/194 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G R +S+ +      +   A     E  R GPVVVELF+SQGCATS +AEL
Sbjct  1    MAPRLFSCFG-RGASSSSHQGTSSEIATADISAEEQRRAGPVVVELFTSQGCATSAQAEL  59

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            LFSR+GRGDF+LE   PLVLLA+HVDYWDY GWKDPFG S WT RQK YVE+L LDTMFT
Sbjct  60   LFSRVGRGDFELEM--PLVLLAYHVDYWDYLGWKDPFGSSLWTARQKAYVEALNLDTMFT  117

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VVQ + QCV N++D +L+ IKSAPR P  SFQA F+ PTP++L+VSLTG LR+KVD 
Sbjct  118  PQVVVQGRAQCVVNEEDPLLSCIKSAPRVPAPSFQAAFQMPTPESLQVSLTGALRSKVDQ  177

Query  554  NGVDIKVVLFESGL  595
            +GV+I V L+ESGL
Sbjct  178  HGVNIMVALYESGL  191



>ref|XP_004510014.1| PREDICTED: uncharacterized protein LOC101489475 [Cicer arietinum]
Length=267

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 144/194 (74%), Gaps = 7/194 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L+ C G + S      +G   +  +     E  RDGPVVVE+FSSQGCATSP AEL
Sbjct  1    MAPRLWTCFGNKGSR-----EGAEGNITSDITTEEQRRDGPVVVEMFSSQGCATSPAAEL  55

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            + SRLGRGDF LE   P+V+L FHVDYWDY GWKDPFG SQWTVRQK YVE+L LDT+ T
Sbjct  56   VLSRLGRGDFQLE--IPVVVLVFHVDYWDYMGWKDPFGSSQWTVRQKGYVEALGLDTLLT  113

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P ++VQ    CVGND++A++ +I  APR+P  SFQATF +PT D+L+VSLTGTLRN+V+S
Sbjct  114  PQVIVQGVAHCVGNDENALIDAITRAPRYPAPSFQATFTRPTQDSLQVSLTGTLRNEVES  173

Query  554  NGVDIKVVLFESGL  595
            NGV+I V L+E+ L
Sbjct  174  NGVNIMVALYENSL  187



>ref|XP_011095267.1| PREDICTED: uncharacterized protein LOC105174777 [Sesamum indicum]
Length=264

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 144/194 (74%), Gaps = 10/194 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C  +RSSS  N ++             E    GPVVVELFSSQGCATS EAE+
Sbjct  1    MAPRLLSCF-RRSSSQSNHEE-------KETATEEEQGPGPVVVELFSSQGCATSTEAEM  52

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            +FSRLGRGDF+L+   PLVLLA+HVDYWDY GWKDPFG SQWTVRQK YVE+L LDTMFT
Sbjct  53   VFSRLGRGDFNLDV--PLVLLAYHVDYWDYNGWKDPFGSSQWTVRQKAYVEALNLDTMFT  110

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q + QCV N+ + +L+ I SAPRFP  SFQATF+KPTPD+L+VSLTGTLR KVD 
Sbjct  111  PQIVIQGRAQCVANEPEEILSCIASAPRFPAPSFQATFQKPTPDSLQVSLTGTLRTKVDD  170

Query  554  NGVDIKVVLFESGL  595
             G ++ V L+E GL
Sbjct  171  QGANLMVALYECGL  184



>ref|XP_011044527.1| PREDICTED: uncharacterized protein LOC105139684 [Populus euphratica]
Length=270

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 145/195 (74%), Gaps = 6/195 (3%)
 Frame = +2

Query  14   MAPSLFCCCGK-RSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP L  C  K   SSA N +     +        E  R G V+VELFSSQGC TSPEAE
Sbjct  1    MAPRLLSCFAKGNDSSARNQNHA---NVTVDVSAEEQHRCGAVLVELFSSQGCKTSPEAE  57

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LL SRLGRGDF +E   P+++LAFHVDYWDY GWKDP+G SQWTVRQK YVESL+LDTMF
Sbjct  58   LLVSRLGRGDFQVEM--PVIVLAFHVDYWDYMGWKDPYGGSQWTVRQKAYVESLKLDTMF  115

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +VVQ + QCVGN+++ +L+SI +APRFP  +FQATF++PTPD L+VSL+G LR K D
Sbjct  116  TPQIVVQGRTQCVGNEEETLLSSIVNAPRFPAPTFQATFQRPTPDCLQVSLSGALRTKAD  175

Query  551  SNGVDIKVVLFESGL  595
            ++GV++ V L+ SGL
Sbjct  176  NDGVNVMVALYNSGL  190



>emb|CDY18312.1| BnaC09g30620D [Brassica napus]
Length=280

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G R SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MAPRLLSCFGVRGSSTSTTGKGISGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRREGGSGSPAMILVFHVDYWDYMGWKDPYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +FQATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFQATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS G+DI V L+E+GL
Sbjct  181  RMKVDSTGIDIMVALYENGL  200



>ref|XP_004294477.1| PREDICTED: uncharacterized protein LOC101312706 [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   235 bits (600),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSS---AVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            M   LF C GK  SS   A  + +     + A     E  + GPV+VELFSSQGCATSP 
Sbjct  1    MGRGLFACFGKGHSSSSPASREKRTSAVASTADVSAEEQRKSGPVLVELFSSQGCATSPV  60

Query  185  AELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDT  364
            AELL SRLGRGDF+  +VPP+V+LA+HVDYWDY GWKDP+G SQWTVRQK Y+E+L+LDT
Sbjct  61   AELLCSRLGRGDFNGSDVPPVVVLAYHVDYWDYMGWKDPYGSSQWTVRQKNYIEALRLDT  120

Query  365  MFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK-PTPDTLEVSLTGTLRN  541
            MFTP +VVQ    CVGND++ +LT IK APR+   +FQATFE+  + D+L+VSLTG LR 
Sbjct  121  MFTPQVVVQGSVHCVGNDENDLLTCIKQAPRYAGPTFQATFERSASSDSLQVSLTGALRT  180

Query  542  KVDSNGVDIKVVLFESGL  595
            KVD NGV++ V L+ESGL
Sbjct  181  KVDGNGVNVMVALYESGL  198



>ref|XP_007021251.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007021252.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY12776.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY12777.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=277

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 148/199 (74%), Gaps = 7/199 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSS-----SAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATS  178
            MA  LF C G+ +S     + V+   G  +          ++ +GP++VELFSSQGCATS
Sbjct  1    MARRLFACFGRGASSSSSRNEVHAAHGKTNGAVVEATTPPSSAEGPILVELFSSQGCATS  60

Query  179  PEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQL  358
            P AELL SRLGRGDF L    P+++LA+HVDYWDY GWKDP+G SQWTVRQK YVESL+L
Sbjct  61   PAAELLLSRLGRGDFQL--AAPVIVLAYHVDYWDYMGWKDPYGSSQWTVRQKAYVESLRL  118

Query  359  DTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLR  538
            DTMFTP +VVQ + QCV ND+DA+L++I  APRF   +FQA F++PT ++L+V+LTG LR
Sbjct  119  DTMFTPQVVVQGRAQCVANDEDALLSTIAGAPRFLAPTFQANFQRPTSESLQVTLTGALR  178

Query  539  NKVDSNGVDIKVVLFESGL  595
            +KVD+NGV+I V L+E+GL
Sbjct  179  SKVDNNGVNIMVALYENGL  197



>ref|XP_006401599.1| hypothetical protein EUTSA_v10014333mg [Eutrema salsugineum]
 gb|ESQ43052.1| hypothetical protein EUTSA_v10014333mg [Eutrema salsugineum]
Length=280

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G + SS     KG    NAA       A DGPV+++LFSSQGC TSPEAE+
Sbjct  1    MAPRLFACFGVKGSSTSTTGKGISGHNAAVVAADVPAGDGPVLLQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK YVE+L 
Sbjct  61   LVSRLGRGDFDGQIRRDGGSGSPAMVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYVEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP +VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQLVVQGRVQLLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS+G+DI V L+E+GL
Sbjct  181  RMKVDSSGIDIMVALYETGL  200



>ref|XP_011098364.1| PREDICTED: uncharacterized protein LOC105177039 [Sesamum indicum]
Length=266

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 139/194 (72%), Gaps = 8/194 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C    S S   DDK   D         E  R GPVVVELFSSQGCA SPEAEL
Sbjct  1    MAPRLLSCFRSPSGSKY-DDKVTAD-----FTAEEQQRGGPVVVELFSSQGCAISPEAEL  54

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            LFSRLGRGDF+LE   PLVLLA+HVDYWDY GWKDPFG SQWTVRQK YVE+L+LDTMFT
Sbjct  55   LFSRLGRGDFNLEV--PLVLLAYHVDYWDYMGWKDPFGSSQWTVRQKAYVEALRLDTMFT  112

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VVQ +  CV N+ +A+L+ I +APR P   FQATF++PTP++L+VSL G LR KVD 
Sbjct  113  PQIVVQGRAHCVANEDEALLSCITTAPRVPAPMFQATFQRPTPESLQVSLAGALRTKVDH  172

Query  554  NGVDIKVVLFESGL  595
             G ++ V L E GL
Sbjct  173  EGANVMVALCECGL  186



>ref|XP_010101767.1| hypothetical protein L484_018723 [Morus notabilis]
 gb|EXB89622.1| hypothetical protein L484_018723 [Morus notabilis]
Length=270

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 143/195 (73%), Gaps = 6/195 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDK-GCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MA  LF C GK +S+A   D+ G  D         E  R G V+VELFSSQGCATS EAE
Sbjct  1    MARRLFACFGKSASAATTSDRIGTAD-----VAAEEQRRGGAVLVELFSSQGCATSLEAE  55

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LL SRLGRGDFD   +PP+++LA HVDYWDY GWKDPFG S  TVRQK YVE+L+LDT+F
Sbjct  56   LLLSRLGRGDFDEMGLPPVIILAHHVDYWDYMGWKDPFGSSLATVRQKAYVEALKLDTIF  115

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +VVQ +  CVGND++A+L  I+ APR P  +FQATF +P+PD+L+VSLTG LR KVD
Sbjct  116  TPQVVVQGKAHCVGNDENALLGLIRDAPRCPAPTFQATFRRPSPDSLQVSLTGALRTKVD  175

Query  551  SNGVDIKVVLFESGL  595
            + G ++ V L+E+GL
Sbjct  176  NYGANVMVALYENGL  190



>emb|CDY14323.1| BnaA10g07320D [Brassica napus]
Length=280

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G + SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MAPRLLSCFGVKGSSTSTTGKGISGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRREGGSGSPAMILVFHVDYWDYMGWKDPYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +FQATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFQATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS G+DI V L+E+GL
Sbjct  181  RMKVDSTGIDIMVALYENGL  200



>ref|NP_200235.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10747.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96472.1| uncharacterized protein AT5G54240 [Arabidopsis thaliana]
Length=282

 Score =   233 bits (594),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 145/202 (72%), Gaps = 8/202 (4%)
 Frame = +2

Query  14   MAPSLFCCCG-KRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP LF C G K SS++    KG    NAA         DGP++V+LFSSQGC TSPEAE
Sbjct  1    MAPRLFTCFGVKGSSTSTTTGKGISGHNAANVAADVPVGDGPILVQLFSSQGCKTSPEAE  60

Query  191  LLFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVES  349
            +L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+
Sbjct  61   MLVSRLGRGDFDGKIRRDGGSSGSPAMVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYIEA  120

Query  350  LQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTG  529
            L  DTMFTP  VVQ + Q +GN+++++L SI  APRFP  +F+ATF++PT +TL+VSLTG
Sbjct  121  LNQDTMFTPQFVVQGRVQLLGNEEESLLKSIVEAPRFPSPAFRATFQRPTSETLQVSLTG  180

Query  530  TLRNKVDSNGVDIKVVLFESGL  595
             LR KVDS+G+DI V L+E+GL
Sbjct  181  ALRMKVDSSGIDIMVALYENGL  202



>ref|XP_010904871.1| PREDICTED: uncharacterized protein LOC105032189 [Elaeis guineensis]
Length=274

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 146/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G+ ++S  +    C  +  A     E  R GPV++ELFSSQGCATSPEAE 
Sbjct  1    MAPRLFSCFGRGAASTSSASPEC--NATADLTAEEQRRMGPVLLELFSSQGCATSPEAEA  58

Query  194  LFSRLGRGDFD--LEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTM  367
            + +RL RG+     EEVPP+V+LAFHV+YWDY GWKDPFG S WTVRQK+YVESL+LDT+
Sbjct  59   VVARLARGELPGLEEEVPPVVVLAFHVEYWDYMGWKDPFGSSIWTVRQKSYVESLKLDTL  118

Query  368  FTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKV  547
            +TP +VV  + QC+G DQDA++++++SAPR+   + QATF KP+P+TL+VS TG LR KV
Sbjct  119  YTPQVVVHGRSQCLGTDQDAIVSAVRSAPRYASPTLQATFSKPSPETLQVSFTGALRTKV  178

Query  548  DSNGVDIKVVLFESGL  595
            D +G D+ V L+E+GL
Sbjct  179  DGSGADVMVALYENGL  194



>ref|XP_009119958.1| PREDICTED: uncharacterized protein LOC103844884 [Brassica rapa]
 ref|XP_009119959.1| PREDICTED: uncharacterized protein LOC103844884 [Brassica rapa]
Length=280

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G + SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MAPRLLSCFGVKGSSTSTTGKGISGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKD +G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRSEGGSGSPAMILVFHVDYWDYMGWKDRYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +FQATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFQATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS G+DI V L+E+GL
Sbjct  181  RMKVDSTGIDIMVALYENGL  200



>gb|KEH19601.1| membrane lipoprotein lipid attachment site-like protein, putative 
[Medicago truncatula]
Length=269

 Score =   230 bits (587),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 141/194 (73%), Gaps = 5/194 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP  + C G + S    D    G    +     E  R GPV+VE+FSSQGCATSP AEL
Sbjct  1    MAPRFWTCFGNKGS---RDSAADGGSMTSDVTTEEQRRGGPVMVEMFSSQGCATSPAAEL  57

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            + SRLGRGDF LE   P+V+LAFHVDYWDY GWKDP+G SQWTVRQK YVE+L LDT+ T
Sbjct  58   VLSRLGRGDFQLEM--PVVVLAFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALGLDTLLT  115

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +V+Q    C+GND  A++ +I++A R+P  +FQATF KPT D+L+VSLTG LR+KVDS
Sbjct  116  PQVVIQGVAHCLGNDDTAIVDAIQNALRYPAPTFQATFTKPTQDSLQVSLTGALRSKVDS  175

Query  554  NGVDIKVVLFESGL  595
            NGV++ V L+E+GL
Sbjct  176  NGVNVMVALYENGL  189



>ref|XP_002867508.1| hypothetical protein ARALYDRAFT_492064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43767.1| hypothetical protein ARALYDRAFT_492064 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G + SS        G +N+AA      A DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MARRLFACFGLKKSST---KPISGGNNSAAVSADIPAGDGPVLVQLFSSQGCKTSPAAEM  57

Query  194  LFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWTVRQK YVE+L
Sbjct  58   LMSRLGRGDFDAQIRGEDGGSGSPAMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYVEAL  117

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
             LDTMFTP +VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG 
Sbjct  118  NLDTMFTPQLVVQGRSQLIGNEEETLLKSISEAPRFPSPAFRATFQRPTSETLQVSLTGA  177

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR KVD NG+DI V ++E+GL
Sbjct  178  LRMKVDGNGMDIMVAIYETGL  198



>ref|XP_009127108.1| PREDICTED: uncharacterized protein LOC103851983 [Brassica rapa]
Length=280

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M P LF C   + SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MTPRLFACFRVKGSSTSPTGKGITGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRREGGAGSPAMVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP  VVQ + Q +GN++DA+L SI  APRFP  +F+ATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQFVVQGRVQFLGNEEDALLKSIVEAPRFPSPAFRATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS+G+DI V L+E+G+
Sbjct  181  RMKVDSSGIDIMVALYENGI  200



>ref|XP_010268858.1| PREDICTED: uncharacterized protein LOC104605699 [Nelumbo nucifera]
Length=270

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C  +RS S+        ++  A +   E  R G ++VELFSSQGCATSPEAEL
Sbjct  1    MAPRLLACFQRRSVSSSTTSTA--ENATADQASEEQRRGGAILVELFSSQGCATSPEAEL  58

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDF+LE   P+++LA+HVDYWDY GWKDPFG SQ TVRQK Y E+L+LDTMFT
Sbjct  59   LISRLGRGDFELE--VPVIILAYHVDYWDYMGWKDPFGSSQCTVRQKAYAEALKLDTMFT  116

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VVQ + QCVG DQ+A+L++I SA RF   SFQATF++P+ D L+VSLTG LR KVDS
Sbjct  117  PQVVVQGRTQCVGTDQEALLSNITSAVRFASPSFQATFQRPSADILQVSLTGALRTKVDS  176

Query  554  NGVDIKVVLFESGL  595
             G  + V L+E+GL
Sbjct  177  QGASVMVALYENGL  190



>ref|XP_003539579.1| PREDICTED: uncharacterized protein LOC100800264 [Glycine max]
Length=274

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 142/196 (72%), Gaps = 4/196 (2%)
 Frame = +2

Query  14   MAPSLFCCC-GKRSSSAVNDDKGCGDDNaaaeeegeaaRDG-PVVVELFSSQGCATSPEA  187
            MAP L  C   K +    + D+GCG  +  +      A    PV+VE+F+SQGCATSP A
Sbjct  1    MAPRLLSCFRNKHAGGCSHHDEGCGASSEESAAGAREAAGEGPVLVEMFTSQGCATSPAA  60

Query  188  ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTM  367
            +L+ SRLGRGDF LE   P+VLLAFHVDYWDY GWKDPFG SQWTVRQK YVE+L LDT+
Sbjct  61   DLVLSRLGRGDFQLEV--PVVLLAFHVDYWDYVGWKDPFGSSQWTVRQKAYVEALGLDTL  118

Query  368  FTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKV  547
            FTP +VVQ Q    GND +A++++I SAPRFP  +FQATF KPTP +LEV+L G LR KV
Sbjct  119  FTPQVVVQGQAHLEGNDDNALISAITSAPRFPAPTFQATFNKPTPTSLEVTLVGALRTKV  178

Query  548  DSNGVDIKVVLFESGL  595
            D+ GVD+ V L+E+GL
Sbjct  179  DNLGVDVMVALYETGL  194



>ref|XP_010539256.1| PREDICTED: uncharacterized protein LOC104813397 [Tarenaya hassleriana]
Length=273

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 145/199 (73%), Gaps = 11/199 (6%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G R SS          +NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MARRLFACFGGRGSST------SAGNNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  54

Query  194  LFSRLGRGDFDLE-----EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQL  358
            + SRLGRGDFD +        P+V+L FHVDYWDY GWKDP+G SQWTVRQK YVE+L+L
Sbjct  55   MVSRLGRGDFDGQTGGGSGSSPVVVLVFHVDYWDYMGWKDPYGSSQWTVRQKAYVEALRL  114

Query  359  DTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLR  538
            DTMFTP +VVQ + QCVGN+++ +L +I  APRFP  +F+ATF++PT +TL+VSLTG LR
Sbjct  115  DTMFTPQVVVQGRAQCVGNEEETILKTIVDAPRFPSPAFRATFQRPTSETLQVSLTGPLR  174

Query  539  NKVDSNGVDIKVVLFESGL  595
             K DSNG+D+ V L+E+GL
Sbjct  175  TKADSNGIDVMVALYENGL  193



>ref|XP_010482831.1| PREDICTED: uncharacterized protein LOC104761448 [Camelina sativa]
Length=283

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 144/203 (71%), Gaps = 9/203 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKR--SSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEA  187
            MAP LF C G R  S+S   + KG    NAA         DGPV+V+LFSSQGC TSPEA
Sbjct  1    MAPRLFACFGVRGSSTSTTTNGKGVSGHNAAVVAADVPVGDGPVLVQLFSSQGCKTSPEA  60

Query  188  ELLFSRLGRGDFD-------LEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            E+L SRLGRGDFD       +    P ++L FHVDYWD+ GWKDP+G SQWTVRQK Y+E
Sbjct  61   EMLVSRLGRGDFDGKIRRDGVSSGSPALVLVFHVDYWDHVGWKDPYGSSQWTVRQKAYIE  120

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L  DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+V+LT
Sbjct  121  ALNQDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVTLT  180

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVDS+G+DI V L+E+GL
Sbjct  181  GPLRMKVDSHGMDIMVALYENGL  203



>ref|XP_010438626.1| PREDICTED: uncharacterized protein LOC104722191 [Camelina sativa]
Length=283

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 144/203 (71%), Gaps = 9/203 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G + SS+     G G +++A       + DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MARRLFACFGLKKSSSNKPISGGGGNSSAVAAADVPSGDGPVLVQLFSSQGCKTSPAAEM  60

Query  194  LFSRLGRGDFDLE---------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            L SRLGRGDFD +            P ++L FHVDYWD+ GWKDP+G SQWTVRQK YVE
Sbjct  61   LMSRLGRGDFDAQIRGGDGGGSVGSPAMVLVFHVDYWDFKGWKDPYGSSQWTVRQKAYVE  120

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L+LDTMFTP +VVQ + Q  G +++ +LTSI  APRFP  +F+ATF++PT +TL+VSLT
Sbjct  121  ALKLDTMFTPQLVVQGRSQLTGIEEETLLTSISEAPRFPSPAFKATFQRPTSETLQVSLT  180

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVD +G+DI V ++E+GL
Sbjct  181  GALRMKVDGDGIDIMVAIYETGL  203



>ref|XP_002866033.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42292.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=282

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 8/202 (4%)
 Frame = +2

Query  14   MAPSLFCCCG-KRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP LF C G K SS++    KG    NAA         DGPV+V+LFSSQGC TSPEAE
Sbjct  1    MAPRLFACFGVKGSSTSTTTGKGISGHNAAVVAADVPVGDGPVLVQLFSSQGCKTSPEAE  60

Query  191  LLFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVES  349
            +L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWT+RQK Y+E+
Sbjct  61   MLVSRLGRGDFDGKIRRDGGSGGSPAMVLVFHVDYWDYLGWKDPYGSSQWTIRQKAYIEA  120

Query  350  LQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTG  529
            L  DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG
Sbjct  121  LNQDTMFTPQFVVQGRVQLLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVSLTG  180

Query  530  TLRNKVDSNGVDIKVVLFESGL  595
             LR KVDS+G+DI V L+E+ L
Sbjct  181  ALRMKVDSSGIDIMVALYENSL  202



>ref|XP_010694437.1| PREDICTED: uncharacterized protein LOC104907239 [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M P L  C GK   S+ N        +  A  E +   DG V+VELFSSQGC TSPEAEL
Sbjct  1    MGPRLISCFGKSGRSSRNGKNDVAATSDEAILEEQRRGDGVVLVELFSSQGCKTSPEAEL  60

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            L SRLGRGDF+LE+  P+++L FHVDYWDY GWKDPFG S +TVRQK YVESLQLDT+FT
Sbjct  61   LMSRLGRGDFNLEK--PIIVLGFHVDYWDYLGWKDPFGSSLYTVRQKAYVESLQLDTIFT  118

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VVQ +  CVGN+++ +L++I SAPRFP  +FQA F++P+ +TL+V+L+G +R K+D 
Sbjct  119  PQVVVQGRAHCVGNEEEILLSTIDSAPRFPSPNFQANFQRPSSETLQVTLSGQVRMKIDQ  178

Query  554  NGVDIKVVLFESGL  595
             G +I V L+E+GL
Sbjct  179  QGANIMVALYENGL  192



>emb|CDY28788.1| BnaA02g09800D [Brassica napus]
Length=280

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M P LF C   + SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MTPRLFACFRVKGSSTSPTGKGITGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRREGGAGSPAIVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
             DTMFTP  VVQ + Q +GN++DA+L SI  AP FP  +F+ATF++PT +TL+VSLTG L
Sbjct  121  QDTMFTPQFVVQGRVQFLGNEEDALLKSIVEAPMFPSPAFRATFQRPTSETLQVSLTGAL  180

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS+G+DI V L+E+G+
Sbjct  181  RMKVDSSGIDIMVALYENGI  200



>gb|KFK27041.1| hypothetical protein AALP_AA8G326300 [Arabis alpina]
Length=279

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 7/200 (4%)
 Frame = +2

Query  14   MAPSLFCCCG-KRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP LF C G K SS++    K     NAA       A D  V+V+LFSSQGC TSPEAE
Sbjct  1    MAPRLFACFGVKGSSTSTTTGKAISGHNAAVVAADVPAGDRSVLVQLFSSQGCKTSPEAE  60

Query  191  LLFSRLGRGDFDLEEV-----PPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            +L SRLGRGDFD +++      P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   MLVSRLGRGDFD-DQIRGSGGSPTIVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYIEALN  119

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTL  535
            LDTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG L
Sbjct  120  LDTMFTPQFVVQGRVQLLGNEEETLLKSIVDAPRFPSPAFRATFQRPTSETLQVSLTGAL  179

Query  536  RNKVDSNGVDIKVVLFESGL  595
            R KVDS+G+DI V L+E+GL
Sbjct  180  RMKVDSSGIDIMVALYENGL  199



>ref|XP_010448148.1| PREDICTED: uncharacterized protein LOC104730645 [Camelina sativa]
Length=283

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 142/203 (70%), Gaps = 9/203 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G + SS  N     G +++A       + DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MARRLFACFGLKKSSFSNKPISGGGNSSAVAAADVPSGDGPVLVQLFSSQGCKTSPAAEM  60

Query  194  LFSRLGRGDFDLE---------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            L SRLGRGDFD +            P ++L FHVDYWD+ GWKDP+G SQWTVRQK YVE
Sbjct  61   LMSRLGRGDFDAQIRGGDGGGSVGSPAMVLVFHVDYWDFKGWKDPYGSSQWTVRQKAYVE  120

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L LDTMFTP +VVQ + Q  G +++ +LTSI  APRFP  +F+ATF++PT +TL+VSLT
Sbjct  121  ALNLDTMFTPQLVVQGRSQLTGIEEETLLTSISEAPRFPSPAFKATFQRPTSETLQVSLT  180

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVD +G+DI V ++E+GL
Sbjct  181  GALRMKVDGDGIDIMVAIYETGL  203



>gb|AAM65012.1| unknown [Arabidopsis thaliana]
Length=278

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M+  LF C G + SS        G +N+AA      A DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MSRRLFACFGLKKSST---KPISGGNNSAAVAAEIPAGDGPVLVQLFSSQGCKTSPAAEM  57

Query  194  LFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L
Sbjct  58   LMSRLGRGDFDAQIRGEDGGSGSPTMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYIEAL  117

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
             LDTMFTP +V+Q + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG 
Sbjct  118  NLDTMFTPQLVIQGRSQLIGNEEETLLKSISEAPRFPSPAFRATFQRPTSETLQVSLTGA  177

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR KVD +G+DI V ++E+GL
Sbjct  178  LRMKVDGDGMDIMVAIYETGL  198



>ref|NP_194465.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG60063.1|AF337911_1 unknown protein [Arabidopsis thaliana]
 emb|CAA19729.1| putative protein [Arabidopsis thaliana]
 emb|CAB79590.1| putative protein [Arabidopsis thaliana]
 gb|AAM44923.1| membrane lipoprotein lipid attachment site-containing unknown 
protein [Arabidopsis thaliana]
 gb|AEE85327.1| uncharacterized protein AT4G27350 [Arabidopsis thaliana]
Length=278

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M+  LF C G + SS        G +N+AA      A DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MSRRLFACFGLKKSST---KPISGGNNSAAVAAEIPAGDGPVLVQLFSSQGCKTSPAAEM  57

Query  194  LFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L
Sbjct  58   LMSRLGRGDFDAQIRGEDGGSGSPTMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYIEAL  117

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
             LDTMFTP +V+Q + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSLTG 
Sbjct  118  NLDTMFTPQLVIQGRSQLIGNEEETLLKSISEAPRFPSPAFRATFQRPTSETLQVSLTGA  177

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR KVD +G+DI V ++E+GL
Sbjct  178  LRMKVDGDGMDIMVAIYETGL  198



>gb|EPS66889.1| hypothetical protein M569_07886 [Genlisea aurea]
Length=272

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 144/203 (71%), Gaps = 20/203 (10%)
 Frame = +2

Query  14   MAPSLFCCC------GKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCAT  175
            MAP L   C       ++    ++DD    ++N          R  PVV+ELFSSQGCA 
Sbjct  1    MAPRLLSGCFGSRGVSRKHHDQIDDDATPAEENR---------RGSPVVLELFSSQGCAA  51

Query  176  SPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            SPEAELLFSR+GRGDF+L+   PL+LLA+HVDYWDYTGWKDPFG SQWTVRQK YVE+L 
Sbjct  52   SPEAELLFSRIGRGDFNLDR--PLILLAYHVDYWDYTGWKDPFGSSQWTVRQKAYVEALN  109

Query  356  LDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPT--PDT-LEVSLT  526
            LDT+FTP +VVQ +DQC+GN+++A+L+ I  A RFP  +FQA F++ +  PDT L+VS T
Sbjct  110  LDTIFTPQVVVQGRDQCMGNEEEALLSYILGAHRFPAPAFQAKFQRSSSPPDTLLQVSFT  169

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G+LR KVD  GV I V L+E GL
Sbjct  170  GSLRTKVDHEGVSIMVALYECGL  192



>ref|XP_006279675.1| hypothetical protein CARUB_v10026913mg [Capsella rubella]
 gb|EOA12573.1| hypothetical protein CARUB_v10026913mg [Capsella rubella]
Length=284

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 143/204 (70%), Gaps = 10/204 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVND---DKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            MAP LF C G R S+  +     KG    NAA         DGPV+V+LFSSQGC TSPE
Sbjct  1    MAPRLFSCFGVRGSTTSSSTTTGKGVSGHNAAVVAADVPVGDGPVLVQLFSSQGCKTSPE  60

Query  185  AELLFSRLGRGDFDLEEV-------PPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYV  343
            AE+L SRLGRGDFD +          P ++L FHVDYWD+ GWKDP+G SQWTVRQK Y+
Sbjct  61   AEMLVSRLGRGDFDGKICRDGGCGGSPAMVLVFHVDYWDHVGWKDPYGSSQWTVRQKAYI  120

Query  344  ESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSL  523
            E+L  DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+VSL
Sbjct  121  EALNQDTMFTPQFVVQGRVQLLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVSL  180

Query  524  TGTLRNKVDSNGVDIKVVLFESGL  595
            TG LR KVDSNG+DI V L+E+GL
Sbjct  181  TGALRMKVDSNGIDIMVALYENGL  204



>ref|XP_010277977.1| PREDICTED: uncharacterized protein LOC104612293 [Nelumbo nucifera]
Length=273

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 136/189 (72%), Gaps = 2/189 (1%)
 Frame = +2

Query  29   FCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAELLFSRL  208
            F C G+ S S    +    +     +   E  + G ++VELF SQGCATSPEAELL SRL
Sbjct  7    FSCFGRGSKSLSKSNPTAENGIEEQQATEEPKKGGAIMVELFLSQGCATSPEAELLISRL  66

Query  209  GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFTPLMVV  388
            GRGDFD E   P+++LAFHVDYWDY GWKDPF  SQWTVRQK YVE+L+LDTMFTP +V+
Sbjct  67   GRGDFDPE--VPVIVLAFHVDYWDYMGWKDPFASSQWTVRQKAYVEALKLDTMFTPQVVI  124

Query  389  QSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDSNGVDI  568
            Q + QCV  DQ A+L++I SA R+P L+FQA FE+ +PD+L VSLTG L+ KVDS G ++
Sbjct  125  QGRTQCVATDQAALLSNITSAVRYPSLAFQAKFERTSPDSLAVSLTGALKTKVDSQGANV  184

Query  569  KVVLFESGL  595
             V L+E+ L
Sbjct  185  MVALYENEL  193



>ref|XP_007132947.1| hypothetical protein PHAVU_011G138400g [Phaseolus vulgaris]
 gb|ESW04941.1| hypothetical protein PHAVU_011G138400g [Phaseolus vulgaris]
Length=340

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = +2

Query  14   MAPSLFCCCG---KRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            MAP L+ C G    R   A+ + +    D   +E        G VVVE+FSSQGCATSPE
Sbjct  67   MAPRLWACFGGKGSRGGEAIAERRVTTAD-FGSESSRGGGGQGAVVVEMFSSQGCATSPE  125

Query  185  AELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDT  364
            AEL+ SRLGRGDF+LE   P+V+L FHVDYWDY GWKDPFG SQWTVRQK YVE+L LDT
Sbjct  126  AELVLSRLGRGDFELEV--PVVVLTFHVDYWDYVGWKDPFGSSQWTVRQKAYVEALGLDT  183

Query  365  MFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNK  544
            +FTP +V+Q + QCVGND++A++ +I +APRFP  +F+ATF KP PD+L+VSLTG LR K
Sbjct  184  IFTPQVVIQGKSQCVGNDENALIETITNAPRFPAPTFRATFTKPAPDSLQVSLTGALRTK  243

Query  545  VDSNGVDIKVVLFESGL  595
            VDS+G ++ V L+ESGL
Sbjct  244  VDSSGANVMVALYESGL  260



>ref|XP_010446683.1| PREDICTED: uncharacterized protein LOC104729440 [Camelina sativa]
Length=283

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 142/203 (70%), Gaps = 9/203 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVND--DKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEA  187
            MAP LF C G R SS       KG    NAA         DGPV+V+LFSSQGC TSPEA
Sbjct  1    MAPRLFACFGVRGSSTSTTTTGKGVSGHNAAVVASDVPVGDGPVLVQLFSSQGCKTSPEA  60

Query  188  ELLFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            E+L SRLGRGDFD +          P ++L FHVDYWD+ GWKDP+G SQWTVRQK Y+E
Sbjct  61   EMLVSRLGRGDFDGKIRRDGGSSGSPAIVLVFHVDYWDHVGWKDPYGSSQWTVRQKAYIE  120

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L  DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+V+LT
Sbjct  121  ALNQDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVTLT  180

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVDS+G+DI V L+E+GL
Sbjct  181  GPLRMKVDSHGMDIMVALYENGL  203



>gb|AAG40031.2|AF324680_1 AT4g27350 [Arabidopsis thaliana]
Length=278

 Score =   223 bits (568),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 141/201 (70%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            M+  LF C G + SS        G +N+AA      A DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MSRRLFACFGLKKSST---KPISGGNNSAAVAAEIPAGDGPVLVQLFSSQGCKTSPAAEM  57

Query  194  LFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            L SRLGRGDFD +          P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L
Sbjct  58   LMSRLGRGDFDAQIRGEDGGSGSPTMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYIEAL  117

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
             LDTMFTP +V+Q + Q +GN++  VL S   APRFP  +F+ATF++PT +TL+VSLTG 
Sbjct  118  NLDTMFTPQLVIQGRSQLIGNEKGDVLKSFSEAPRFPSPAFRATFQRPTSETLQVSLTGA  177

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR KVD +G+DI V ++E+GL
Sbjct  178  LRMKVDGDGMDIMVAIYETGL  198



>ref|XP_004146868.1| PREDICTED: uncharacterized protein LOC101216671 [Cucumis sativus]
 ref|XP_004154885.1| PREDICTED: uncharacterized protein LOC101226506 [Cucumis sativus]
 gb|KGN59870.1| hypothetical protein Csa_3G851710 [Cucumis sativus]
Length=275

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSA---VNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            M   LF C GK   S    + +D+        AEE+ +  R G VVVELFSSQGCAT+PE
Sbjct  1    MVRCLFTCFGKSDESGATGIANDRSSATAEVTAEEQQQQGRGGGVVVELFSSQGCATTPE  60

Query  185  AELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDT  364
            AE+L SRLGRGDF+LE   P+V+LA+HVDYWDY GWKDPFG SQWTVRQK YVE+L LDT
Sbjct  61   AEVLVSRLGRGDFELE--APVVVLAYHVDYWDYVGWKDPFGHSQWTVRQKAYVEALGLDT  118

Query  365  MFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNK  544
            MFTP +VVQ + Q V  DQ ++L+ IK APR+P  +FQATF++PT D+L+V+L G LR K
Sbjct  119  MFTPQVVVQGRAQAVATDQTSLLSMIKDAPRYPSPTFQATFQRPTTDSLQVTLNGALRTK  178

Query  545  VDSNGVDIKVVLFESGL  595
            VDSNG ++ V L+ESGL
Sbjct  179  VDSNGANVMVALYESGL  195



>ref|XP_008454626.1| PREDICTED: uncharacterized protein LOC103494992 [Cucumis melo]
Length=275

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 146/197 (74%), Gaps = 5/197 (3%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSA---VNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            M   LF C GK   S    ++ ++        AEE+ +  R G VVVELFSSQGCATSPE
Sbjct  1    MVRCLFTCFGKSDESGATGISHERSSATAEVTAEEQQQQGRGGGVVVELFSSQGCATSPE  60

Query  185  AELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDT  364
            AE+L SRLGRGDF+LE   P+V+LA+HVDYWDY GWKDP+G SQWTVRQK YVE+L LDT
Sbjct  61   AEVLVSRLGRGDFELE--APVVVLAYHVDYWDYMGWKDPYGHSQWTVRQKAYVEALGLDT  118

Query  365  MFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNK  544
            MFTP +VVQ + Q V  DQ ++L+ IK APR+P  +FQATF++PT D+LEV+LTG LR K
Sbjct  119  MFTPQVVVQGRAQAVATDQSSLLSMIKDAPRYPSPTFQATFQRPTTDSLEVTLTGALRTK  178

Query  545  VDSNGVDIKVVLFESGL  595
            VDS+G ++ V L+ESGL
Sbjct  179  VDSDGANVMVALYESGL  195



>ref|XP_006413087.1| hypothetical protein EUTSA_v10025946mg [Eutrema salsugineum]
 gb|ESQ54540.1| hypothetical protein EUTSA_v10025946mg [Eutrema salsugineum]
Length=279

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTG  289
            DGPV+V+LFSSQGC TSP AE+L SRLGRGDFD +         P ++L FHVDYWDY G
Sbjct  38   DGPVLVQLFSSQGCKTSPAAEMLMSRLGRGDFDDQIRGEGGSGSPAMVLVFHVDYWDYKG  97

Query  290  WKDPFGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPL  469
            WKDP+G SQWTVRQK YVE+L LDTMFTP +VVQ + Q +GN+++ +L SI  APRFP  
Sbjct  98   WKDPYGSSQWTVRQKAYVEALNLDTMFTPQLVVQGRSQLIGNEEETLLKSISEAPRFPSP  157

Query  470  SFQATFEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            +F+ATF++PT +TL+VSLTG L+ KVD NG+DI V L+E+GL
Sbjct  158  AFRATFQRPTSETLQVSLTGALKMKVDGNGIDIMVALYETGL  199



>ref|XP_006464666.1| PREDICTED: uncharacterized protein LOC102623764 [Citrus sinensis]
 gb|KDO74245.1| hypothetical protein CISIN_1g023845mg [Citrus sinensis]
Length=276

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R G V+VELFSSQGC TSPEAE+L SRLGRGDF+L    P+++LA+HVDYWDY GWKDP+
Sbjct  40   RGGAVLVELFSSQGCKTSPEAEILVSRLGRGDFELG--VPVIVLAYHVDYWDYMGWKDPY  97

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G SQWTVRQK YVE+L LDTMFTP +V Q + QC GNDQD +L++I +AP+FP  SFQAT
Sbjct  98   GSSQWTVRQKAYVEALNLDTMFTPQLVFQGRVQCQGNDQDGMLSAIANAPKFPAPSFQAT  157

Query  485  FEKPT--PDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            FE+ T   ++L+VSLTG+LR+KVD+ G +I V L+ESGL
Sbjct  158  FERLTSGSESLQVSLTGSLRSKVDNQGANIMVALYESGL  196



>ref|XP_006452004.1| hypothetical protein CICLE_v10009152mg [Citrus clementina]
 gb|ESR65244.1| hypothetical protein CICLE_v10009152mg [Citrus clementina]
Length=276

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R G V+VELFSSQGC TSPEAE+L SRLGRGDF+L    P+++LA+HVDYWDY GWKDP+
Sbjct  40   RGGAVLVELFSSQGCKTSPEAEILVSRLGRGDFELG--VPVIVLAYHVDYWDYMGWKDPY  97

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G SQWTVRQK YVE+L LDTMFTP +V Q + QC GNDQD +L++I +AP+FP  SFQAT
Sbjct  98   GSSQWTVRQKAYVEALNLDTMFTPQLVFQGRVQCQGNDQDGMLSAIANAPKFPAPSFQAT  157

Query  485  FEKPT--PDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            FE+ T   ++L+VSLTG+LR+KVD+ G +I V L+ESGL
Sbjct  158  FERLTSGSESLQVSLTGSLRSKVDNQGANIMVALYESGL  196



>ref|XP_010433380.1| PREDICTED: uncharacterized protein LOC104717502 [Camelina sativa]
Length=282

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 142/203 (70%), Gaps = 10/203 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G +  S+ N     G +++A       + DGPV+V+LFSSQGC TSP AE+
Sbjct  1    MARRLFACFGLKKPSS-NKPISGGGNSSAVVAADVPSGDGPVLVQLFSSQGCKTSPAAEM  59

Query  194  LFSRLGRGDFDLE---------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            L SRLGRGDFD +            P ++L FHVDYWD+ GWKDP+G SQWTVRQK YVE
Sbjct  60   LMSRLGRGDFDAQIRGGDGGGSVGSPAMVLVFHVDYWDFKGWKDPYGSSQWTVRQKAYVE  119

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L LDTMFTP +VVQ + Q  G +++ +LTSI  APRFP  +F+ATF++PT +TL+VSLT
Sbjct  120  ALNLDTMFTPQLVVQGRSQLTGIEEETLLTSISEAPRFPSPAFKATFQRPTSETLQVSLT  179

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVD +G+DI V ++E+GL
Sbjct  180  GALRMKVDGDGIDIMVAIYETGL  202



>ref|XP_010443000.1| PREDICTED: uncharacterized protein LOC104725946 [Camelina sativa]
Length=283

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 141/203 (69%), Gaps = 9/203 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVND--DKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEA  187
            MAP LF C G R SS       KG    NAA         DGPV+V+LFSSQGC TSPEA
Sbjct  1    MAPRLFACFGVRGSSTSTTTTGKGVSGHNAAVVAADVPVGDGPVLVQLFSSQGCKTSPEA  60

Query  188  ELLFSRLGRGDFD-------LEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            E+L SRLGRGDFD       +    P ++L FHVDYWD+ GWKDP G SQWTVRQK Y+E
Sbjct  61   EMLVSRLGRGDFDGKIRRDGVSSGSPALVLVFHVDYWDHVGWKDPHGSSQWTVRQKAYIE  120

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L  DTMFTP  VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT +TL+V+LT
Sbjct  121  ALNQDTMFTPQFVVQGRVQFLGNEEETLLKSIVEAPRFPSPAFRATFQRPTSETLQVTLT  180

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVDS+G+DI V L+E+GL
Sbjct  181  GPLRMKVDSHGMDIMVALYENGL  203



>ref|XP_009412440.1| PREDICTED: uncharacterized protein LOC103993925 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP  F C G+R     +  K    +  A + + E  R GPV+VELFSSQGC TSPEAE 
Sbjct  1    MAPRPFACFGRRRGREASASKPPVANATADQTQEEQRRMGPVLVELFSSQGCGTSPEAEG  60

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            + SRLGRGDF+  ++PP+ +LAFHV+YWDY GW+DPFG S WTVRQK YV+ L LDT++T
Sbjct  61   VVSRLGRGDFE-GDLPPVAVLAFHVEYWDYRGWRDPFGSSIWTVRQKAYVDVLHLDTLYT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VV  + QCVG D DAV  +++SAPRF   + QATF+KP P TL+VS TG L+ KVD 
Sbjct  120  PQVVVNGRAQCVGTDPDAVFAAVRSAPRFTSPTMQATFQKPDPGTLQVSFTGALQTKVDG  179

Query  554  NGVDIKVVLFESGL  595
            +G D+ V L++SGL
Sbjct  180  SGADVMVALYQSGL  193



>ref|XP_006284150.1| hypothetical protein CARUB_v10005286mg [Capsella rubella]
 gb|EOA17048.1| hypothetical protein CARUB_v10005286mg [Capsella rubella]
Length=316

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 140/201 (70%), Gaps = 10/201 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MA  LF C G + SS        G +++A       A DGPV+V+LFSSQGC TSP AE+
Sbjct  39   MARRLFACFGLKKSST---KPISGGNSSAVVAADVPAGDGPVLVQLFSSQGCKTSPAAEM  95

Query  194  LFSRLGRGDFDLE-------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            L SRLGRGDFD +          P ++L FHVDYWD+ GWKDP+G SQWTVRQK YVE+L
Sbjct  96   LMSRLGRGDFDAQIHGGGGDGGSPAMVLVFHVDYWDFKGWKDPYGSSQWTVRQKAYVEAL  155

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
             LDTMFTP +VVQ + Q    +++ +LTSI  APRFP  +F+A+F++PT +TL+VSLTG 
Sbjct  156  NLDTMFTPQLVVQGRSQLTAIEEETLLTSISEAPRFPSPAFKASFQRPTSETLQVSLTGA  215

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR KVD NG+DI V ++E+GL
Sbjct  216  LRMKVDGNGMDIMVAIYETGL  236



>ref|XP_010064913.1| PREDICTED: uncharacterized protein LOC104452083 [Eucalyptus grandis]
 gb|KCW70058.1| hypothetical protein EUGRSUZ_F03360 [Eucalyptus grandis]
Length=259

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            + G V+VELFSSQGCATSPEAELL SRLGRGDFD+E  P +V+LA HVDYWDYTGWKDPF
Sbjct  25   QGGAVLVELFSSQGCATSPEAELLLSRLGRGDFDVE-APVVVVLAHHVDYWDYTGWKDPF  83

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G SQ TVRQK YVE+L+LDTMFTP +VVQ + QCVG DQDA+L++I SAPRFP  + QA 
Sbjct  84   GSSQSTVRQKAYVEALRLDTMFTPQVVVQGRSQCVGTDQDALLSAIASAPRFPSPTLQAN  143

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            F++P+PD+ +VSL+G LR KV+     + V L+E+GL
Sbjct  144  FQRPSPDSFQVSLSGALRMKVEGQAT-VMVALYENGL  179



>emb|CDY29300.1| BnaC01g19520D [Brassica napus]
Length=281

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 11/203 (5%)
 Frame = +2

Query  14   MAPSLFCCC-GKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            M+  LF C  GK+ SS+    K    +N+A       A DGPV+V+LFSSQGC TSP AE
Sbjct  1    MSRRLFACFRGKKPSSSTT--KPVSGNNSATVSADVPAGDGPVLVQLFSSQGCKTSPAAE  58

Query  191  LLFSRLGRGDFDLE--------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            +L SRLGRGDFD +           P ++L FHVDYWDY GWKDP+G SQWTVRQK YVE
Sbjct  59   MLMSRLGRGDFDAQIRGGEDAGSGSPAMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYVE  118

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L LDTMFTP +VVQ + Q   N+++ +L SI  APRFP  +F+A+F++PT +TL+VSLT
Sbjct  119  ALNLDTMFTPQLVVQGRSQLNENEEETLLKSISEAPRFPSPAFKASFQRPTSETLQVSLT  178

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVD +G+DI V L+E+GL
Sbjct  179  GALRMKVDGDGLDIMVALYETGL  201



>ref|XP_002281704.1| PREDICTED: uncharacterized protein LOC100267563 [Vitis vinifera]
 emb|CBI20382.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  149  LFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVR  328
            LFSSQGCATSPEAELL SRLGRGDF L    P+++LA+HVDYWD+ GWKDPFG SQWTVR
Sbjct  45   LFSSQGCATSPEAELLISRLGRGDFGLGR--PVMVLAYHVDYWDHMGWKDPFGSSQWTVR  102

Query  329  QKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDT  508
            QK YVE+L+LDT+FTP +VVQ +  CVGND++A+L+SI +AP  P  + QATF++P+PDT
Sbjct  103  QKAYVEALKLDTLFTPQVVVQGKAHCVGNDEEALLSSIGAAPPIPAPTLQATFQRPSPDT  162

Query  509  LEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            L VS+TG LR KVDSNG D+ V L+E+GL
Sbjct  163  LRVSITGALRTKVDSNGADVLVALYENGL  191



>emb|CDX89256.1| BnaA01g16370D [Brassica napus]
Length=281

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 11/203 (5%)
 Frame = +2

Query  14   MAPSLFCCC-GKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            M+  LF C  GK+ SS+    K    +N+AA      A DGPV+V+LFSSQGC TSP AE
Sbjct  1    MSRRLFACFRGKKPSSSTT--KPVSGNNSAAVSADVPAGDGPVLVQLFSSQGCKTSPAAE  58

Query  191  LLFSRLGRGDFDLE--------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVE  346
            +L SRLGRGDFD +           P ++L FHVDYWDY GWKDP+G SQWTVRQK YVE
Sbjct  59   MLMSRLGRGDFDAQIRGGEDAGSGSPAMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYVE  118

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L LDTMFTP +VVQ + Q   N+++ +L SI  APRF   +F+A+F++PT +TL+VSLT
Sbjct  119  ALNLDTMFTPQLVVQGRSQLNENEEETLLKSISEAPRFASPAFKASFQRPTSETLQVSLT  178

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            G LR KVD +G+DI V L+E+GL
Sbjct  179  GALRTKVDGDGLDIMVALYETGL  201



>ref|XP_009143344.1| PREDICTED: uncharacterized protein LOC103867063 [Brassica rapa]
Length=282

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 142/204 (70%), Gaps = 12/204 (6%)
 Frame = +2

Query  14   MAPSLFCCC-GKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            M+  LF C  GK+ SS+    K    +N+AA      A DGPV+V+LFSSQGC TSP AE
Sbjct  1    MSRRLFACFRGKKPSSSTT--KPVSGNNSAAVSADVPAGDGPVLVQLFSSQGCKTSPAAE  58

Query  191  LLFSRLGRGDFDLE---------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYV  343
            +L SRLGRGDFD +            P ++L FHVDYWDY GWKDP+G SQWTVRQK YV
Sbjct  59   MLMSRLGRGDFDAQIRGGEDGSGSGSPAMVLVFHVDYWDYKGWKDPYGSSQWTVRQKAYV  118

Query  344  ESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSL  523
            E+L LDTMFTP +VVQ + Q   N+++ +L SI  APRF   +F+A+F++PT +TL+VSL
Sbjct  119  EALNLDTMFTPQLVVQGRSQLNENEEETLLKSISEAPRFASPAFKASFQRPTSETLQVSL  178

Query  524  TGTLRNKVDSNGVDIKVVLFESGL  595
            TG LR KVD +G+DI V L+E+GL
Sbjct  179  TGALRTKVDGDGLDIMVALYETGL  202



>ref|XP_009417275.1| PREDICTED: uncharacterized protein LOC103997696 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 135/198 (68%), Gaps = 10/198 (5%)
 Frame = +2

Query  14   MAPSLFCC----CGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSP  181
            MAP  F C    CG  S S   +     D         E  R  PV+VELFSSQGC TSP
Sbjct  1    MAPWQFSCLGRGCGASSPSTSPEANATAD-----LTAEELRRRCPVLVELFSSQGCGTSP  55

Query  182  EAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            EAE + SRLGRG+   E++PP+ +L FHV+YWDY GW+DPFG S WTVRQK YVESL+LD
Sbjct  56   EAEAVLSRLGRGELR-EDLPPVAVLGFHVEYWDYRGWRDPFGSSIWTVRQKAYVESLRLD  114

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T++TP +VV  + QC+G D DA+ ++++SA RFP  + QATF+KP P+TL+V+ TG LR+
Sbjct  115  TLYTPQVVVHGRAQCIGTDIDAIASAVRSALRFPSPTMQATFQKPAPETLQVAFTGALRS  174

Query  542  KVDSNGVDIKVVLFESGL  595
             VD +G D+ V L++S L
Sbjct  175  TVDGSGADVMVALYQSSL  192



>ref|XP_009416064.1| PREDICTED: uncharacterized protein LOC103996794 [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 2/194 (1%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G+    A +  +    +    +   E  R GPV+VELFSSQGC TSPEAE 
Sbjct  1    MAPRLFACFGRGRGRATSSSESPEANATVDQNVEEQRRMGPVLVELFSSQGCGTSPEAEA  60

Query  194  LFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFT  373
            +  +LGRG+  + ++PP+ +L FHV+YWDY GWKDPFG S WTVRQK YV++L LDT++T
Sbjct  61   VAMQLGRGEL-VGDLPPVAVLGFHVEYWDYRGWKDPFGSSIWTVRQKAYVDALHLDTLYT  119

Query  374  PLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVDS  553
            P +VV  + QCVG D DA+  +++S PRFP  + QATF+KP PDTL+VS TG LR+KV  
Sbjct  120  PQVVVSGRAQCVGTDLDAISAALQSVPRFPSPTMQATFQKPAPDTLQVSFTGALRSKVVG  179

Query  554  NGVDIKVVLFESGL  595
               D+ V L+ESGL
Sbjct  180  RA-DVMVALYESGL  192



>ref|XP_008812646.1| PREDICTED: uncharacterized protein LOC103723499 [Phoenix dactylifera]
Length=349

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C G+ ++S+ +       +  A     E  R GPV+VELFSSQGCATSPEAE 
Sbjct  76   MAPRLFSCFGRGAASSSSASPE--SNATADLTAEEQRRMGPVLVELFSSQGCATSPEAEA  133

Query  194  LFSRLGRGDF--DLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTM  367
            + +RL RG+     EEVPP+V+L FHV+YWDY GWKDPFG S WTVRQK YVESL+LDT+
Sbjct  134  VAARLARGELLGPEEEVPPVVVLGFHVEYWDYMGWKDPFGSSIWTVRQKAYVESLKLDTL  193

Query  368  FTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKV  547
            +TP +VV  ++QC+G DQDA++++++SA R+P  + QATF KP+PDTL+VS TG LR KV
Sbjct  194  YTPQVVVHGRNQCLGTDQDAIVSAVRSAARYPSPTMQATFTKPSPDTLQVSCTGALRTKV  253

Query  548  DSNGVDIKVVLFESGL  595
            D +G D+ V L+E+GL
Sbjct  254  DGSGADVMVALYENGL  269



>ref|XP_006841846.1| hypothetical protein AMTR_s00003p00270810 [Amborella trichopoda]
 gb|ERN03521.1| hypothetical protein AMTR_s00003p00270810 [Amborella trichopoda]
Length=277

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G V+VELF+SQGCATSPEAELL SRLGRGD  L+   P+++LA+HV+YWDY GWKDP+G 
Sbjct  45   GHVLVELFTSQGCATSPEAELLISRLGRGD--LQNEVPVIVLAYHVEYWDYLGWKDPYGS  102

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
            S W+VRQK YVE+L++D+++TP +VVQ + QC+G  +  +L+ I+SA RFP  + QATF+
Sbjct  103  SLWSVRQKAYVEALRMDSIYTPQVVVQGRSQCLGTKEQELLSEIRSAARFPGPNMQATFQ  162

Query  491  KPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
            +P+ DTL+VSL G LR+KVDS G+D+   L+ES +
Sbjct  163  RPSQDTLQVSLAGPLRSKVDSKGMDVMAALYESNV  197



>ref|XP_004958017.1| PREDICTED: uncharacterized protein LOC101785046 [Setaria italica]
Length=275

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 134/199 (67%), Gaps = 10/199 (5%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+R  +  +       D    +++ +    GPV++ELF+SQGC  SPEA+ 
Sbjct  1    MAPRLLACFGRRGGATAS-----APDEQEDQQQQQQVAPGPVLLELFASQGCGASPEADA  55

Query  194  LFSRLGRGDFDLEEV----PPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + +RL +     +E     P +V+LAFHVDYWD++GWKDPF  S WTVRQK YVE+L+LD
Sbjct  56   VAARLAQDSAAQQEGGGGGPAVVVLAFHVDYWDHSGWKDPFASSAWTVRQKAYVEALRLD  115

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T+FTP +VVQ +  CVG +QDA+  +++ APR+P  + +ATF++P P TL+ S TGTLR+
Sbjct  116  TLFTPQVVVQGRAHCVGTEQDALAQAVRDAPRYPAPAMKATFQRPNPTTLQASFTGTLRS  175

Query  542  KVD-SNGVDIKVVLFESGL  595
            +V+ + G  + V L+ESGL
Sbjct  176  RVEGAGGASVLVALYESGL  194



>gb|ACF84986.1| unknown [Zea mays]
 tpg|DAA63115.1| TPA: putative secreted protein [Zea mays]
Length=266

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 19/199 (10%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+  ++A +D  G G   A           GPV+VELF SQGC  SPEA+ 
Sbjct  1    MAPRLLACFGRGVAAAPDDATGEGQLEAPPA--------GPVLVELFGSQGCGASPEADA  52

Query  194  LFSRL----GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + +RL    G GD        +V+LAFHVDYWDY GWKDPF  S WTVRQK YVE+L+LD
Sbjct  53   VAARLAQDSGSGD------GAVVVLAFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLD  106

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T+FTP +V+Q +  CVG DQDA+  +++ APR+P  + + TF++P+P TL+ S TGTLR+
Sbjct  107  TLFTPQVVLQGRAHCVGTDQDALALAVRDAPRYPAPAIKVTFQRPSPATLQASFTGTLRS  166

Query  542  KVDS-NGVDIKVVLFESGL  595
            +V+   G  + V L+ESGL
Sbjct  167  RVEGPGGASVLVALYESGL  185



>gb|ACG40905.1| uncharacterized secreted protein [Zea mays]
Length=266

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 19/199 (10%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+  ++A +D  G G   A           GPV+VELF SQGC  SPEA+ 
Sbjct  1    MAPRLLACFGRGVAAAPDDATGEGQLEAPPA--------GPVLVELFGSQGCGASPEADA  52

Query  194  LFSRL----GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + +RL    G GD        +V+LAFHVDYWDY GWKDPF  S WTVRQK YVE+L+LD
Sbjct  53   VAARLAQDSGSGD------GAVVVLAFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLD  106

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T+FTP +V+Q +  CVG DQDA+  +++ APR+P  + + TF++P+P TL+ S TGTLR+
Sbjct  107  TLFTPQVVLQGRAHCVGTDQDALALAVRDAPRYPAPAIKVTFQRPSPATLQASFTGTLRS  166

Query  542  KVDS-NGVDIKVVLFESGL  595
            +V+   G  + V L+ESGL
Sbjct  167  RVEGPGGASVLVALYESGL  185



>gb|ABR16741.1| unknown [Picea sitchensis]
Length=300

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDF--DLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            GPV+VELF+SQGC TSP A+L  S+LG+GD   +LE   P+++LA+HV+YWDY GWKDPF
Sbjct  64   GPVLVELFTSQGCTTSPTADLFISKLGQGDSAQELELDVPVIILAYHVEYWDYLGWKDPF  123

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
              S WTVRQK Y +SLQ D+++TP +VVQ + QC+G+D D+VL+ I+SAPRFP    + T
Sbjct  124  ASSLWTVRQKAYGQSLQQDSIYTPQVVVQGRSQCLGSDADSVLSLIRSAPRFPSSEIKTT  183

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESG  592
              +P+  ++EVSL+G LR KV+   +DI V L+E+G
Sbjct  184  IARPSESSMEVSLSGPLRFKVEGYSLDILVALYENG  219



>ref|XP_002463018.1| hypothetical protein SORBIDRAFT_02g036300 [Sorghum bicolor]
 gb|EER99539.1| hypothetical protein SORBIDRAFT_02g036300 [Sorghum bicolor]
Length=272

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 129/199 (65%), Gaps = 13/199 (7%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVN---DDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPE  184
            MAP L  C G+R   A     DD+G   + AAA         GPV+VELF+SQGC  SPE
Sbjct  1    MAPRLLACFGRRGGGATASAPDDEGQQQEAAAA--------PGPVLVELFASQGCGASPE  52

Query  185  AELLFSRLGR-GDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            A+ + +RL +           +V+LAFHVDYWDY GWKDPF  S WTVRQK YVE+L+LD
Sbjct  53   ADAVAARLAQDSGDGDGAAVAVVVLAFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLD  112

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T+FTP +V+Q +  CVG + DA+  +++ APR+P  + + TF++P P TL+ S TGTLR+
Sbjct  113  TLFTPQVVLQGRAHCVGTEHDALAQAVRDAPRYPAPAIKVTFQRPNPTTLQASFTGTLRS  172

Query  542  KVDS-NGVDIKVVLFESGL  595
            +V+   G  + V L+ESGL
Sbjct  173  RVEGPGGASVLVALYESGL  191



>ref|XP_003562894.1| PREDICTED: uncharacterized protein LOC100835610 [Brachypodium 
distachyon]
Length=275

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 123/198 (62%), Gaps = 8/198 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaR--DGPVVVELFSSQGCATSPEA  187
            MAP    C G R  SA         DN A + + +  +   GPV+VELFSSQGC  SPEA
Sbjct  1    MAPRFLACFGSRGGSAT----ASAPDNPAEQADDQQQQLPPGPVLVELFSSQGCGASPEA  56

Query  188  ELLFSRLGRGDFDLEEVP--PLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + + +RL +   +        +V+L FHVDYWDY GWKDPF  S WTVRQK YVE+LQLD
Sbjct  57   DAVAARLAQDAAEEGGAGERAVVVLGFHVDYWDYRGWKDPFASSAWTVRQKAYVEALQLD  116

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRN  541
            T+FTP +VVQ +  CVG +QD +  +++ APR+P  + + TF++P P TL+ +  G LR 
Sbjct  117  TLFTPQVVVQGRAHCVGTEQDKLAQAVRDAPRYPSPAMKVTFQRPNPGTLQATFKGALRA  176

Query  542  KVDSNGVDIKVVLFESGL  595
            +VD     + V L+ESG+
Sbjct  177  RVDGGDGSVLVALYESGV  194



>dbj|BAK01006.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=264

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 122/196 (62%), Gaps = 15/196 (8%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP    C G+  ++A   +              E    GPV+VELFSSQGCA SPEA+ 
Sbjct  1    MAPRFLACLGRGGATASAPEP------------VEDLAPGPVLVELFSSQGCAASPEADA  48

Query  194  LFSRLGRGDFDLEE--VPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTM  367
            L +RL +   +        +++L FHVDYWDY GWKDPF  S WTVRQK YVE+L+LDT+
Sbjct  49   LVARLAQESSEASAGGERAVLVLGFHVDYWDYQGWKDPFASSAWTVRQKAYVEALRLDTL  108

Query  368  FTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKV  547
            FTP +VVQ +  CVG +QD +  +I+ APR+P  + +  F++P P TL+VS TG L ++V
Sbjct  109  FTPQVVVQGRADCVGTEQDKLAQAIRDAPRYPSPAMKVKFQRPNPSTLQVSFTGALHSRV  168

Query  548  DSNGVDIKVVLFESGL  595
            D  G  + V L+E+G+
Sbjct  169  DGGG-SVLVALYENGV  183



>ref|NP_001147369.1| uncharacterized protein LOC100280977 [Zea mays]
 gb|ACG27127.1| uncharacterized secreted protein [Zea mays]
Length=263

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 121/195 (62%), Gaps = 14/195 (7%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP    C G+  ++A   +              E    GPV+VELFSSQGCA SPEA+ 
Sbjct  1    MAPRFLACFGRGGATASAPEP------------VEDLAPGPVLVELFSSQGCAASPEADA  48

Query  194  LFSRLGRGDFDLEEVP-PLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            L +RL +   +       +V+L FHVDYWDY GWKDPF  S WTVRQK YVE+L+LDT+F
Sbjct  49   LVARLAQESSEAGGGERAMVVLGFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLDTLF  108

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNKVD  550
            TP +VVQ +  CVG +QD +  +++ APR+P  + +  F++P P TL+ S TG L ++VD
Sbjct  109  TPQVVVQGRADCVGTEQDKLAQAVRDAPRYPSPAMKVKFQRPNPSTLQASFTGALHSRVD  168

Query  551  SNGVDIKVVLFESGL  595
              G  + V L+ESG+
Sbjct  169  GGG-SVLVALYESGV  182



>ref|NP_001059980.2| Os07g0559400 [Oryza sativa Japonica Group]
 dbj|BAC84042.1| membrane lipoprotein lipid attachment site-containing protein 
-like [Oryza sativa Japonica Group]
 gb|EAZ04327.1| hypothetical protein OsI_26467 [Oryza sativa Indica Group]
 gb|EAZ40283.1| hypothetical protein OsJ_24725 [Oryza sativa Japonica Group]
 dbj|BAF21894.2| Os07g0559400 [Oryza sativa Japonica Group]
Length=273

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 127/201 (63%), Gaps = 16/201 (8%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+ S++A   D+         EE   AA  GPV++ELF SQGC  SPEA+ 
Sbjct  1    MAPRLLSCFGRGSATASAPDQ--------PEEAAAAAAPGPVLLELFCSQGCGASPEADA  52

Query  194  LFSRLGRGD-------FDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESL  352
            + +R+   D               +V+L FHVDYWDY GWKDPF  S WTVRQK YVE+L
Sbjct  53   VAARMVHEDQQRAAAGEGGGGERGVVVLGFHVDYWDYRGWKDPFASSAWTVRQKAYVEAL  112

Query  353  QLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGT  532
            +LDT+FTP  VVQ +  CVG +QDA+  +++ APR+P  + + TF++P P TL+ S TGT
Sbjct  113  RLDTLFTPQAVVQGRAHCVGTEQDALAQAVRDAPRYPAPAMKVTFQRPNPSTLQASFTGT  172

Query  533  LRNKVDSNGVDIKVVLFESGL  595
            LR++++  G  + V L+ESGL
Sbjct  173  LRSRMEGGG-SVLVALYESGL  192



>emb|CDY41793.1| BnaC02g13630D [Brassica napus]
Length=147

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 90/136 (66%), Gaps = 6/136 (4%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP LF C   + SS     KG    NAA       A DGPV+V+LFSSQGC TSPEAE+
Sbjct  1    MAPRLFACFRVKGSSTSPTGKGITGHNAAVVAADVPAGDGPVLVQLFSSQGCKTSPEAEM  60

Query  194  LFSRLGRGDFDLE------EVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQ  355
            L SRLGRGDFD +         P ++L FHVDYWDY GWKDP+G SQWTVRQK Y+E+L 
Sbjct  61   LVSRLGRGDFDGQIRREGGAGSPAIVLVFHVDYWDYLGWKDPYGSSQWTVRQKAYIEALN  120

Query  356  LDTMFTPLMVVQSQDQ  403
             DTMFTP  VVQ + Q
Sbjct  121  QDTMFTPQFVVQGRVQ  136



>gb|KHN47867.1| hypothetical protein glysoja_036611 [Glycine soja]
Length=184

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  287  GWKDPFGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            GWKDPFG SQWTVRQK YVE+L LDT+FTP +VVQ + QCVGND++A++++I SAPRFP 
Sbjct  2    GWKDPFGASQWTVRQKAYVEALGLDTIFTPQVVVQGKAQCVGNDENALVSAITSAPRFPA  61

Query  467  LSFQATFEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
             +FQATF +P PD+L+VSLTG LR KVDS+G ++ V L+E+GL
Sbjct  62   PTFQATFTRPAPDSLQVSLTGALRTKVDSDGANVMVALYENGL  104



>gb|ACF87772.1| unknown [Zea mays]
 tpg|DAA63116.1| TPA: hypothetical protein ZEAMMB73_659630 [Zea mays]
Length=174

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 99/154 (64%), Gaps = 18/154 (12%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+  ++A +D  G G   A           GPV+VELF SQGC  SPEA+ 
Sbjct  1    MAPRLLACFGRGVAAAPDDATGEGQLEAPPA--------GPVLVELFGSQGCGASPEADA  52

Query  194  LFSRL----GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + +RL    G GD        +V+LAFHVDYWDY GWKDPF  S WTVRQK YVE+L+LD
Sbjct  53   VAARLAQDSGSGDG------AVVVLAFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLD  106

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
            T+FTP +V+Q +  CVG DQDA+  +++ APR+P
Sbjct  107  TLFTPQVVLQGRAHCVGTDQDALALAVRDAPRYP  140



>ref|NP_001132600.1| hypothetical protein [Zea mays]
 gb|ACF81515.1| unknown [Zea mays]
 tpg|DAA63114.1| TPA: hypothetical protein ZEAMMB73_659630 [Zea mays]
Length=186

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 99/154 (64%), Gaps = 18/154 (12%)
 Frame = +2

Query  14   MAPSLFCCCGKRSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAEL  193
            MAP L  C G+  ++A +D  G G   A           GPV+VELF SQGC  SPEA+ 
Sbjct  1    MAPRLLACFGRGVAAAPDDATGEGQLEAPPA--------GPVLVELFGSQGCGASPEADA  52

Query  194  LFSRL----GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLD  361
            + +RL    G GD        +V+LAFHVDYWDY GWKDPF  S WTVRQK YVE+L+LD
Sbjct  53   VAARLAQDSGSGD------GAVVVLAFHVDYWDYRGWKDPFASSAWTVRQKAYVEALRLD  106

Query  362  TMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
            T+FTP +V+Q +  CVG DQDA+  +++ APR+P
Sbjct  107  TLFTPQVVLQGRAHCVGTDQDALALAVRDAPRYP  140



>gb|KHN28014.1| hypothetical protein glysoja_007746 [Glycine soja]
Length=184

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +2

Query  287  GWKDPFGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            GWKDPFG SQWTVRQK YVE+L LDT+FTP +VVQ Q    GND +A++++I SAPRFP 
Sbjct  2    GWKDPFGASQWTVRQKAYVEALGLDTLFTPQVVVQGQAHLEGNDDNALISAITSAPRFPA  61

Query  467  LSFQATFEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
             +FQATF KPTP +LEV+L G LR KVD+ GVD+ V L+E+GL
Sbjct  62   PTFQATFNKPTPTSLEVTLVGALRTKVDNLGVDVMVALYETGL  104



>ref|XP_002969957.1| hypothetical protein SELMODRAFT_67460, partial [Selaginella moellendorffii]
 gb|EFJ29081.1| hypothetical protein SELMODRAFT_67460, partial [Selaginella moellendorffii]
Length=235

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRG---DFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            V+VELF+SQGC++ P A+LL S+LG+    D  LE   P+V+L FHV+YWD+ GWKDPF 
Sbjct  1    VLVELFTSQGCSSCPPADLLISQLGQAKSSDVALEV--PIVVLGFHVEYWDFMGWKDPFA  58

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATF  487
             S WT+RQ+ Y ++LQ D+++TP +VVQ +  C+ +  + +L  I  APRF       +F
Sbjct  59   NSTWTLRQRNYGQALQQDSIYTPEVVVQGRSHCIASSLEPILALIHQAPRFAAPDITVSF  118

Query  488  EKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
              P    L+ ++   ++ KVD   +DI V L+E+GL
Sbjct  119  SLPRLRVLDTTMEAIIKFKVDKFTLDIMVALYENGL  154



>ref|XP_002981427.1| hypothetical protein SELMODRAFT_57486, partial [Selaginella moellendorffii]
 gb|EFJ17615.1| hypothetical protein SELMODRAFT_57486, partial [Selaginella moellendorffii]
Length=234

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRG---DFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            V+VELF+SQGC++ P A+LL S+LG+    D  LE   P+V+L FHV+YWD+ GWKDPF 
Sbjct  1    VLVELFTSQGCSSCPPADLLISQLGQAKSSDVALEV--PIVVLGFHVEYWDFMGWKDPFA  58

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATF  487
             S WT+RQ+ Y ++LQ D+++TP +VVQ +  C+ +  + +L  I  APRF       +F
Sbjct  59   NSTWTLRQRNYGQALQQDSIYTPEVVVQGRSHCIASSLEPILALIHQAPRFAAPDITVSF  118

Query  488  EKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
              P    L+ ++   ++ KVD   +DI V L+E+GL
Sbjct  119  SLPQ-RVLDTTMEAIIKFKVDKFTLDIMVALYENGL  153



>ref|XP_006370345.1| hypothetical protein POPTR_0001s41850g [Populus trichocarpa]
 gb|ERP66914.1| hypothetical protein POPTR_0001s41850g [Populus trichocarpa]
Length=151

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 92/156 (59%), Gaps = 31/156 (20%)
 Frame = +2

Query  14   MAPSLFCCCGK-RSSSAVNDDKGCGDDNaaaeeegeaaRDGPVVVELFSSQGCATSPEAE  190
            MAP L  C  K   SSA N +     +        E  R G V+VELFSSQGC TSPEAE
Sbjct  1    MAPRLLSCFAKGNDSSARNQNHA---NVTVDVSAEEQHRGGAVLVELFSSQGCKTSPEAE  57

Query  191  LLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMF  370
            LL SRLGR                           DP+G SQWTVRQK YVESL+LDTMF
Sbjct  58   LLVSRLGR---------------------------DPYGGSQWTVRQKAYVESLKLDTMF  90

Query  371  TPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQ  478
            TP +VVQ + QCVGN+++A+L+SI +APRFP  +FQ
Sbjct  91   TPQIVVQGRTQCVGNEEEALLSSIVNAPRFPAPTFQ  126



>ref|XP_001765306.1| predicted protein [Physcomitrella patens]
 gb|EDQ70034.1| predicted protein [Physcomitrella patens]
Length=236

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRG-DFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            V+VE F+SQGC + P A+L F++LG+G   D     P++ LA+HVDYW++ GW+DPF  +
Sbjct  1    VLVEYFTSQGCKSCPSADLEFAKLGQGLAQDATGGVPIIALAYHVDYWNHLGWRDPFSSA  60

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQATFE  490
             WT+RQK Y E +Q D++ TP ++VQ      G+  ++V   IK+A RFP P   +A++E
Sbjct  61   SWTLRQKAYGEKMQQDSISTPGIIVQGCAHAEGDKMESVTGLIKAAQRFPGPDVLEASYE  120

Query  491  KPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESG  592
             P   TL VSLT   + +V+   +D+ V ++++G
Sbjct  121  LPFRSTLRVSLTLAYKKRVEKQALDVMVAIYQNG  154



>ref|XP_002863162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=107

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  293  KDPFGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLS  472
            + P+G SQWTVRQK YVE+L LDTMFTP +VVQ   Q +GN+++ +L SI  APRFP  +
Sbjct  6    RRPYGSSQWTVRQKAYVEALNLDTMFTPQLVVQGCSQLIGNEEETLLKSISEAPRFPSPA  65

Query  473  FQATFEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFE  586
            F+ATF++PT +TL+VSLTG LR KVD NG+DI V +++
Sbjct  66   FRATFQRPTSETLQVSLTGALRMKVDGNGMDIIVAIYD  103



>ref|WP_038324115.1| hypothetical protein, partial [delta proteobacterium JGI 0002000-E07]
Length=191

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            + PVVVELF+SQGC++ P A+ L   L        ++ PL   AFHVDYWD+ GW+DPF 
Sbjct  28   NKPVVVELFTSQGCSSCPPADRLLGELANDPALRGKIIPL---AFHVDYWDHLGWRDPFS  84

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
              QWT RQ  YV S+ L + +TP +VV    Q VG+D+ A+L +I
Sbjct  85   SRQWTARQMAYVRSMNLASAYTPQVVVDGARQFVGSDRRALLEAI  129



>ref|WP_038073456.1| hypothetical protein [Thioclava pacifica]
Length=227

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 7/104 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVVVELF+SQGC++ P A+ LF        ++ E P ++ LA HVDYWDY GWKDPFG 
Sbjct  12   GPVVVELFTSQGCSSCPPADALFE-------EIAERPDVIALALHVDYWDYLGWKDPFGK  64

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
             ++T RQK Y  +    T++TP M+V+ ++  VG  +  +L +I
Sbjct  65   PEFTARQKAYALAAGERTVYTPQMIVEGREALVGPQRTDLLAAI  108



>gb|KEO56495.1| hypothetical protein TP2_02915 [Thioclava pacifica DSM 10166]
Length=294

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 7/104 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVVVELF+SQGC++ P A+ LF        ++ E P ++ LA HVDYWDY GWKDPFG 
Sbjct  79   GPVVVELFTSQGCSSCPPADALFE-------EIAERPDVIALALHVDYWDYLGWKDPFGK  131

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
             ++T RQK Y  +    T++TP M+V+ ++  VG  +  +L +I
Sbjct  132  PEFTARQKAYALAAGERTVYTPQMIVEGREALVGPQRTDLLAAI  175



>ref|WP_038144034.1| hypothetical protein [Thioclava sp. 13D2W-2]
Length=237

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 18/131 (14%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            +GPVV+EL++SQGC++ P A+ LF+R+ + D        ++ LA HVDYWDY GWKDPFG
Sbjct  21   NGPVVLELYTSQGCSSCPPADALFARIAKRD-------DVIALALHVDYWDYLGWKDPFG  73

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATF  487
              ++T RQK Y  +     ++TP M+V+ ++  VG   D ++ +I+              
Sbjct  74   KPEFTARQKAYALATGERIVYTPQMIVEGREALVGPGHDDLVAAIEH-----------EL  122

Query  488  EKPTPDTLEVS  520
            ++  P TLEV+
Sbjct  123  DQARPVTLEVN  133



>ref|WP_033405572.1| hypothetical protein, partial [Kiloniella laminariae]
Length=211

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ L +       +L ++P ++ L++HVDYWDY GWKDPF   + 
Sbjct  1    VVELFTSQGCSSCPPADALLN-------ELADLPGIIALSYHVDYWDYIGWKDPFSSPEA  53

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAP-RFPPLSFQATFEKP  496
            T RQ+ Y ++L L  ++TP +V+  + + VG+ +  VL +I++A  R  P+S     ++ 
Sbjct  54   TARQRGYAQALALRYVYTPQIVIDGKTEMVGSRRGDVLLAIEAASQRVKPVSLH--IDQV  111

Query  497  TPDTLEVSLTGTL  535
            TP    +   G L
Sbjct  112  TPGKSRIIFEGLL  124



>gb|KFE36361.1| hypothetical protein DW2_03594 [Thioclava sp. 13D2W-2]
Length=303

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 18/131 (14%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            +GPVV+EL++SQGC++ P A+ LF+R+ + D        ++ LA HVDYWDY GWKDPFG
Sbjct  87   NGPVVLELYTSQGCSSCPPADALFARIAKRD-------DVIALALHVDYWDYLGWKDPFG  139

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATF  487
              ++T RQK Y  +     ++TP M+V+ ++  VG   D ++ +I+              
Sbjct  140  KPEFTARQKAYALATGERIVYTPQMIVEGREALVGPGHDDLVAAIEH-----------EL  188

Query  488  EKPTPDTLEVS  520
            ++  P TLEV+
Sbjct  189  DQARPVTLEVN  199



>ref|WP_008618083.1| hypothetical protein [Magnetospirillum sp. SO-1]
 gb|EME69543.1| hypothetical protein H261_12854 [Magnetospirillum sp. SO-1]
Length=235

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L         +L + P ++ LA+H+DYWD  GWKDPF   
Sbjct  30   PVVVELFTSQGCSSCPPADRLLG-------ELAKRPGIITLAYHIDYWDRLGWKDPFSLK  82

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
              T RQ  YV ++ L T++TP MV+      VG D+ AVL ++ +
Sbjct  83   SATARQNAYVAAMGLKTLYTPQMVINGTTDVVGFDRPAVLAALDA  127



>ref|WP_007067245.1| hypothetical protein [Fulvimarina pelagi]
 gb|EAU43271.1| hypothetical protein FP2506_10516 [Fulvimarina pelagi HTCC2506]
Length=279

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 7/97 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P+AE + S+L        E   ++ LA+HVDYWDY GW+D +G SQ 
Sbjct  57   VVELFTSQGCSSCPQAETVLSKL-------SEEADVLALAYHVDYWDYIGWRDTYGSSQN  109

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV  430
            T RQ+ Y +   L T+FTP MV+  Q Q VG + ++V
Sbjct  110  TARQQAYGKRFNLSTLFTPQMVIDGQQQMVGAEYESV  146



>ref|WP_012830500.1| hypothetical protein [Haliangium ochraceum]
 ref|YP_003269801.1| hypothetical protein [Haliangium ochraceum DSM 14365]
 gb|ACY17908.1| protein of unknown function DUF1223 [Haliangium ochraceum DSM 
14365]
Length=258

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 90/158 (57%), Gaps = 19/158 (12%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVV+ELF+SQGC++ P A+ L   LGR D        ++ LAFHVDYW+  GW+DPF  
Sbjct  45   GPVVIELFTSQGCSSCPPADRLLGELGRRD-------DVIALAFHVDYWNDLGWEDPFSS  97

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
            S W+ RQ+ Y   L    ++TP +V+Q ++  +G+ +DAVL +I++    P    +   E
Sbjct  98   SSWSQRQRLYSHELP-SRVYTPQLVIQGREHVIGSRRDAVLAAIETQAERPQPRLEIAIE  156

Query  491  KPTPDTLEVSLTGTLRNKVDSNGVDIK----VVLFESG  592
            + + D L + +        D+ G D +    V L+ESG
Sbjct  157  R-SGDQLALHI------DRDAEGPDAELRPVVALYESG  187



>ref|WP_019015184.1| hypothetical protein [Elioraea tepidiphila]
Length=239

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVV+ELF+SQGC+  P A+ L ++L R +        ++ L+FHV YWD+ GW+DPF  
Sbjct  27   GPVVLELFTSQGCSACPPADKLLAKLARDNG-------IIALSFHVPYWDHMGWRDPFAL  79

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
                 RQ+ Y  +++  +++TP +VVQ     VG+D+ A+   I +AP  P  S      
Sbjct  80   PVSVQRQRGYARAMKERSVYTPQLVVQGSAHAVGHDRPAIERLIAAAP--PSASITIALA  137

Query  491  KPTPDTLEVSL  523
               P TL + +
Sbjct  138  ARQPPTLRIEI  148



>gb|KEP71620.1| hypothetical protein DL1_01005 [Thioclava dalianensis]
Length=239

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 73/129 (57%), Gaps = 18/129 (14%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            P+VVEL++SQGC++ P A+ LFS     D        ++ LA HVDYWDY GWKDPFG +
Sbjct  25   PIVVELYTSQGCSSCPPADALFSEYADRD-------DVLALALHVDYWDYLGWKDPFGRA  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
            ++T RQK+Y  +    T++TP M+++     VG   D +  +IK              + 
Sbjct  78   EFTARQKSYARAAGERTIYTPQMMIEGTQALVGVQHDELKAAIKD-----------DLDA  126

Query  494  PTPDTLEVS  520
            P P TL++S
Sbjct  127  PQPVTLDIS  135



>ref|WP_007668525.1| hypothetical protein [alpha proteobacterium BAL199]
 gb|EDP66668.1| hypothetical protein BAL199_16443 [alpha proteobacterium BAL199]
Length=248

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVV+ELF+SQGC++ P A+ L   L + D        ++ LAFHVDYWDY GWKDPFG S
Sbjct  33   PVVLELFTSQGCSSCPPADALLGELAKRD-------DVITLAFHVDYWDYIGWKDPFGDS  85

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            ++T RQ+ Y   L   T++TP +VV      VG+ +  V  SI+      P
Sbjct  86   KFTARQRAYAAFLGQRTIYTPQLVVDGTTHVVGSRRGDVEASIRDRLNMSP  136



>ref|WP_028068782.1| hypothetical protein [Sphingobacterium thalpophilum]
Length=258

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 79/127 (62%), Gaps = 5/127 (4%)
 Frame = +2

Query  74   KGCGDDNaaaeeegeaaR-DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLV  250
            KG  DD+  A  +   +   G  VVELF+S+GC + P A+ L +RL + + + E    L 
Sbjct  24   KGFADDHKIANIKEANSSGKGFAVVELFTSEGCWSCPPADELIARLEKDNQNNE----LF  79

Query  251  LLAFHVDYWDYTGWKDPFGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV  430
            +LAFHVDYWD+ GWKD F  +++T RQK Y + + L T++TP +V+  + + VG++   V
Sbjct  80   ILAFHVDYWDHQGWKDRFSQARFTERQKQYAQWMNLSTLYTPQLVINGKTEMVGSETGKV  139

Query  431  LTSIKSA  451
            L  I+SA
Sbjct  140  LKGIQSA  146



>ref|WP_027287438.1| hypothetical protein [Rhodovibrio salinarum]
Length=238

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+ L         +L+  P ++ L+ HVDYWDY GW+DP+G ++
Sbjct  29   VVVELFTSQGCSSCPPADRLLG-------ELKGRPGVIALSLHVDYWDYIGWQDPYGLAR  81

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
             T RQ+ Y   L LD ++TP +VV    Q VG+ + AVL  +  A + P
Sbjct  82   HTNRQQAYRHRLGLDYVYTPQIVVDGALQAVGSRRQAVLDQLARARQRP  130



>ref|WP_036553511.1| hypothetical protein [Nisaea denitrificans]
Length=255

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 67/106 (63%), Gaps = 7/106 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R GP+V+ELF+SQGC++ P A+ L         +L + P ++ LA+HVDYW+Y GW+DPF
Sbjct  35   RSGPIVLELFTSQGCSSCPPADELLG-------ELAKAPDVIALAYHVDYWNYIGWEDPF  87

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
               + + RQ+ Y  ++ L T++TP +V+  +   VG+ +  VL  +
Sbjct  88   SSKEMSDRQRRYAHAMNLRTIYTPQLVIDGEADLVGSRRSIVLQEL  133



>ref|WP_036489243.1| hypothetical protein, partial [Nesiotobacter exalbescens]
Length=246

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 8/118 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ L S       +L + P ++ LAFHVDYWDY GW+D F     
Sbjct  31   VVELFTSQGCSSCPPADALLS-------ELADRPGILALAFHVDYWDYLGWEDTFASPTN  83

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
            + RQ+ Y ES    +++TP M+V      VG+D+ AV   +++A RF PL  + T E 
Sbjct  84   SKRQRLYAESHGERSVYTPQMIVNGTSGLVGSDRTAVEAELEAANRF-PLDVETTVEN  140



>gb|KDB02257.1| hypothetical protein U879_18225 [Defluviimonas sp. 20V17]
Length=253

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 13/139 (9%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLG--RGDFDLEEVPPLVLLAFHVDYWDYTGWKDP  301
            D  VVVELF+SQGC++ P A+ L  RL   RG         ++ L FHVDYWDY GWKD 
Sbjct  44   DRQVVVELFTSQGCSSCPPADELLGRLATHRG---------VIALGFHVDYWDYIGWKDS  94

Query  302  FGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQA  481
            FG   +T RQK Y  +     ++TP M++Q  D+ VG   + V   I+     PP++ Q 
Sbjct  95   FGSPAFTKRQKDYARTAGDRAVYTPQMIIQGTDRVVGFKPNEVAALIRLYRATPPIA-QV  153

Query  482  TFEKPTPDTLEVSLTGTLR  538
            T  + T D L +  T   R
Sbjct  154  TMAR-TGDMLTIEATAEHR  171



>ref|WP_038129451.1| hypothetical protein [Thioclava sp. DT23-4]
Length=237

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 7/103 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ LF      D        ++ LA HVDYWDY GWKDPFG +
Sbjct  23   PVVVELFTSQGCSSCPPADALFQTFADRD-------DVIALALHVDYWDYLGWKDPFGKA  75

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
            ++T RQK Y  + +  T++TP M+V      +G  +D +  +I
Sbjct  76   EFTARQKAYARAARERTVYTPQMIVGGTTALIGVQKDELNAAI  118



>ref|WP_011524695.1| hypothetical protein [Candidatus Koribacter versatilis]
 ref|YP_592970.1| hypothetical protein Acid345_3896 [Candidatus Koribacter versatilis 
Ellin345]
 gb|ABF42896.1| protein of unknown function DUF1223 [Candidatus Koribacter versatilis 
Ellin345]
Length=248

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 83/155 (54%), Gaps = 9/155 (6%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
             PVVVELF+S+GC++ P A+ L + L   +      P ++ L  HVDYW++ GW D F  
Sbjct  27   APVVVELFTSEGCSSCPPADQLLADLVAANAPGR--PEVIALGEHVDYWNHDGWTDRFSS  84

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
             Q+T RQ  Y +  +LD+ FTP MV+    Q   ND+ AV+ +I +A +  P S +    
Sbjct  85   RQFTDRQNNYAQKFKLDSPFTPQMVIDGNQQVSANDKSAVVHAILAAAQQAP-SAKVNLR  143

Query  491  KPTPDTLEVSLTGTLRNKVDSNGVDIKVVLFESGL  595
              +   L V +      + D +  DI +V+ E GL
Sbjct  144  LSSAARLNVEV------QSDHHSDDIFLVITEDGL  172



>ref|WP_038061508.1| hypothetical protein [Thioclava dalianensis]
Length=214

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 18/128 (14%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            +VVEL++SQGC++ P A+ LFS     D        ++ LA HVDYWDY GWKDPFG ++
Sbjct  1    MVVELYTSQGCSSCPPADALFSEYADRD-------DVLALALHVDYWDYLGWKDPFGRAE  53

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKP  496
            +T RQK+Y  +    T++TP M+++     VG   D +  +IK              + P
Sbjct  54   FTARQKSYARAAGERTIYTPQMMIEGTQALVGVQHDELKAAIKD-----------DLDAP  102

Query  497  TPDTLEVS  520
             P TL++S
Sbjct  103  QPVTLDIS  110



>ref|WP_008504901.1| protein of unknown function DUF1223 [Mucilaginibacter paludis]
 gb|EHQ25222.1| protein of unknown function DUF1223 [Mucilaginibacter paludis 
DSM 18603]
Length=264

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            +G  V+ELF+S+GC++ P A+ L +R+ + D D     P+ +LAFHVDYW+  GWKDPF 
Sbjct  40   NGFAVIELFTSEGCSSCPPADELVARVQKEDAD----KPVYILAFHVDYWNRLGWKDPFS  95

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
             + ++ RQ  Y   L L +++TP +VV    + VG+++  +  +I +  R  P
Sbjct  96   SADYSKRQSQYTTWLNLQSVYTPQIVVNGHKEFVGSEEGTLRNAITAGLRATP  148



>gb|KEO60646.1| hypothetical protein DT23_13070 [Thioclava sp. DT23-4]
Length=290

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ LF        D ++V   + LA HVDYWDY GWKDPFG +
Sbjct  76   PVVVELFTSQGCSSCPPADALFQTFA----DRDDV---IALALHVDYWDYLGWKDPFGKA  128

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
            ++T RQK Y  + +  T++TP M+V      +G  +D +  +I
Sbjct  129  EFTARQKAYARAARERTVYTPQMIVGGTTALIGVQKDELNAAI  171



>ref|WP_035845785.1| hypothetical protein [Defluviimonas sp. 20V17]
Length=207

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 74/136 (54%), Gaps = 13/136 (10%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLG--RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            +VVELF+SQGC++ P A+ L  RL   RG         ++ L FHVDYWDY GWKD FG 
Sbjct  1    MVVELFTSQGCSSCPPADELLGRLATHRG---------VIALGFHVDYWDYIGWKDSFGS  51

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
              +T RQK Y  +     ++TP M++Q  D+ VG   + V   I+     PP++ Q T  
Sbjct  52   PAFTKRQKDYARTAGDRAVYTPQMIIQGTDRVVGFKPNEVAALIRLYRATPPIA-QVTMA  110

Query  491  KPTPDTLEVSLTGTLR  538
            + T D L +  T   R
Sbjct  111  R-TGDMLTIEATAEHR  125



>ref|XP_002893600.1| hypothetical protein ARALYDRAFT_890548 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69859.1| hypothetical protein ARALYDRAFT_890548 [Arabidopsis lyrata subsp. 
lyrata]
Length=78

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  365  MFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLTGTLRNK  544
            MFTP +VVQ + Q +GN+++ +L SI  APRFP  +F+ATF++PT  TL+VSLTG LR K
Sbjct  1    MFTPQLVVQGRSQLIGNEEETLLKSISEAPRFPSPAFRATFQRPTSGTLQVSLTGALRVK  60

Query  545  VDSNGVDIKVVLFE  586
            VD NG+DI V +++
Sbjct  61   VDGNGMDIIVAIYD  74



>ref|WP_008235272.1| hypothetical protein [Roseobacter sp. CCS2]
 gb|EBA11416.1| hypothetical protein RCCS2_02118 [Roseobacter sp. CCS2]
Length=230

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            ++GPVVVEL++SQGC++ P A+ +         DL +   ++ LA HVDYWDY GWKD F
Sbjct  22   QNGPVVVELYTSQGCSSCPPADAML-------HDLAKRDDVIALALHVDYWDYIGWKDSF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPR  457
               Q+T RQ  Y  +    T++TP M++   D  +G+    V+ ++++  R
Sbjct  75   ASPQFTERQHAYARAASATTVYTPQMIIGGVDHVIGSRSMQVMDTLQAHSR  125



>ref|WP_025142804.1| hypothetical protein [Sphingobacterium sp. H1ai]
Length=264

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 77/141 (55%), Gaps = 19/141 (13%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVP--PLVLLAFHVDYWDYTGWKDPF  304
            G  VVELF+S+GC++ P A+ L + + +      E P  P+ LLAFHVDYWD  GWKD F
Sbjct  35   GFAVVELFTSEGCSSCPPADALLAEIEK------ETPKKPVYLLAFHVDYWDRLGWKDSF  88

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
              ++++ RQ  Y   L L T++TP  VV    + +G+D+  +   I +            
Sbjct  89   SNAKFSARQNEYANWLNLKTVYTPQAVVNGSMEFIGSDEKILRNRINTM-----------  137

Query  485  FEKPTPDTLEVSLTGTLRNKV  547
              KP+ D LE+SL  T R+ +
Sbjct  138  LTKPSTDHLEISLGKTDRHNL  158



>ref|WP_007093134.1| hypothetical protein [Kordia algicida]
 gb|EDP96304.1| hypothetical protein KAOT1_02807 [Kordia algicida OT-1]
Length=248

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
             D  VV+ELF+SQGC++ P A+ L  ++G    D  +   +  L++HVDYWDY GWKDPF
Sbjct  28   HDSVVVLELFTSQGCSSCPSADALLEKVG----DEFKTKNVFTLSYHVDYWDYIGWKDPF  83

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPR  457
               Q+T +Q+ Y    + + ++TP ++V  ++  VG+++  +   IK+  +
Sbjct  84   SQKQFTDKQRAYARKFRDNQIYTPAVIVNGKEHFVGSNRAKMYAKIKAYKK  134



>ref|WP_007680398.1| hypothetical protein [alpha proteobacterium BAL199]
 gb|EDP61561.1| hypothetical protein BAL199_14025 [alpha proteobacterium BAL199]
Length=247

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (60%), Gaps = 7/104 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+     L + D        +V LAFH+DYWDY GWKDPFG  
Sbjct  32   PVVVELYTSQGCSSCPPADAFMGELAKRD-------DVVALAFHIDYWDYIGWKDPFGDP  84

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
             +T RQ+ Y   L   +++TP MV+      VG+ +  V  +I+
Sbjct  85   LFTARQRAYAARLGQRSIYTPQMVIDGVTHAVGSRRGEVEAAIR  128



>ref|WP_013665894.1| hypothetical protein [Sphingobacterium sp. 21]
 ref|YP_004317843.1| hypothetical protein [Sphingobacterium sp. 21]
 gb|ADZ79173.1| protein of unknown function DUF1223 [Sphingobacterium sp. 21]
Length=261

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G  VVELF+S+GC++ P A+ L  ++   +    E   L +LAFHVDYWD+ GWKD F  
Sbjct  43   GFAVVELFTSEGCSSCPPADELMEKIQAEN----ENKQLYILAFHVDYWDHQGWKDRFSD  98

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
             ++++RQK Y   ++L T++TP ++V   ++ +G++  AV  +IK
Sbjct  99   HEFSLRQKQYANWMKLQTIYTPQVIVNGSEEMIGSEAGAVFNAIK  143



>ref|WP_038013633.1| hypothetical protein [Thalassobaculum salexigens]
Length=248

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+    RL   D        ++ LA+H+DYWDY GW DPF  +
Sbjct  33   PVVVELFTSQGCSSCPPADAYLGRLAARD-------DVIALAYHIDYWDYIGWPDPFADA  85

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV  430
             +T RQ+ Y  +L   T++TP MV+      VG+D  AV
Sbjct  86   AFTARQRAYQHALGNRTLYTPQMVIDGAVDAVGSDSRAV  124



>ref|WP_027298489.1| hypothetical protein [Rhodospirillales bacterium URHD0088]
Length=246

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEA-ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            PVVVELF+SQGC++ P A E L     R D        ++ LAFHVDYW+Y GW DPF  
Sbjct  23   PVVVELFTSQGCSSCPPADEYLGEMTARTD--------IIPLAFHVDYWNYIGWSDPFAS  74

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQ---DAVLTSIKSAPRFPP  466
             Q T RQK Y ++L    ++TP MVV    Q VG+++   +A++ + ++AP+  P
Sbjct  75   KQMTHRQKAYSKALGQRYIYTPEMVVNGTTQEVGSNRHGVEALIEAARTAPQSGP  129



>ref|WP_035215978.1| hypothetical protein, partial [Acidobacteriaceae bacterium KBS 
89]
Length=174

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            +VELF+S+GC++ P A+ L ++L R D  +     +++L  HVDYWD  GW D F   Q+
Sbjct  1    LVELFTSEGCSSCPPADALLAKLDR-DQPVNGTE-IIVLGEHVDYWDNGGWHDRFSSHQY  58

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPT  499
            T RQ  Y   L+ D ++TP M+V   DQ VGND    L SI+ A +   +    T  +P 
Sbjct  59   TDRQTQYSARLKFDDVYTPQMIVDGTDQFVGNDASHALRSIQRAAQSSKVKL--TLSQPV  116

Query  500  PDTLEVSLT  526
             D  +VS +
Sbjct  117  VDGRKVSAS  125



>ref|WP_028094457.1| hypothetical protein [Donghicola xiamenensis]
Length=238

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 67/112 (60%), Gaps = 9/112 (8%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            GPVVVELF+SQGC++ P A+LL  +L GR     E+V PL   A HVDYWDY GWKD F 
Sbjct  26   GPVVVELFTSQGCSSCPPADLLLQKLTGR-----EDVLPL---ALHVDYWDYIGWKDTFA  77

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
               +T+RQK Y  +     ++TP +VV  QD  VG D   +   I +  R P
Sbjct  78   DPFFTLRQKGYARAAGRRMIYTPQIVVMGQDDVVGADAMELADLIMAQLRRP  129



>ref|WP_028958004.1| hypothetical protein [Sulfitobacter sp. 20_GPM-1509m]
Length=230

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 15/153 (10%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ +F+ L + D        ++ LA HVDYWDY GWKD F 
Sbjct  22   DSPVVVELFTSQGCSSCPPADEIFAELAQRD-------DVIALALHVDYWDYIGWKDEFA  74

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQAT  484
               +  RQ+ Y  + Q  +++TP MVV  Q   VG     +  +I      P P++   T
Sbjct  75   VPAYADRQRGYAAAAQRRSIYTPQMVVNGQTDIVGARPMELSEAIAKHAAMPSPVTLDVT  134

Query  485  FEKPTPDTLEVSLTGTLRNKVDSNGVDIKVVLF  583
             +    D L++S     +N  D+  + +++V +
Sbjct  135  RQG---DALKIS----AQNTGDAGNMVVQLVRY  160



>ref|WP_022704761.1| hypothetical protein [Pseudorhodobacter ferrugineus]
Length=237

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+ L   L          P L+ L+ HVDYWDY GWKD F    
Sbjct  27   VVVELFTSQGCSSCPPADALLGALAHD-------PRLLALSLHVDYWDYLGWKDKFASPT  79

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV  430
            +T RQK+Y    +   ++TP MVVQ Q + VGN  +AV
Sbjct  80   FTKRQKSYAHHARDKMVYTPQMVVQGQTRLVGNKTEAV  117



>ref|WP_037925677.1| hypothetical protein [Sulfitobacter sp. H3]
 gb|KEJ95613.1| hypothetical protein SUH3_19060 [Sulfitobacter sp. H3]
Length=230

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 11/136 (8%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ +F+ L + D        ++ LA HVDYWDY GWKD F 
Sbjct  22   DSPVVVELFTSQGCSSCPPADKIFAELAQRD-------DVIALALHVDYWDYIGWKDEFA  74

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI-KSAPRFPPLSFQAT  484
               +  RQ+ Y  + Q  +++TP MVV  Q   VG     +  +I K A    P++   T
Sbjct  75   VPAYADRQRGYAAAAQRRSIYTPQMVVNGQTDIVGARPMELSEAIAKHAAMKSPVTLDVT  134

Query  485  FEKPTPDTLEVSLTGT  532
             +    D L++S   T
Sbjct  135  RQG---DALQISAQNT  147



>ref|WP_039140477.1| hypothetical protein [Flavihumibacter solisilvae]
 gb|KIC93986.1| hypothetical protein OI18_13190 [Flavihumibacter solisilvae]
Length=247

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            +G  VVELF+S+GC++ P A+ L  +L   + D     P+ ++A+HVDYWD+ GWKD F 
Sbjct  31   EGFAVVELFTSEGCSSCPPADRLIEKLSASNQD----KPVYIMAYHVDYWDHQGWKDRFS  86

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
               ++ RQ  Y + L++ +++TP +VV   ++ VG+D+ +V  +I
Sbjct  87   SGDYSRRQNQYADWLRVQSLYTPQIVVNGSEEYVGSDEQSVTNAI  131



>ref|WP_025048723.1| hypothetical protein [Sulfitobacter mediterraneus]
Length=232

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 63/114 (55%), Gaps = 7/114 (6%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVEL++SQGC++ P A+ +   L   D        ++ LA HVDYWDY GWKDPF
Sbjct  22   QDTPVVVELYTSQGCSSCPPADQILHELADRD-------DVIALALHVDYWDYIGWKDPF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            G      RQ+ Y  +    +++TP M+VQ Q   VG    A+  +I    R  P
Sbjct  75   GDPAHAERQRAYAAAGHRRSIYTPEMIVQGQTDIVGAKPMALAKAIAEHARQAP  128



>ref|WP_035247254.1| hypothetical protein [Actibacterium atlanticum]
Length=223

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 61/95 (64%), Gaps = 9/95 (9%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            GPVVVEL++SQGC++ P A+ +   L GR D        ++ LA HVDYWDY GWKD F 
Sbjct  15   GPVVVELYTSQGCSSCPPADRMLGDLAGRDD--------VIALALHVDYWDYIGWKDIFA  66

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
              Q+T RQ++Y ++    +++TP  +VQ QD  +G
Sbjct  67   DPQYTKRQRSYAQAAGHRSVYTPQFIVQGQDHVIG  101



>ref|WP_037910709.1| hypothetical protein [Sulfitobacter mediterraneus]
 gb|KAJ01910.1| hypothetical protein PM02_16860 [Sulfitobacter mediterraneus]
Length=232

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 63/114 (55%), Gaps = 7/114 (6%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVEL++SQGC++ P A+ +   L   D        ++ LA HVDYWDY GWKDPF
Sbjct  22   QDTPVVVELYTSQGCSSCPPADQILHELADRD-------DVIALALHVDYWDYIGWKDPF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            G      RQ+ Y  +    +++TP M+VQ Q   VG    A+  +I    R  P
Sbjct  75   GDPAHAERQRAYAAAGHRRSIYTPEMIVQGQTDIVGAKPMALAKAIAEHARQRP  128



>gb|KHD09326.1| hypothetical protein OT06_23695 [Candidatus Thiomargarita nelsonii]
 gb|KHD12174.1| hypothetical protein OT06_06335 [Candidatus Thiomargarita nelsonii]
Length=232

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 7/106 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVVVEL++SQGC++ P A+ L  RL + D        +V L+ HVDYWDY GWKD F  
Sbjct  24   GPVVVELYTSQGCSSCPPADDLLGRLAKRD-------DVVALSLHVDYWDYIGWKDVFAN  76

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
             +++ RQ+ Y  +     ++TP MV+  QD  VG   + V + IK+
Sbjct  77   PKYSDRQRAYARAAGKRMVYTPQMVIDGQDLVVGAKPNEVASLIKA  122



>ref|WP_007425820.1| hypothetical protein [Oceaniovalibus guishaninsula]
 gb|EKE45189.1| hypothetical protein OCGS_0667 [Oceaniovalibus guishaninsula 
JLT2003]
Length=234

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 10/109 (9%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VV+ELF+SQGCA+ P A+ L ++L   D        L+ LA HVDYWDY GWKD F    
Sbjct  28   VVIELFTSQGCASCPPADALLAQLADRD-------DLLPLALHVDYWDYIGWKDRFADPA  80

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN---DQDAVLTSIKSAP  454
            +T RQK Y  S+   T++TP MVV   DQ VG+   D  A + + K  P
Sbjct  81   FTARQKEYARSMGARTVYTPQMVVGGSDQIVGSQPLDLSAAIKAHKGRP  129



>ref|WP_014537692.1| coproporphyrinogen III oxidase [Ketogulonicigenium vulgare]
 ref|YP_005794705.1| Coproporphyrinogen III oxidase [Ketogulonicigenium vulgare WSH-001]
 gb|AEM40709.1| Coproporphyrinogen III oxidase [Ketogulonicigenium vulgare WSH-001]
Length=230

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 10/111 (9%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL+++QGCA  P A+++ S+L        ++P ++ LA HVDYWDY GW D FG +
Sbjct  25   PVVVELYTAQGCAACPPADVVLSKL-------RDIPGVIPLALHVDYWDYIGWIDAFGQA  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI---KSAPR  457
             +T RQ  Y +      ++TP MV+      +G D  AV+ +I   K APR
Sbjct  78   AFTQRQNAYADIRNERYIYTPQMVIDGTRSVLGGDGMAVMDAISAAKDAPR  128



>ref|WP_026756182.1| hypothetical protein [Sediminimonas qiaohouensis]
Length=241

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 65/121 (54%), Gaps = 10/121 (8%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVVVELF+SQGC++ P A+ L + L + +  L        LA HVDYWDY GWKD FG 
Sbjct  31   GPVVVELFTSQGCSSCPPADALLAELAKREGVLA-------LALHVDYWDYIGWKDSFGD  83

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV---LTSIKSAPRFPPLSFQA  481
               T RQK Y  +    +++TP M+VQ     VG     V   +TS  S P    L  + 
Sbjct  84   PAHTRRQKAYASAGGRRSIYTPQMIVQGAQHVVGTQPQNVRDLITSHASDPALIALRVER  143

Query  482  T  484
            T
Sbjct  144  T  144



>ref|WP_011048028.1| hypothetical protein [Ruegeria pomeroyi]
 ref|YP_167534.1| hypothetical protein SPO2311 [Ruegeria pomeroyi DSS-3]
 gb|AAV95573.1| hypothetical protein SPO2311 [Ruegeria pomeroyi DSS-3]
Length=294

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 11/134 (8%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            +GPVVVEL++SQGC++ P A+ +  RL R D        ++ LA HVDYWDY GW D + 
Sbjct  84   EGPVVVELYTSQGCSSCPPADAIMHRLARRD-------DVIGLALHVDYWDYIGWADEYA  136

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQAT  484
                T+RQ+ Y  +     ++TP M++Q  +  VG  ++ VL  I++    P P+   A 
Sbjct  137  DPAHTLRQQAYARAGGRSMIYTPQMIIQGVEDVVGAREEEVLALIEAHKARPAPVGIAA-  195

Query  485  FEKPTPDTLEVSLT  526
              +   D + V+LT
Sbjct  196  --RRVGDDITVTLT  207



>ref|WP_009805074.1| hypothetical protein [Oceanicola batsensis]
 gb|EAQ01595.1| hypothetical protein OB2597_04123 [Oceanicola batsensis HTCC2597]
Length=225

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 73/138 (53%), Gaps = 10/138 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            D PVVVEL++SQGC++ P A+   S L  R D        ++ L  HVDYWDY GWKD F
Sbjct  15   DTPVVVELYTSQGCSSCPPADAFLSVLAPRED--------VIALGLHVDYWDYIGWKDVF  66

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            G  +++ RQK Y ++    +++TP M++  +   VGN    V   I S  R  P+    T
Sbjct  67   GSPEFSARQKAYAKAAGRRSVYTPQMIIGGEADVVGNHPMDVTDLIDSY-RDRPVRVHLT  125

Query  485  FEKPTPDTLEVSLTGTLR  538
             E+  PD + +      R
Sbjct  126  LERRGPDRVGIDAEAVDR  143



>ref|WP_037248701.1| hypothetical protein [Roseovarius sp. MCTG156(2b)]
Length=214

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 7/97 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVELF+SQGCA+ P A+    +L   D        +V LA HVDYWDY GW+D F
Sbjct  3    QDRPVVVELFTSQGCASCPPADAFLQQLAARD-------DVVALALHVDYWDYIGWEDSF  55

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
            G   ++ RQ+ Y +S +   ++TP M++   D  VG 
Sbjct  56   GSPDYSARQRGYAKSGERKMVYTPQMIINGADHVVGT  92



>ref|WP_007120141.1| hypothetical protein [Oceanibulbus indolifex]
 gb|EDQ04377.1| hypothetical protein OIHEL45_15649 [Oceanibulbus indolifex HEL-45]
Length=236

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 66/116 (57%), Gaps = 11/116 (9%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVELF+SQGC++ P A+ + +       +L E   ++ LA HVDYWDY GWKDPF
Sbjct  23   QDQPVVVELFTSQGCSSCPAADEMLA-------ELAEREDIIALALHVDYWDYIGWKDPF  75

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND----QDAVLTSIKSAPRF  460
            G      RQ+ Y       +++TP ++VQ Q   VG       DAV    ++APR 
Sbjct  76   GDPAHAERQRGYAAVGGRRSVYTPELIVQGQTDIVGAKPMKLMDAVEKHAEAAPRV  131



>gb|KHQ52125.1| hypothetical protein OA50_03140 [Ponticoccus sp. UMTAT08]
Length=231

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 7/97 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVELF+SQGC++ P A+ + + L     D ++V PL   A HVDYWDY GWKD F
Sbjct  22   QDNPVVVELFTSQGCSSCPPADAILAELS----DRDDVIPL---ALHVDYWDYIGWKDAF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
                +T RQK Y  +     ++TP MVV  QD  VG+
Sbjct  75   AQHAFTQRQKAYARTGGWKMIYTPQMVVNGQDDVVGS  111



>ref|WP_035024872.1| hypothetical protein [Gemmobacter nectariphilus]
Length=234

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 7/110 (6%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC   P A+  F+       +L + P ++ LA HVDYWDY GW+D F    
Sbjct  27   VVVELFTSQGCIACPPADAFFA-------ELADQPGVIALALHVDYWDYLGWEDSFAAPA  79

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            +T RQK Y  +     ++TP ++V  QD+  G    A++ SI +    PP
Sbjct  80   FTQRQKRYARAASARMIYTPQVIVNGQDRVEGTRPQAIIDSITARAATPP  129



>gb|ETX30655.1| hypothetical protein RISW2_07520 [Roseivivax isoporae LMG 25204]
Length=233

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 74/142 (52%), Gaps = 19/142 (13%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   LG+ D        ++ LA HVDYWDY GWKD F  +
Sbjct  27   PVVVELFTSQGCSSCPPADALLHELGQRD-------DVIALALHVDYWDYIGWKDSFAEA  79

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
            ++T RQK Y  +    +++TP MVV      VGN    V   I           +    K
Sbjct  80   RFTERQKGYATAAGRTSIYTPQMVVNGVHDVVGNRPKDVAKLI-----------EKHRAK  128

Query  494  PTPDTLEVSLTG-TLRNKVDSN  556
             +P TL+++  G  LR   D+ 
Sbjct  129  ASPVTLDIAREGEMLRIAADTT  150



>ref|WP_021096718.1| putative secreted protein [Rubellimicrobium thermophilum]
 gb|EPX87214.1| putative secreted protein [Rubellimicrobium thermophilum DSM 
16684]
Length=238

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ +   L R D        ++ LA HVDYWDY GW D F   
Sbjct  27   PVVVELYTSQGCSSCPPADAMLEELARMDG-------VIALALHVDYWDYIGWPDSFASP  79

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
             ++ RQ+ Y ++     ++TP ++V  QD+ VG+D  AV+  + +
Sbjct  80   LFSARQEAYAKAAGERMVYTPQVIVNGQDRVVGSDAMAVMARLHA  124



>emb|CCQ72189.1| conserved protein of unknown function [Magnetospira sp. QH-2]
Length=244

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GP VVELF+SQGC++ P A+     L     D  +V PL   +FHVDYWDY GWKDPF  
Sbjct  31   GPTVVELFTSQGCSSCPPADAFIGELA----DRRDVLPL---SFHVDYWDYIGWKDPFAD  83

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
               T RQ+TY    +  +++TP +VV    + VG+D+ +V   I  A
Sbjct  84   PDHTRRQRTYAHRFRQRSVYTPQVVVHGTYEGVGSDRRSVNRLITKA  130



>ref|WP_037944578.1| MULTISPECIES: hypothetical protein [Sulfitobacter]
 gb|KAJ31138.1| hypothetical protein PM01_04275 [Sulfitobacter pontiacus 3SOLIMAR09]
 gb|KFC26691.1| hypothetical protein IV89_15765 [Sulfitobacter sp. CB2047]
Length=232

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 64/107 (60%), Gaps = 7/107 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVEL++SQGC++ P A+ +F+ L + D        ++ LA HVDYWDY GW+DPF
Sbjct  22   QDRPVVVELYTSQGCSSCPPADEMFAELSKRD-------DVIALALHVDYWDYIGWQDPF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
            G  +   RQ+ Y  +    +++TP M+V  Q   VG     ++ +I 
Sbjct  75   GAPEHAERQRAYALTGGRTSIYTPEMIVNGQSDVVGAKPMKLMEAIN  121



>ref|WP_027244047.1| hypothetical protein [Leisingera daeponensis]
Length=233

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 64/110 (58%), Gaps = 7/110 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   L   D    +V PL   A HVDYWDY GWKD F   
Sbjct  25   PVVVELFTSQGCSSCPPADALLHELAARD----DVLPL---ALHVDYWDYIGWKDKFARR  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
            + T RQK Y ++     ++TP MV+  Q+  VG D   V ++I+   + P
Sbjct  78   EHTRRQKGYAQAGGRRMIYTPQMVIMGQEDVVGADAVQVESAIRKHQKKP  127



>ref|XP_006658691.1| PREDICTED: uncharacterized protein LOC102717452 [Oryza brachyantha]
Length=213

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +2

Query  347  SLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPTPDTLEVSLT  526
            +L+LDT+FTP  VVQ +  CVG +QDA+  +++ APR+P  + + TF++  P TL+ S T
Sbjct  50   ALRLDTLFTPQAVVQGRAHCVGTEQDALAQAVRDAPRYPAPAMKVTFQRANPSTLQASFT  109

Query  527  GTLRNKVDSNGVDIKVVLFESGL  595
            GTLR++++  G  + V L+ESGL
Sbjct  110  GTLRSRMEGGGGSVVVALYESGL  132



>ref|WP_039182615.1| hypothetical protein [Leisingera sp. ANG-M7]
 gb|KIC37301.1| hypothetical protein RA26_08435 [Leisingera sp. ANG-M7]
Length=233

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 8/122 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVEL++SQGC++ P A+ L   L       ++V PL   A HVDYWDY GWKD F 
Sbjct  23   DEPVVVELYTSQGCSSCPPADALLHELAA----RQDVLPL---ALHVDYWDYIGWKDKFA  75

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQAT  484
                T RQK Y  +     ++TP M++  QD  VG D  AV  +I    + P P+S   +
Sbjct  76   DPSHTKRQKGYAHAGGRRMIYTPQMIIMGQDDVVGADALAVENAIARHQKTPRPVSLSVS  135

Query  485  FE  490
             E
Sbjct  136  RE  137



>ref|WP_025057928.1| hypothetical protein [Sulfitobacter donghicola]
 gb|KEJ90115.1| hypothetical protein DSW25_07900 [Sulfitobacter donghicola DSW-25 
= KCTC 12864 = JCM 14565]
Length=236

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 63/113 (56%), Gaps = 9/113 (8%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            PVVVEL++SQGC++ P A+ + + L GR D        ++ +A HVDYWDY GWKD FG 
Sbjct  29   PVVVELYTSQGCSSCPPADAMLAELSGRDD--------VIAIALHVDYWDYIGWKDEFGD  80

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPL  469
            +    RQ+ Y       T++TP M+VQ Q   VG    A+  +I       PL
Sbjct  81   AGHAKRQRDYANKAGRRTIYTPEMIVQGQTDIVGAKPKALSKAIAEHKAKAPL  133



>ref|WP_035338263.1| hypothetical protein, partial [Dokdonia sp. PRO95]
Length=193

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 82/152 (54%), Gaps = 21/152 (14%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            P V+ELF+SQGC++ P A+ L + L +   +L+E   +++L++HVDYWDY GWKDP+  +
Sbjct  23   PTVIELFTSQGCSSCPPADRLIAHLSK---ELKE--DVIILSYHVDYWDYIGWKDPYASA  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQ--------------DAVLTSIKSA  451
              T  Q  Y  +  + +++TP  V+  ++  VG+++              D    +I S 
Sbjct  78   SNTNHQYEYGRTFNIRSVYTPQAVINGRNHVVGSNERELKGAVASETSRIDKSAVTIASV  137

Query  452  PRFPP-LSFQATFEKPTPDTLEVSLTGTLRNK  544
             R    ++ QA+F K  PD   +    T++ K
Sbjct  138  ARMAEGVTIQASF-KELPDDAIIMYALTVKEK  168



>gb|AJE46349.1| hypothetical protein P73_1634 [Celeribacter indicus]
Length=248

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPV+VELF+SQGC++ P A+ + + L   D    +V PL L   HVDYWDY GW+D F  
Sbjct  39   GPVIVELFTSQGCSSCPPADAMIAELATRD----DVLPLSL---HVDYWDYIGWRDGFAQ  91

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
             Q+T RQK Y  +    T++TP M+VQ Q+  VG 
Sbjct  92   PQFTERQKAYAHAAGKRTVYTPQMIVQGQETLVGT  126



>ref|WP_037279533.1| hypothetical protein [Rubellimicrobium mesophilum]
 gb|EYD77062.1| hypothetical protein that often co-occurs with aconitase [Rubellimicrobium 
mesophilum DSM 19309]
Length=234

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            P+VVELF+SQGC++ P A+   S LG    DL ++  ++ LA HVDYWDY GW D F  +
Sbjct  27   PIVVELFTSQGCSSCPPAD---SMLG----DLSKMDNVIALALHVDYWDYIGWPDTFASA  79

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
              T RQ+ Y  +     ++TP ++V  +D+ VG D  AV+ S+++
Sbjct  80   NHTARQEAYARAAGERMVYTPQIIVNGEDRLVGGDTFAVMESLQA  124



>ref|WP_008556148.1| hypothetical protein [Rhodobacterales bacterium Y4I]
 gb|EDZ47242.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
Length=233

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 63/110 (57%), Gaps = 7/110 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   L   D    +V PL   A HVDYWDY GWKD F   
Sbjct  25   PVVVELFTSQGCSSCPPADALLHELAARD----DVLPL---ALHVDYWDYIGWKDKFARR  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
            + T RQK Y  +     ++TP MV+  Q+  VG D   V ++I+   + P
Sbjct  78   EHTRRQKGYAHAGGRRMIYTPQMVIMGQEDVVGADAVQVESAIRKHQKKP  127



>ref|WP_005854265.1| MULTISPECIES: hypothetical protein [Sulfitobacter]
 gb|EAP79114.1| hypothetical protein NAS141_07555 [Sulfitobacter sp. NAS-14.1]
 gb|EAP84790.1| hypothetical protein EE36_17312 [Sulfitobacter sp. EE-36]
Length=232

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVEL++SQGC++ P A+ +F+ L + D        ++ LA HVDYWDY GW+DPF
Sbjct  22   QDRPVVVELYTSQGCSSCPPADEMFAELSKRD-------DVIALALHVDYWDYIGWQDPF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
            G      RQ+ Y  +    +++TP M+V  Q   VG     ++ +I 
Sbjct  75   GAPAHAKRQRAYALTGGRTSIYTPEMIVNGQSDVVGAKPMKLMEAIN  121



>ref|WP_037262183.1| hypothetical protein [Roseivivax halodurans]
 gb|ETX14697.1| hypothetical protein OCH239_22095 [Roseivivax halodurans JCM 
10272]
Length=231

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 7/96 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ L   LG+   + + +P    LA HVDYWDY GWKD F 
Sbjct  23   DQPVVVELFTSQGCSSCPPADALLQELGQ---EADVIP----LALHVDYWDYIGWKDSFA  75

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
              ++T RQK Y E+   ++++TP MVV      VG 
Sbjct  76   QPKFTARQKGYAEAAGRNSVYTPQMVVGGTHDVVGT  111



>ref|WP_009507168.1| hypothetical protein [Citreicella sp. 357]
 gb|EIE48930.1| hypothetical protein C357_22260 [Citreicella sp. 357]
Length=238

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 79/154 (51%), Gaps = 19/154 (12%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
             D PVVVELF+SQGC + P A+ + + LG+ D        ++ LA HVDYWDY GW+D F
Sbjct  29   HDSPVVVELFTSQGCISCPAADAVLAELGQRD-------DVIALALHVDYWDYIGWRDSF  81

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLS----  472
            G   +T RQK Y  +    +++TP M++      VG+    V+ +++ A   P L+    
Sbjct  82   GDPAFTKRQKGYARAAGRRSIYTPQMMIGGAFDVVGSRPMKVMDAVQHALDAPALATLTI  141

Query  473  --------FQATFEKPTPDTLEVSLTGTLRNKVD  550
                     +A    P P+TL   +  T R  VD
Sbjct  142  TRDGDMLLIRADPLGPLPETLVHLVRYTPRATVD  175



>ref|WP_037210033.1| hypothetical protein [Rhodovulum sp. NI22]
 gb|KGB80998.1| hypothetical protein JT55_15775 [Rhodovulum sp. NI22]
Length=235

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVV+ELF+SQGC++ P A+ L   L + +        ++ LA HVDYWDY GWKD F 
Sbjct  26   DAPVVIELFTSQGCSSCPPADALLGELSKRE-------DIIALALHVDYWDYIGWKDKFA  78

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
               +T RQK Y  +    T++TP M+V   D  +G
Sbjct  79   SPAFTNRQKAYARAAGSRTIYTPQMIVGGADHLMG  113



>gb|ETW14497.1| hypothetical protein ATO8_01270 [Roseivivax sp. 22II-s10s]
Length=232

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   LG    D + +P    LA HVDYWDY GWKD F  +
Sbjct  26   PVVVELFTSQGCSSCPPADELLETLGS---DADVIP----LALHVDYWDYIGWKDSFAQA  78

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
            ++T RQK Y ++    T++TP MVV   +  VG 
Sbjct  79   RFTKRQKAYAKAAGRHTIYTPQMVVNGTEDVVGT  112



>ref|WP_025056523.1| hypothetical protein [Sulfitobacter sp. NB-77]
Length=232

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 64/113 (57%), Gaps = 7/113 (6%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            ++ PVVVEL++SQGC++ P A+ L   L     D E+V   + LA HVDYWDY GWKDPF
Sbjct  22   QENPVVVELYTSQGCSSCPAADALLHELA----DREDV---IALALHVDYWDYIGWKDPF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
            G      RQ+ Y  +    +++TP MVV  +   VG     +  +I +  R P
Sbjct  75   GDPAHAERQRAYAAAGDRRSIYTPEMVVNGETDIVGAKPMKLSEAIAAHARAP  127



>ref|WP_008032401.1| hypothetical protein [Rhodobacter sp. SW2]
 gb|EEW24091.1| protein of unknown function DUF1223 [Rhodobacter sp. SW2]
Length=236

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+     L R        P ++ LA HVDYWDY GW D F   +
Sbjct  30   VVVELFTSQGCSSCPPADAFLQHLARD-------PAVIALALHVDYWDYIGWADSFADPR  82

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            +T RQK Y  +    T++TP M+V+ QD+  G+  + V   I+S
Sbjct  83   FTERQKAYAHAAGSRTIYTPQMIVEGQDRVEGHQPELVEDLIRS  126



>ref|WP_013551837.1| hypothetical protein [Cellulophaga algicola]
 ref|YP_004165872.1| hypothetical protein [Cellulophaga algicola DSM 14237]
 gb|ADV50374.1| protein of unknown function DUF1223 [Cellulophaga algicola DSM 
14237]
Length=257

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 81/141 (57%), Gaps = 8/141 (6%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G VVV L++SQGC++ P A++L  ++ + +F  E +P    L++HVDYW+Y GWKDPF  
Sbjct  40   GVVVVALYTSQGCSSCPPADVLLDQVKK-EFSEEVIP----LSYHVDYWNYIGWKDPFSK  94

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLS-FQATF  487
            + +T +Q  Y    +  + +TP +VV      VG++   +  +I +  +  P +    T+
Sbjct  95   AIYTKKQTAYNYKFKNRSNYTPQVVVNGVTHFVGSNSSEMYANINTYKKIKPSNKLTLTY  154

Query  488  EKPTPDTL--EVSLTGTLRNK  544
             K + +T+  +  +TG L NK
Sbjct  155  VKASVNTINFDYEITGDLSNK  175



>ref|WP_027259167.1| hypothetical protein [Leisingera aquimarina]
Length=233

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 10/123 (8%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ L  +L       E+V PL   A HVDYWDY GWKD F   
Sbjct  25   PVVVELYTSQGCSSCPPADALLHKLA----AREDVLPL---ALHVDYWDYIGWKDQFAKP  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI---KSAPRFPPLSFQAT  484
              T RQK Y  +     ++TP M++  QD  +G D   V  +I   +S PR   LS + +
Sbjct  78   SHTKRQKGYAHAGGRRMIYTPQMIIMGQDDVIGADAMKVTDAIGKYQSQPRPVTLSVERS  137

Query  485  FEK  493
             E+
Sbjct  138  GEE  140



>ref|WP_039001300.1| hypothetical protein [Halocynthiibacter sp. PAMC 20958]
Length=215

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 9/110 (8%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDP  301
            + GPVVVEL++SQGC++ P A+ L  +L  R D        ++ L  HVDYWDY GWKD 
Sbjct  8    QSGPVVVELYTSQGCSSCPPADALLDQLAQRRD--------IIALGLHVDYWDYIGWKDV  59

Query  302  FGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
            FG   +T RQ+ Y  +     ++TP MV+   +  VGN    V  +IK A
Sbjct  60   FGDPAFTERQRNYSRAAGTTVVYTPQMVIGGVEHVVGNKPADVERAIKKA  109



>ref|WP_023849651.1| hypothetical protein [Rhodobacteraceae bacterium PD-2]
 gb|ETA52697.1| hypothetical protein P279_07310 [Rhodobacteraceae bacterium PD-2]
Length=235

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 65/112 (58%), Gaps = 9/112 (8%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            PVVVELF+SQGC++ P A+ L + + GR D        ++ LA HVDYWDY GW D F  
Sbjct  29   PVVVELFTSQGCSSCPAADALLAEMAGRED--------IIPLALHVDYWDYIGWADGFAQ  80

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            S++T+RQK Y  +     ++TP MVV  ++  VG+    V   I+     PP
Sbjct  81   SRFTMRQKGYARAAGERRIYTPQMVVNGREDVVGSRPLKVAALIEKHADTPP  132



>ref|WP_007813633.1| hypothetical protein [Roseobacter sp. AzwK-3b]
 gb|EDM72023.1| coproporphyrinogen III oxidase [Roseobacter sp. AzwK-3b]
Length=236

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 62/110 (56%), Gaps = 9/110 (8%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            VVVELF+SQGC+  P A+ L   L  RGD        +V LA HVDYWDY GWKD F   
Sbjct  29   VVVELFTSQGCSACPPADELMRELAKRGD--------VVALALHVDYWDYIGWKDSFANP  80

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
             +T RQK Y ++     ++TP M+V  +DQ +G  +  V+  I +    P
Sbjct  81   AFTARQKAYAKAQGNPMVYTPQMIVSGRDQVMGTKEMKVVDLIAAHRAMP  130



>ref|WP_015499829.1| hypothetical protein [Octadecabacter antarcticus]
 ref|YP_007704440.1| hypothetical protein OAN307_c21740 [Octadecabacter antarcticus 
307]
 gb|AGI67806.1| hypothetical protein OAN307_c21740 [Octadecabacter antarcticus 
307]
Length=234

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 9/113 (8%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEA-ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            DGPVVVEL++SQGC++ P A E+L +   R D        ++ LA HVDYWDY GW D F
Sbjct  25   DGPVVVELYTSQGCSSCPPADEMLHTLAARSD--------VIALALHVDYWDYIGWADSF  76

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
                 TVRQ++Y       T++TP M++   D  +G     V   I++    P
Sbjct  77   ADPAHTVRQQSYAHVAGASTIYTPQMIIGGADHVIGTKPMEVANLIQAHVASP  129



>ref|WP_011455765.1| hypothetical protein [Jannaschia sp. CCS1]
 ref|YP_510586.1| hypothetical protein Jann_2644 [Jannaschia sp. CCS1]
 gb|ABD55561.1| protein of unknown function DUF1223 [Jannaschia sp. CCS1]
Length=233

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 13/132 (10%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEA-ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            DGPVVVELF+SQGC++ P A ELL    GR D        ++ LA HVDYWDY GW D F
Sbjct  23   DGPVVVELFTSQGCSSCPPADELLGELAGRDD--------IIALALHVDYWDYIGWADTF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQA  481
              S ++ RQ+ Y  +     ++TP MV+   D  +GN    V+ +I +      P+   A
Sbjct  75   AQSAFSQRQQNYGHAAGSTVVYTPQMVIGGVDHVIGNRAMDVVDTIAAHRGVASPVEIAA  134

Query  482  TFEKPTPDTLEV  517
            T   P  D  +V
Sbjct  135  T---PAQDGWQV  143



>ref|WP_039166169.1| hypothetical protein [Leisingera sp. ANG-M1]
 gb|KIC08300.1| hypothetical protein RA19_20210 [Leisingera sp. ANG-M1]
Length=233

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 65/117 (56%), Gaps = 12/117 (10%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ L  +L   D    +V PL   A HVDYWDY GWKD F   
Sbjct  25   PVVVELYTSQGCSSCPPADALLHKLAERD----DVLPL---ALHVDYWDYIGWKDEFARP  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI---KSAPRFPPLSF  475
              T RQK Y  +     ++TP MV+  QD  VG D   V  +I   K  PR  P+S 
Sbjct  78   SHTKRQKGYAHAGGRRMIYTPQMVIMGQDDVVGADAMEVADAIAKHKDQPR--PVSL  132



>ref|WP_012791253.1| hypothetical protein [Chitinophaga pinensis]
 ref|YP_003123281.1| hypothetical protein Cpin_3618 [Chitinophaga pinensis DSM 2588]
 gb|ACU61080.1| protein of unknown function DUF1223 [Chitinophaga pinensis DSM 
2588]
Length=262

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G  VVELF+S+GC++ P A+ L  R+ +G+ +      + +L +HVDYWD  GWKD F  
Sbjct  43   GFAVVELFTSEGCSSCPPADELMGRIEKGNKN----ESIYILTYHVDYWDRQGWKDKFSD  98

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
              ++ RQ++Y   L L +++TP +VV   ++ +G+D+ +V+  I  A
Sbjct  99   HAFSQRQESYANWLNLSSVYTPQLVVNGANEYIGSDEHSVIGGIADA  145



>ref|WP_027237873.1| hypothetical protein [Leisingera caerulea]
Length=233

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 61/110 (55%), Gaps = 7/110 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ L         +L   P ++ LA HVDYWDY GWKD F   
Sbjct  25   PVVVELYTSQGCSSCPPADALL-------HELAARPDVLPLALHVDYWDYIGWKDKFAKP  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
              T RQK Y  S     ++TP M++  QD  VG D   V  +I+   + P
Sbjct  78   AHTRRQKGYARSGGRRMIYTPQMIIMGQDDVVGADAVEVAEAIEKHQKQP  127



>dbj|GAK44247.1| conserved protein [alpha proteobacterium MA2]
Length=241

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L         +L E P ++ L+  VDYWDY GWKD     
Sbjct  26   PVVVELFTSQGCSSCPPADALL-------HELAERPDVLALSLPVDYWDYLGWKDTLASP  78

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
              T RQKTY  ++   T++TP MV+   +  VG+ +  V  +I++    PP
Sbjct  79   SNTRRQKTYAANMGARTVYTPQMVINGMEDVVGSRRGEVTGAIEAQQSRPP  129



>ref|WP_005863370.1| hypothetical protein [Sagittula stellata]
 gb|EBA05956.1| hypothetical protein SSE37_25148 [Sagittula stellata E-37]
Length=225

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 7/104 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L + LG    D ++V PL   A HVDYWDY GWKD FG  
Sbjct  19   PVVVELFTSQGCSSCPPADALLAELG----DRDDVIPL---ALHVDYWDYIGWKDVFGTP  71

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
            + T RQK Y  +     ++TP ++V  ++  VG+    V   I+
Sbjct  72   KATKRQKGYARANGWKMIYTPQIIVNGREDVVGSRPGQVAALIE  115



>ref|WP_007799450.1| hypothetical protein [Pelagibaca bermudensis]
 gb|EAU45607.1| hypothetical protein R2601_21977 [Pelagibaca bermudensis HTCC2601]
Length=235

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 7/112 (6%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            + PVVVELF+SQGCA+ P A+ + + LG    + E V PL   A HVDYWDY GWKD F 
Sbjct  27   EHPVVVELFTSQGCASCPAADAILAELG----EQENVIPL---ALHVDYWDYIGWKDNFA  79

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
               +T RQK Y  S    +++TP M+V      VG+    V+ +I+ A   P
Sbjct  80   DPVFTKRQKGYARSAGRRSIYTPQMMVGGVYDVVGSRPMKVVDAIRHASEKP  131



>ref|WP_036636727.1| hypothetical protein [Paenirhodobacter enshiensis]
 gb|KFI27560.1| hypothetical protein CG50_16300 [Paenirhodobacter enshiensis]
Length=228

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 7/100 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            GPVVVE+F+SQGC++ P A+  F             P ++ L+ HVDYWDY GW+DPF  
Sbjct  13   GPVVVEMFTSQGCSSCPPADESF-------MAYAARPDVIALSLHVDYWDYLGWEDPFAQ  65

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAV  430
              +T RQK Y  +    +++TP MVV      +G+D  A+
Sbjct  66   PAFTSRQKAYARAAHSRSIYTPQMVVGGAQSLIGSDMSAL  105



>gb|KFE60609.1| hypothetical protein DB31_5948 [Hyalangium minutum]
Length=243

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PV+VELF+S+GC++ P A+   +RL +    +E V  L+ L FHVDYWDY GWKDP+   
Sbjct  20   PVLVELFTSEGCSSCPSADNALARLAQKQ-PVEGVE-LIALGFHVDYWDYLGWKDPYSSG  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQD  424
            +++ RQ+ YV     + M+TP MVV  Q   VG + +
Sbjct  78   EYSERQRRYVLDGDDNRMYTPQMVVDGQRAFVGGEDE  114



>ref|WP_039130065.1| hypothetical protein [Leisingera sp. ANG-Vp]
 gb|KIC17553.1| hypothetical protein RA20_14400 [Leisingera sp. ANG-Vp]
Length=233

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 67/132 (51%), Gaps = 18/132 (14%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ L  +L       E+V PL   A HVDYWDY GWKD F   
Sbjct  25   PVVVELYTSQGCSSCPPADALLHKLA----AREDVLPL---ALHVDYWDYIGWKDEFARP  77

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
              T RQK Y        ++TP M++  QD  VG D   V  +I               ++
Sbjct  78   SHTQRQKGYAHVGGRRMIYTPQMIIMGQDDVVGADAMEVADAIAK-----------HKDQ  126

Query  494  PTPDTLEVSLTG  529
            P P +LEV   G
Sbjct  127  PRPVSLEVERRG  138



>ref|WP_028725961.1| hypothetical protein [Paracoccus zeaxanthinifaciens]
Length=297

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 8/111 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ + +RLG       + P ++ L++HVDYWDY GW D F   
Sbjct  77   PVVVELFTSQGCSSCPPADHMLNRLG-------DDPEILPLSYHVDYWDYLGWADSFASP  129

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP  466
            ++T RQ+ Y  S    +++TP ++V   D  V     A L  +  A RF P
Sbjct  130  EFTERQEAYARSAGERSVYTPQIIVNGADTAVA-PSPAQLMGLIDAHRFAP  179



>ref|WP_014132407.1| hypothetical protein [Pelagibacterium halotolerans]
 ref|YP_004901013.1| hypothetical protein [Pelagibacterium halotolerans B2]
 gb|AEQ53263.1| hypothetical protein that often co-occurs with aconitase [Pelagibacterium 
halotolerans B2]
Length=245

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVELF+SQGC+  P+A+ L ++LG R D        +V LA+H+DYWDY GW+D F    
Sbjct  34   VVELFTSQGCSRCPDADRLLAQLGARED--------IVALAYHIDYWDYIGWEDTFALPA  85

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQ  478
             T  QK Y ES   + ++TP MV+  Q   VG+D      +I+ A    P++ +
Sbjct  86   NTELQKGYAESWGKNRIYTPQMVINGQSAVVGSDVAEAERAIEQAAPLLPVTLR  139



>ref|WP_008885521.1| hypothetical protein [Citreicella sp. SE45]
 gb|EEX15562.1| conserved hypothetical protein [Citreicella sp. SE45]
Length=254

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 7/107 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGCA+ P A+++ + LG+    +E V PL   A HVDYWDY GWKD F 
Sbjct  45   DAPVVVELFTSQGCASCPAADVVLAELGQ----MENVIPL---ALHVDYWDYIGWKDDFA  97

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
               +T RQK Y  +    +++TP M++      VG+    V+ +I  
Sbjct  98   DPAFTKRQKGYARAAGRRSIYTPQMMIGGVYDVVGSRPMKVVDAIHH  144



>ref|WP_028033747.1| hypothetical protein [Chelativorans sp. J32]
Length=251

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC+  P A+ LF        +L E   +V LA+H+DYWDY GW+D     + 
Sbjct  36   VVELFTSQGCSRCPPADALF-------VELAERSNIVALAYHIDYWDYLGWEDSLAVPEN  88

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
            T RQ  Y E L    ++TP +VV  Q   VG D++AVL +++ A
Sbjct  89   TERQHAYGEVLGTG-VYTPQIVVNGQKDVVGADRNAVLNAVQPA  131



>ref|WP_019295463.1| MULTISPECIES: hypothetical protein [Leisingera]
 gb|KIC25433.1| hypothetical protein RA23_06115 [Leisingera sp. ANG-S3]
 gb|KIC30090.1| hypothetical protein RA24_03900 [Leisingera sp. ANG-M6]
 gb|KIC54462.1| hypothetical protein RA22_07430 [Leisingera sp. ANG-S]
 gb|KID10717.1| hypothetical protein GC1_03325 [Leisingera sp. ANG1]
Length=233

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 63/114 (55%), Gaps = 12/114 (11%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVEL++SQGC++ P A+ L   L       E+V PL   A HVDYWDY GWKD F 
Sbjct  23   DEPVVVELYTSQGCSSCPPADALLHELA----AREDVLPL---ALHVDYWDYIGWKDEFA  75

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND----QDAVLTSIKSAPR  457
                T RQK Y        ++TP M++  QD  VG D    +DA++   K  PR
Sbjct  76   KPSHTKRQKGYAHQGGRRMIYTPQMIIMGQDDVVGADAMKVEDAIIRHQKQ-PR  128



>ref|WP_014221593.1| hypothetical protein [Niastella koreensis]
 ref|YP_005011085.1| hypothetical protein [Niastella koreensis GR20-10]
 gb|AEW01682.1| protein of unknown function DUF1223 [Niastella koreensis GR20-10]
Length=262

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 83/146 (57%), Gaps = 21/146 (14%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G  +VEL++S+GC++ P A+ L  +L + +       P+ ++AFHVDYW+  GWKD F  
Sbjct  49   GFALVELYTSEGCSSCPPADQLMEKLQQENAG----KPVYVVAFHVDYWNQLGWKDKFSA  104

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFE  490
            +++T RQ+ Y + + L++++TP +VV    + VG+++ +++ +I            A+ E
Sbjct  105  AEFTARQRQYSDWMNLESIYTPQVVVNGVSEYVGSNERSIVKAI-----------DASLE  153

Query  491  KPTPDTLEVSLTGTLRNKVDSNGVDI  568
            + T + L      TL  K DS  V +
Sbjct  154  RGTDNAL------TLTGKADSGKVRV  173



>ref|WP_021101873.1| hypothetical protein that often co-occurs with aconitase [Thalassobacter 
arenae]
 gb|EPX81354.1| hypothetical protein that often co-occurs with aconitase [Thalassobacter 
arenae DSM 19593]
Length=240

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 18/135 (13%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ L   L   D        ++ L+ HVDYWDY GW D F 
Sbjct  30   DAPVVVELFTSQGCSSCPPADALLGELVNRD-------DVIALSLHVDYWDYLGWTDEFA  82

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATF  487
                T RQ+ Y  +     ++TP MV++ ++Q VG        +++ A R      +   
Sbjct  83   DPANTERQRGYARAAGSTMIYTPQMVIEGRNQIVGTK------AMELAER-----IEQHK  131

Query  488  EKPTPDTLEVSLTGT  532
            ++P P TL V+ +GT
Sbjct  132  QQPAPVTLAVTRSGT  146



>ref|WP_013421052.1| hypothetical protein [Rhodomicrobium vannielii]
 ref|YP_004013793.1| hypothetical protein Rvan_3514 [Rhodomicrobium vannielii ATCC 
17100]
 gb|ADP72694.1| protein of unknown function DUF1223 [Rhodomicrobium vannielii 
ATCC 17100]
Length=255

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 7/102 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELFSSQGC+  P A  +  +L R        P +V+L+F V+YWDY GWKD     ++
Sbjct  37   VVELFSSQGCSLCPPAHRILQQLSR-------RPGIVVLSFPVNYWDYLGWKDTLARPEY  89

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
              RQ+ Y   L    +FTPL VV     CVG+D  A+ T+I+
Sbjct  90   GERQRNYAALLTKGEVFTPLAVVNGMRNCVGSDLAAIETAIR  131



>ref|WP_036564474.1| hypothetical protein [Oceanicola sp. HL-35]
Length=224

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+     L + D        ++ LA HVDYWDY GWKD F   
Sbjct  16   PVVVELFTSQGCSSCPPADKFLHDLAKRD-------DVIALALHVDYWDYIGWKDVFAKP  68

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
              T RQK Y  S    +++TP M++   D  VGN
Sbjct  69   GHTARQKAYAVSAGRRSVYTPQMIIDGSDHVVGN  102



>ref|WP_005982379.1| hypothetical protein [Ruegeria lacuscaerulensis]
 gb|EEX10402.1| conserved hypothetical protein [Silicibacter lacuscaerulensis 
ITI-1157]
Length=232

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            DGPVVVELF+SQGC++ P A+ +   L + D        ++ LA HVDYWDY GWKD + 
Sbjct  22   DGPVVVELFTSQGCSSCPPADAIMHDLAKRD-------DVIGLALHVDYWDYIGWKDEYA  74

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
                T RQ+ Y      D ++TP MVV  Q   VG
Sbjct  75   DPFHTTRQRIYARQGGRDVIYTPQMVVNGQQDVVG  109



>ref|WP_008207287.1| hypothetical protein [Roseobacter sp. SK209-2-6]
 gb|EBA16330.1| hypothetical protein RSK20926_21430 [Roseobacter sp. SK209-2-6]
Length=240

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 60/105 (57%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L  +L     +  +V PL   A HVDYWDY GWKD F   
Sbjct  31   PVVVELFTSQGCSSCPPADALLLKLA----ERSDVLPL---ALHVDYWDYIGWKDIFASP  83

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
              T RQK Y        ++TP M++  Q   +G D+ AV  +I S
Sbjct  84   AHTRRQKGYAHLAGRRMIYTPQMIIMGQQDILGADETAVEEAIAS  128



>ref|WP_027261169.1| hypothetical protein [Sedimentitalea nanhaiensis]
Length=232

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +  PVVVELF+SQGC++ P A+ L   L R +    +V PL   A HVDYWDY GWKD F
Sbjct  22   QSNPVVVELFTSQGCSSCPPADKLLQELARRN----DVIPL---ALHVDYWDYIGWKDLF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
               Q   RQ+ Y +      ++TP M+V  QD  VG
Sbjct  75   ARPQHAERQRAYAQVAGRHMIYTPQMIVNGQDDVVG  110



>ref|WP_009571436.1| hypothetical protein [Celeribacter baekdonensis]
 gb|EKE72802.1| hypothetical protein B30_07461 [Celeribacter baekdonensis B30]
Length=249

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R   VVVELF+SQGC++ P A+ + + L   D    +V PL L   HVDYWDY GW+D F
Sbjct  38   RSALVVVELFTSQGCSSCPPADAMMAELATRD----DVLPLSL---HVDYWDYIGWRDAF  90

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
               Q+T RQK Y  +    T++TP M+VQ  D  VG
Sbjct  91   AQPQFTDRQKAYAHAAGKRTIYTPQMIVQGLDHLVG  126



>ref|WP_010520718.1| hypothetical protein [Flavobacteriaceae bacterium HQM9]
Length=240

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 70/128 (55%), Gaps = 5/128 (4%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VV+ELF+SQGC++ P A+ L  ++   D    +   ++ LA+HVDYWD  GWKDPF   +
Sbjct  25   VVLELFTSQGCSSCPRADQLLKKIAESD----QSDRIITLAYHVDYWDRLGWKDPFSKQE  80

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP-PLSFQATFEK  493
             T  Q  Y +  + ++++TP +V+      VG+D  A+  S+      P PL  + T  +
Sbjct  81   HTEYQYKYGKKFRGNSIYTPQLVINGDQHIVGSDVAALHASLNKINTIPLPLEIKLTNVQ  140

Query  494  PTPDTLEV  517
               + + V
Sbjct  141  KETEKISV  148



>ref|WP_029877079.1| hypothetical protein [Xanthobacter sp. 126]
Length=255

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 70/129 (54%), Gaps = 8/129 (6%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGCA+ P A+ L +       DL + P ++ L   VDYWDY GWKD      
Sbjct  39   VVVELFTSQGCASCPPADALLN-------DLAKDPQVLALTLSVDYWDYVGWKDTLALHG  91

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKP  496
             ++RQK Y E      ++TP MV+  Q    G+D+ AV  ++ +A     LS     ++ 
Sbjct  92   HSLRQKAYAEQRPDKKIYTPQMVIDGQIAAKGSDRAAVQRAVMTARASGGLSLPVEVKRD  151

Query  497  TPDTLEVSL  523
              D LE++L
Sbjct  152  G-DALEITL  159



>ref|WP_039146327.1| hypothetical protein [Leisingera sp. ANG-DT]
 gb|KIC19653.1| hypothetical protein RA21_03965 [Leisingera sp. ANG-DT]
Length=233

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVEL++SQGC++ P A+ L   L       E+V PL   A HVDYWDY GWKD F 
Sbjct  23   DEPVVVELYTSQGCSSCPPADALLHELA----AREDVLPL---ALHVDYWDYIGWKDEFA  75

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
                T RQK Y        ++TP M++  QD  VG D   V  +I    + P
Sbjct  76   KPSHTKRQKGYAHQGGRRMIYTPQMIIMGQDDVVGADAMKVEDAITRHQKQP  127



>ref|WP_013579675.1| hypothetical protein [Granulicella tundricola]
 ref|YP_004217132.1| hypothetical protein AciX9_1290 [Granulicella tundricola MP5ACTX9]
 gb|ADW68352.1| protein of unknown function DUF1223 [Granulicella tundricola 
MP5ACTX9]
Length=250

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 76/132 (58%), Gaps = 0/132 (0%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            R   V+VELF+S+GC++ P A+ + ++L       E+ P +V L+ HV YW+  GW DPF
Sbjct  26   RPNAVLVELFTSEGCSSCPPADAVLAKLNATRGAGEDGPLIVGLSEHVTYWNRLGWADPF  85

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
                +T RQ  Y   ++LD+++TP +VV    + VG+D+  +L +++++ +   +  +  
Sbjct  86   SQELFTSRQNGYGSRMRLDSVYTPQVVVDGTRELVGSDEAGILRAVQASGKAGGVGLKIA  145

Query  485  FEKPTPDTLEVS  520
                  D ++VS
Sbjct  146  SAVAGHDGVKVS  157



>ref|WP_009819160.1| hypothetical protein [Roseovarius sp. 217]
 gb|EAQ27198.1| hypothetical protein ROS217_21767 [Roseovarius sp. 217]
Length=239

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            D PVVVELF+SQGCA+ P A+  F  L  R D        +V L+ HVDYWDY GW D F
Sbjct  29   DRPVVVELFTSQGCASCPPADAFFLELVARED--------VVALSLHVDYWDYIGWTDSF  80

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
            G    + RQ+ Y ++ +   ++TP M++  +D  VG 
Sbjct  81   GSPDNSARQRGYAKTAERKMVYTPQMIINGEDHVVGT  117



>ref|WP_039169929.1| hypothetical protein [Leisingera sp. ANG-S5]
 gb|KIC34711.1| hypothetical protein RA25_02690 [Leisingera sp. ANG-S5]
Length=233

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 60/112 (54%), Gaps = 7/112 (6%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVEL++SQGC++ P A+ L   L       E+V PL   A HVDYWDY GWKD F 
Sbjct  23   DEPVVVELYTSQGCSSCPPADALLHELA----AREDVLPL---ALHVDYWDYIGWKDEFA  75

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP  463
                T RQK Y        ++TP M++  QD  VG D   V  +I    + P
Sbjct  76   KPSHTKRQKGYAHQGGRRMIYTPQMIIMGQDDVVGADAMKVEDAITRHQKQP  127



>ref|WP_009207913.1| hypothetical protein [Aurantimonas manganoxydans]
 gb|EAS48387.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
Length=299

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ + SRL      +E  P ++ LA+HVDYWDY GW+D  G S+ 
Sbjct  76   VVELFTSQGCSSCPPADRILSRLA-----VE--PGILALAYHVDYWDYIGWRDTHGSSEN  128

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAP  454
            T RQ+ Y  +    T++TP +VV      +G+ +  V   + S P
Sbjct  129  TERQRAYAAAFGTTTIYTPQVVVNGVADAIGSHEGKVRALMDSHP  173



>ref|WP_010442055.1| hypothetical protein [Ruegeria conchae]
Length=233

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVELF+SQGC++ P A+ +   L + D        ++ LA HVDYWDY GWKD +
Sbjct  22   QDDPVVVELFTSQGCSSCPPADRIMHELAKRD-------DVIGLALHVDYWDYIGWKDEY  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
                 TVRQ+ Y        ++TP MVV  Q   VG
Sbjct  75   ANPDHTVRQRAYAREGGRTMIYTPQMVVNGQQDVVG  110



>ref|WP_009831103.1| hypothetical protein [Rhodobacteraceae bacterium HTCC2083]
 gb|EDZ44289.1| conserved hypothetical protein [Rhodobacteraceae bacterium HTCC2083]
Length=229

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 9/96 (9%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            PVV+ELF+SQGC++ P A+ L  +L  R D        ++ L+ HVDYWDY GWKD FG 
Sbjct  25   PVVIELFTSQGCSSCPPADALMHKLAARSD--------VIALSMHVDYWDYIGWKDEFGR  76

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND  418
             +   RQ++Y  +    +++TP MV+  +D  VG  
Sbjct  77   PENAARQRSYAAAGGRRSVYTPQMVIAGEDSVVGTH  112



>ref|WP_036538700.1| hypothetical protein [Oceanicola nanhaiensis]
Length=228

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 7/95 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+  FS L        E   ++ L  HVDYWDY GWKD F   
Sbjct  20   PVVVELYTSQGCSSCPPADAFFSTLA-------EREDVIALGLHVDYWDYIGWKDVFASP  72

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND  418
             +T RQK+Y       +++TP M++  Q+  VG  
Sbjct  73   LFTKRQKSYARHAGRRSIYTPQMIIHGQEDVVGTH  107



>ref|WP_020041922.1| hypothetical protein [Salipiger mucosus]
Length=234

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ + + LG+ D        ++ LA HVDYWDY GW D F 
Sbjct  25   DRPVVVELFTSQGCSSCPPADAILAELGQRD-------DVIPLALHVDYWDYIGWTDGFA  77

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
               +T RQK Y  S    +++TP MVV  +   VG+    V+ +I+ 
Sbjct  78   QPGFTKRQKGYARSAGRRSVYTPQMVVDGRYDVVGSRPMKVVEAIRH  124



>ref|WP_015331335.1| hypothetical protein [Fibrella aestuarina]
 ref|YP_007320829.1| hypothetical protein FAES_2227 [Fibrella aestuarina BUZ 2]
 emb|CCH00236.1| hypothetical protein FAES_2227 [Fibrella aestuarina BUZ 2]
Length=249

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            V+ELF+SQGC++ P A+ L     R      E   +  L+FHVDYWD  GW+DPF   Q+
Sbjct  34   VIELFTSQGCSSCPAADRLLGETIRQAN--AEGQAVYALSFHVDYWDRLGWRDPFSGHQY  91

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPR-FPPLSFQ-ATFEK  493
            T RQ+ Y +  +L T++TP  V+  + + VG+++  +   + +A +    +  Q AT  K
Sbjct  92   TERQRRYAQLFKLQTVYTPQAVLNGRQEFVGSNRARLKALMDNALQDGARVGVQLATQRK  151

Query  494  PTPDTLEVSLTGTL  535
                T++ SLTG L
Sbjct  152  GNTITVDYSLTGNL  165



>ref|WP_035176823.1| hypothetical protein, partial [Acidobacteria bacterium KBS 146]
Length=251

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVP--PLVLLAFHVDYWDYTGWKDPF  304
             PV+VELF+S+GC++ P A+ L + L +     + VP   +++L  HVDYWD  GW+D F
Sbjct  26   APVLVELFTSEGCSSCPPADKLLAVLQKQ----QPVPGANIIVLEEHVDYWDRQGWRDQF  81

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFP--PLSFQ  478
              +Q+T RQ  Y   L  +  +TP MVV  Q Q +G+D    +  I  A R    PLS  
Sbjct  82   SSAQFTQRQSFYAPRLHFEDSYTPQMVVDGQTQFLGSDSSKAIAVISEAARAAKIPLSLT  141

Query  479  A  481
            A
Sbjct  142  A  142



>ref|WP_029558748.1| hypothetical protein [Xanthobacter sp. 91]
Length=246

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 8/129 (6%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGCA+ P A+ L +       DL + P ++ L   VDYWDY GWKD      
Sbjct  30   VVVELFTSQGCASCPPADALLN-------DLAKDPQVLALTLSVDYWDYVGWKDTLALHG  82

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKP  496
             ++RQK Y E      ++TP MV+  Q    G+D+ AV  ++ +A     LS     ++ 
Sbjct  83   HSLRQKAYAEQRPDKKIYTPQMVIDGQIAAKGSDRAAVQRAVMTARASGGLSLPVEVKRD  142

Query  497  TPDTLEVSL  523
              D +E++L
Sbjct  143  G-DAIEITL  150



>ref|WP_022831038.1| hypothetical protein [Cytophagales bacterium B6]
Length=264

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = +2

Query  131  GPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            G  +VELF+S+GC++ P A+ L +++ +   D     P+ +LA+HVDYWD  GWKD F  
Sbjct  44   GFALVELFTSEGCSSCPAADELVAKVEKEVGD----KPVYILAYHVDYWDRLGWKDTFSN  99

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS---APRFPPLSFQA  481
            + +T RQK Y   L L  ++TP +VV  + + VG+ + A+  ++ +   A     LS  A
Sbjct  100  AAYTRRQKQYAGWLNLSQIYTPQIVVNGKTEFVGSQEAALRKALNTGLQAGSEVQLSLMA  159

Query  482  TFEKPTPDTLEVSLTG  529
            +       T+   L G
Sbjct  160  SRNVGNTATIRYKLEG  175



>ref|WP_027240054.1| hypothetical protein [Pseudophaeobacter arcticus]
Length=229

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 18/132 (14%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L  +L        + P ++ LA HVDYWDY GWKD F   
Sbjct  21   PVVVELFTSQGCSSCPPADALLKQLA-------QRPGVIALALHVDYWDYIGWKDFFASP  73

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
              T RQK Y +      ++TP M+V  Q    G+D   +  +I         ++QA   +
Sbjct  74   SNTNRQKGYAQVNGRKMIYTPQMIVMGQQDIPGSDVMGLSEAIS--------AYQA---R  122

Query  494  PTPDTLEVSLTG  529
            P P  LE+   G
Sbjct  123  PRPVALELQRQG  134



>ref|WP_009158408.1| hypothetical protein [Thalassobium sp. R2A62]
 gb|EET47335.1| conserved hypothetical protein [Thalassobium sp. R2A62]
Length=234

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVV+EL++SQGC++ P A+ L         DL +   ++ LA HVDYWDY GWKD F
Sbjct  24   QDNPVVLELYTSQGCSSCPPADELM-------HDLAKRDDVIALALHVDYWDYIGWKDTF  76

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
               Q++ RQ+ Y +S     ++TP M++  +D  +G
Sbjct  77   ASPQYSNRQRAYAQSGGDGRVYTPQMIIDGEDFIIG  112



>ref|WP_024089872.1| hypothetical protein [Leisingera methylohalidivorans]
 ref|YP_008971272.1| hypothetical protein METH_08015 [Leisingera methylohalidivorans 
DSM 14336]
 gb|AHD00647.1| hypothetical protein METH_08015 [Leisingera methylohalidivorans 
DSM 14336]
Length=233

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 65/123 (53%), Gaps = 12/123 (10%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLG-RGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGC  310
            PVVVEL++SQGC++ P A+ L   L  R D        ++ LA HVDYWDY GWKD F  
Sbjct  25   PVVVELYTSQGCSSCPPADALLHELAARKD--------VLPLALHVDYWDYIGWKDQFAK  76

Query  311  SQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI---KSAPRFPPLSFQA  481
                 RQK Y  +     ++TP M++  QD  VG D   V  +I   +S PR   LS + 
Sbjct  77   PSHAKRQKGYAHAGGRRMIYTPQMIIMGQDDVVGADAMKVADAIGKHQSQPRPVSLSVER  136

Query  482  TFE  490
              E
Sbjct  137  NGE  139



>gb|KFI24994.1| hypothetical protein CG51_16910 [Haematobacter missouriensis]
Length=296

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF++QGC+  P A+           +L E   ++ LA HVDYWDY GW D F  ++ 
Sbjct  72   VVELFTAQGCSACPPADAFLG-------ELAERSDVIALALHVDYWDYIGWADGFARAEA  124

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            T RQKTY        ++TP ++V  Q+Q +GND  A+   I++
Sbjct  125  TKRQKTYARVAGAKMIYTPQVIVGGQEQLIGNDFAAIGEIIRA  167



>gb|EPX76266.1| hypothetical protein that often co-occurs with aconitase [Salipiger 
mucosus DSM 16094]
Length=265

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 7/107 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+ + + LG+ D        ++ LA HVDYWDY GW D F 
Sbjct  56   DRPVVVELFTSQGCSSCPPADAILAELGQRD-------DVIPLALHVDYWDYIGWTDGFA  108

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
               +T RQK Y  S    +++TP MVV  +   VG+    V+ +I+ 
Sbjct  109  QPGFTKRQKGYARSAGRRSVYTPQMVVDGRYDVVGSRPMKVVEAIRH  155



>gb|KFI31758.1| hypothetical protein CN97_04835 [Haematobacter massiliensis]
Length=291

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF++QGC+  P A+           +L E   ++ LA HVDYWDY GW D F  ++ 
Sbjct  67   VVELFTAQGCSACPPADAFLG-------ELAERSDVIALALHVDYWDYIGWADGFARAEA  119

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            T RQKTY        ++TP ++V  Q+Q +GND  A+   I++
Sbjct  120  TKRQKTYARVAGAKMIYTPQVIVGGQEQLIGNDFAAIGEIIRA  162



>ref|WP_009814277.1| hypothetical protein [Roseovarius nubinhibens]
 gb|EAP75178.1| hypothetical protein ISM_11340 [Roseovarius nubinhibens ISM]
Length=214

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 62/109 (57%), Gaps = 10/109 (9%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+     L + D        ++ LA HVDYWDY GWKD F    
Sbjct  8    VVVELFTSQGCSSCPPADEYLHELAKRD-------DVIALALHVDYWDYIGWKDIFADPA  60

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN---DQDAVLTSIKSAP  454
            +T RQ+ Y +      ++TP M++  Q+  VGN   D  A++ + ++ P
Sbjct  61   YTARQRKYAKVAGRRMVYTPQMIINGQEDVVGNRPQDVQALIAAHQAKP  109



>gb|KGM47984.1| hypothetical protein ATO9_15425 [Oceanicola sp. 22II-S11g]
Length=223

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+   S L   D        ++ L FHVDYWDY GWKD F 
Sbjct  13   DRPVVVELFTSQGCSSCPPADAFLSVLAPRD-------DVIALGFHVDYWDYIGWKDVFA  65

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
               ++ RQ+ Y ++    +++TP M++      +GN
Sbjct  66   SRHFSERQRAYAKAAGRRSVYTPQMIISGTKDVIGN  101



>ref|WP_035348996.1| hypothetical protein, partial [Edaphobacter aggregans]
Length=181

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 77/151 (51%), Gaps = 4/151 (3%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PV+VELF+S+GC++ P A+ L + L +          +++L  HVDYWD TGW+D F  S
Sbjct  4    PVLVELFTSEGCSSCPPADKLLATLQKQQPVANAR--IIVLEEHVDYWDRTGWRDRFSSS  61

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
             +  RQ  Y   L+ D  +TP MVV    Q +G+D    + SI  A + P +    +  +
Sbjct  62   LFAERQNLYAPRLKFDDPYTPQMVVDGTAQFLGSDPSKAIASITQAAQSPKIPL--SLSQ  119

Query  494  PTPDTLEVSLTGTLRNKVDSNGVDIKVVLFE  586
            P  D   +S + +     D    D+  VL +
Sbjct  120  PAVDGKHISCSVSAATGSDLPRGDLYAVLVD  150



>ref|WP_038542233.1| hypothetical protein [Neorhizobium galegae]
 emb|CDN53669.1| Putative secreted protein [Neorhizobium galegae bv. officinalis 
bv. officinalis str. HAMBI 1141]
Length=233

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 60/105 (57%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A     +L R        P ++ L+F V YWDY GWKD FG  
Sbjct  31   PVVVELFTSQGCSSCPPANANLVKLSRD-------PAILALSFAVTYWDYLGWKDIFGRE  83

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            ++T RQ TY  +L   + FTP MV+  +   VG D   V + I +
Sbjct  84   EFTRRQATYEPALGQSSPFTPQMVINGRTSTVGQDLGEVRSLIAA  128



>ref|WP_035747153.1| hypothetical protein [Haematobacter missouriensis]
Length=225

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            +VELF++QGC+  P A+           +L E   ++ LA HVDYWDY GW D F  ++ 
Sbjct  1    MVELFTAQGCSACPPADAFLG-------ELAERSDVIALALHVDYWDYIGWADGFARAEA  53

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            T RQKTY        ++TP ++V  Q+Q +GND  A+   I++
Sbjct  54   TKRQKTYARVAGAKMIYTPQVIVGGQEQLIGNDFAAIGEIIRA  96



>ref|WP_035706811.1| hypothetical protein [Haematobacter massiliensis]
Length=225

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            +VELF++QGC+  P A+           +L E   ++ LA HVDYWDY GW D F  ++ 
Sbjct  1    MVELFTAQGCSACPPADAFLG-------ELAERSDVIALALHVDYWDYIGWADGFARAEA  53

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
            T RQKTY        ++TP ++V  Q+Q +GND  A+   I++
Sbjct  54   TKRQKTYARVAGAKMIYTPQVIVGGQEQLIGNDFAAIGEIIRA  96



>ref|WP_026355687.1| hypothetical protein [Pannonibacter phragmitetus]
Length=252

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 71/134 (53%), Gaps = 11/134 (8%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L         DL +   ++ L+  VDYWDY GWKD     
Sbjct  35   PVVVELFTSQGCSSCPPADKLLQ-------DLAKDASILALSLPVDYWDYLGWKDTLASP  87

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
            + + RQ+ Y       +++TP +V+   +  VG D+ AV  ++  A +       +    
Sbjct  88   ENSERQRLYSARRGDRSVYTPQIVINGGEHVVGGDEAAVGAALGRATKM----TASVLLH  143

Query  494  PTPDTLEVSLTGTL  535
             TPD LEV++ G L
Sbjct  144  STPDMLEVTIDGAL  157



>ref|WP_025061645.1| hypothetical protein [Sulfitobacter guttiformis]
Length=236

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 7/103 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+ +FS L   D        ++ +A HVDYWDY GWKD FG  
Sbjct  29   PVVVELYTSQGCSSCPPADEIFSELDDRD-------DVIAIALHVDYWDYIGWKDEFGQP  81

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
               VRQ+ Y      ++++TP M+V      VG    A+  +I
Sbjct  82   AHAVRQRAYAAKAGRNSIYTPEMIVNGTTDIVGAKPMALSKAI  124



>gb|ESW61370.1| hypothetical protein Q27BPR15_06745 [Rhodobacter sp. CACIA14H1]
Length=248

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 60/103 (58%), Gaps = 7/103 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVEL++SQGC++ P A+   + L     D+      + LA HVDYWDY GW D F   
Sbjct  41   PVVVELYTSQGCSSCPPADEFLAELA-AHRDV------IALALHVDYWDYIGWADSFAQP  93

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
             +T RQK Y  +++   ++TP M++   D+  GN  DAV+  I
Sbjct  94   AFTERQKRYARAVKSRMIYTPQMIIGGLDRVEGNTPDAVVKLI  136



>gb|KGK80878.1| hypothetical protein PM03_02840 [Thalassobacter stenotrophicus]
Length=231

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   LGR +        ++ LA HVDYWDY GW D F   
Sbjct  22   PVVVELFTSQGCSSCPPADALLGELGRNE-------DVIALALHVDYWDYIGWPDTFAQP  74

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
             +  RQK Y  +     ++TP MVV   D   G     V+  I +
Sbjct  75   AFGKRQKGYARAAGSTVVYTPHMVVGGTDHVAGAKPMQVMEQIAA  119



>ref|WP_015494449.1| hypothetical protein [Octadecabacter arcticus]
 ref|YP_007698694.1| hypothetical protein OA238_c10390 [Octadecabacter arcticus 238]
 gb|AGI71235.1| hypothetical protein OA238_c10390 [Octadecabacter arcticus 238]
Length=234

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 9/97 (9%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEA-ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            DGPVVVEL++SQGC++ P A E+L     R D        ++ LA HVDYWDY GW D F
Sbjct  25   DGPVVVELYTSQGCSSCPPADEMLHVLAARSD--------VIALALHVDYWDYIGWADSF  76

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
               + TVRQ+ Y       +++TP M++   D  VG 
Sbjct  77   ADPEHTVRQQRYAYVAGASSIYTPQMIIGGADHVVGT  113



>ref|WP_035261428.1| hypothetical protein [Actibacterium mucosum]
 gb|KAJ54577.1| hypothetical protein ACMU_17885 [Actibacterium mucosum KCTC 23349]
Length=231

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 9/93 (10%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEA-ELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            +VVELF+SQGC++ P A EL+    GR D        +V LA HVDYWDY GWKD F   
Sbjct  27   IVVELFTSQGCSSCPPADELMVELAGRND--------VVALALHVDYWDYIGWKDEFADP  78

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
             +T RQK Y  +    +++TP  VVQ  D  VG
Sbjct  79   AYTQRQKLYARAAGSRSIYTPQFVVQGVDHVVG  111



>ref|WP_026595430.1| hypothetical protein [Methyloferula stellata]
Length=245

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 58/101 (57%), Gaps = 7/101 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ L S + R        P L+ ++F VDYWDY GWKD      +
Sbjct  30   VVELFTSQGCSSCPPADRLVSAMARN-------PGLIAVSFPVDYWDYIGWKDTLASPHF  82

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
            T RQK Y        ++TP +VV  +   VG+D+D V  +I
Sbjct  83   TARQKAYASVRGDGHVYTPQIVVDGRSDVVGSDEDGVKEAI  123



>ref|WP_038005220.1| MULTISPECIES: hypothetical protein [Thalassobacter]
 gb|KGL02262.1| hypothetical protein PM04_06860 [Thalassobacter sp. 16PALIMAR09]
Length=233

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L   LGR +        ++ LA HVDYWDY GW D F   
Sbjct  24   PVVVELFTSQGCSSCPPADALLGELGRNE-------DVIALALHVDYWDYIGWPDTFAQP  76

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
             +  RQK Y  +     ++TP MVV   D   G     V+  I +
Sbjct  77   AFGKRQKGYARAAGSTVVYTPHMVVGGTDHVAGAKPMQVMEQIAA  121



>ref|WP_014283173.1| hypothetical protein [Pseudovibrio sp. FO-BEG1]
 ref|YP_005078741.1| hypothetical protein PSE_0207 [Pseudovibrio sp. FO-BEG1]
 gb|AEV34719.1| protein containing DUF1223 [Pseudovibrio sp. FO-BEG1]
Length=239

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%), Gaps = 10/133 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+     L      + +   +V L++HVDYWDY GWKD  G   +
Sbjct  26   VVELFTSQGCSSCPPADQFLEEL------VADQKDVVTLSYHVDYWDYFGWKDTLGSPVF  79

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPT  499
            T RQK Y +S     ++TP +VV  +   VG+D+ +V  +I+ +     +  +A  +   
Sbjct  80   TQRQKDYAKSRGDAQIYTPQVVVNGRGHMVGSDRRSVKNAIRKSSGM-TVQVEAMLDD--  136

Query  500  PDTLEVSLTGTLR  538
               LEV L+G+L+
Sbjct  137  -SALEVQLSGSLK  148



>ref|WP_036386721.1| hypothetical protein, partial [Muricauda sp. MAR_2010_75]
Length=175

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 58/103 (56%), Gaps = 7/103 (7%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVL-LAFHVDYWDYTGWKDPFGCS  313
            VV+ELF+SQGC++ P A+ L  ++ +      E P  V  L++HVDYWDY GWKDPF   
Sbjct  10   VVLELFTSQGCSSCPSADRLLEKVKK------EFPETVFALSYHVDYWDYIGWKDPFAKP  63

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
             +  +Q  Y         +TP MVV  ++  VG++Q    + I
Sbjct  64   GYAKKQSEYNREFGYPNNYTPQMVVNGREHFVGSNQAKAYSKI  106



>ref|WP_035099101.1| hypothetical protein [Devosia sp. LC5]
 gb|KFC68625.1| Hypothetical protein precursor [Devosia sp. LC5]
Length=244

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 11/116 (9%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGR-GDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVELF+SQGCA  P A+ L + L   GD        ++ LA+HVDYWDY GW+D FG + 
Sbjct  35   VVELFTSQGCAQCPPADALLTSLAEEGD--------VIALAYHVDYWDYVGWEDTFGQAD  86

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQAT  484
            ++ RQ+ Y +S     ++TP MVV      VG+ ++ V  ++ +A    PLS   T
Sbjct  87   YSDRQRAYAKSWGSSRIYTPQMVVNGDKGVVGSRRNEVHGALDAATL--PLSVDIT  140



>ref|WP_012178522.1| hypothetical protein [Dinoroseobacter shibae]
 ref|YP_001533193.1| hypothetical protein Dshi_1850 [Dinoroseobacter shibae DFL 12 
= DSM 16493]
 gb|ABV93592.1| hypothetical protein DUF1223 [Dinoroseobacter shibae DFL 12 = 
DSM 16493]
Length=234

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+ L +       +L++   ++ LA HVDYWDY GWKD F   +
Sbjct  29   VVVELFTSQGCSSCPPADALLA-------ELDKSADVIALALHVDYWDYIGWKDSFADPE  81

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
             T RQ+ Y  + +  ++FTP MV+   D  +G
Sbjct  82   NTERQRGYARAAKARSIFTPQMVIGGVDHVIG  113



>ref|WP_037269199.1| hypothetical protein [Roseovarius mucosus]
 gb|KGM87013.1| putative secreted protein [Roseovarius mucosus DSM 17069]
Length=234

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            ++ PVVVELF+SQGC++ P A+  F        DL     +V L+ HVDYWDY GW+D F
Sbjct  23   QERPVVVELFTSQGCSSCPPADAYFQ-------DLAARKDVVALSLHVDYWDYIGWEDSF  75

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
            G    + RQ+ Y ++ +   ++TP M++   D  VG 
Sbjct  76   GSPDNSARQRGYAKAAERKMVYTPQMIINGADHVVGT  112



>ref|WP_008227708.1| hypothetical protein [Roseobacter sp. GAI101]
 gb|EEB85157.1| conserved hypothetical protein [Roseobacter sp. GAI101]
Length=232

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 60/106 (57%), Gaps = 7/106 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            +D PVVVELF+SQGC++ P A+ + + L + D        ++ LA HVDYWDY GWKD F
Sbjct  22   QDRPVVVELFTSQGCSSCPPADKILAELAQRD-------DVIALALHVDYWDYIGWKDRF  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
            G      RQ+ Y  +    +++TP M+V      VG    A+  +I
Sbjct  75   GDPNHAARQRAYAVASGRKSVYTPEMIVNGHTDVVGAKPMALSKAI  120



>ref|WP_024351881.1| hypothetical protein [Aurantimonas coralicida]
Length=258

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 7/105 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ + SRL      +E  P ++ LA+HVDYWDY GW+D  G S+ 
Sbjct  35   VVELFTSQGCSSCPPADRILSRLA-----VE--PGILALAYHVDYWDYIGWRDTHGSSEN  87

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAP  454
            T RQ+ Y  +    T++TP +VV      +G+ +  V   +   P
Sbjct  88   TERQRAYAAAFGTTTIYTPQVVVNGVADAIGSHEGKVRALMDDHP  132



>ref|WP_009808550.1| hypothetical protein [Roseobacter sp. MED193]
 gb|EAQ45184.1| hypothetical protein MED193_05121 [Roseobacter sp. MED193]
Length=239

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 59/105 (56%), Gaps = 7/105 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L  +L        + P ++ LA HVDYWDY GWKD F   
Sbjct  31   PVVVELFTSQGCSSCPPADALLKQLA-------QRPDVIALALHVDYWDYIGWKDIFASP  83

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKS  448
              T RQK Y +      ++TP M+V  Q    G+D   +  +I +
Sbjct  84   FNTNRQKGYAQVAGRKMIYTPQMIVMGQQDVSGSDAMGLAKAISA  128



>ref|WP_034837103.1| hypothetical protein [Inquilinus limosus]
 gb|KGM33874.1| hypothetical protein P409_13455 [Inquilinus limosus MP06]
Length=226

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L S        L + P ++ LAFHVDYW+  GW DPF   
Sbjct  26   PVVVELFTSQGCSSCPPADALLS-------TLADRPEVLALAFHVDYWNRLGWTDPFSGP  78

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQ  421
              T RQ  Y   L  D ++TP  V+  +   VG+D+
Sbjct  79   WATARQTAYAAQLGSDQVYTPQAVIDGRGDVVGSDR  114



>ref|WP_035238144.1| hypothetical protein, partial [Acidobacteriaceae bacterium URHE0068]
Length=201

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 67/108 (62%), Gaps = 6/108 (6%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVP--PLVLLAFHVDYWDYTGWKDPFG  307
            PV+VELF+S+GC+  P A+ L +RL       + +P   +V+L+ HV YW++ GW DPF 
Sbjct  36   PVLVELFTSEGCSDCPPADDLLARLEHD----QPIPGVHVVVLSEHVTYWNHQGWADPFS  91

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
              Q   RQ+ Y E  +L  ++TP MVV   +Q VG++ +A+ T++  A
Sbjct  92   MEQMDYRQRDYQEHFRLGDVYTPQMVVDGAEQFVGSNVNALNTAMTHA  139



>ref|WP_035084865.1| hypothetical protein [Devosia riboflavina]
 gb|KFL30202.1| hypothetical protein JP75_16575 [Devosia riboflavina]
Length=245

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (55%), Gaps = 12/128 (9%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGCA+ P A+ L + L        E   +V LAFHVDYWDY GWKD F    +
Sbjct  35   VVELFTSQGCASCPPADALLTALA-------EREDVVALAFHVDYWDYVGWKDTFAQEAF  87

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPT  499
            + RQ+ Y +S     ++TP +VV      VG+ ++ V  ++  A    PL+   T     
Sbjct  88   SDRQRAYAKSWGSSRIYTPQVVVNGAKAVVGSRRNEVQQAVDRASL--PLAMDLTLNG--  143

Query  500  PDTLEVSL  523
             D L++S+
Sbjct  144  -DMLKISV  150



>ref|WP_008550708.1| hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA93983.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
Length=247

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%), Gaps = 10/133 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+     L      + +   +V L++HVDYWDY GWKD  G   +
Sbjct  34   VVELFTSQGCSSCPPADQFLEEL------VADQKDVVTLSYHVDYWDYFGWKDTLGSPVF  87

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEKPT  499
            T RQK Y +S     ++TP +VV  +   VG+D+ +V  +I+ +     +  +A  +   
Sbjct  88   TQRQKDYAKSRGDAQIYTPQVVVNGRGHMVGSDRRSVKNAIRKSSGM-TVQVEAMLDD--  144

Query  500  PDTLEVSLTGTLR  538
               LEV L+G+L+
Sbjct  145  -SALEVQLSGSLK  156



>ref|WP_011907522.1| hypothetical protein [Rhodobacter sphaeroides]
 ref|YP_001166676.1| hypothetical protein Rsph17025_0465 [Rhodobacter sphaeroides 
ATCC 17025]
 gb|ABP69371.1| protein of unknown function DUF1223 [Rhodobacter sphaeroides 
ATCC 17025]
Length=235

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 7/102 (7%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+   + L          P L+ LA HVDYWDY GW+D F   +
Sbjct  29   VVVELFTSQGCSSCPPADAFLAALASD-------PRLIPLALHVDYWDYIGWEDQFADPR  81

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
            +T RQK+Y  ++   T++TP M+V   D+  GN  + V   I
Sbjct  82   FTQRQKSYARAVGSRTIYTPQMIVGGVDRVEGNAPEKVAALI  123



>ref|WP_020602772.1| hypothetical protein [Spirosoma spitsbergense]
Length=255

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (52%), Gaps = 13/143 (9%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPP----LVLLAFHVDYWDYTGWKDPFG  307
            VVELF+S+GC++ P A+ L +        + E       ++ L+FHVDYWD  GWKDPF 
Sbjct  37   VVELFTSEGCSSCPAADHLLTE------TITEAAKTNRNIIGLSFHVDYWDRLGWKDPFS  90

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPP-LSFQAT  484
               +T RQ  Y E   L+  +TP  VV  Q + VG+++    + + SA   P   S Q T
Sbjct  91   NHAFTQRQYQYGEYFGLNGAYTPQEVVNGQQEFVGSNRAKQSSGLASALSHPATASVQLT  150

Query  485  FEKPTPDTLEVS--LTGTLRNKV  547
               P+  T  V+  L G L N V
Sbjct  151  IAAPSTTTRTVTYQLDGELTNAV  173



>ref|WP_005626489.1| hypothetical protein [Ruegeria mobilis]
 gb|ENZ90844.1| hypothetical protein K529_13451 [Ruegeria mobilis F1926]
Length=235

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ L  RL     + E++ PL   AFHVDYWDY GW D F   
Sbjct  27   PVVVELFTSQGCSSCPPADELVKRLS----EREDILPL---AFHVDYWDYIGWADIFADP  79

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND  418
             +T RQ+ Y +    + ++TP M+V  ++  VG D
Sbjct  80   AYTDRQRGYAQVGGRNMIYTPQMIVMGREDVVGAD  114



>ref|WP_008597248.1| hypothetical protein [Nitratireductor pacificus]
 gb|EKF18675.1| hypothetical protein NA2_12284 [Nitratireductor pacificus pht-3B]
Length=263

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 9/102 (9%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGR-GDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVELF+SQGC++ P A+ + + L R GD        +V LA+HVDYWDY GW+D  G  +
Sbjct  41   VVELFTSQGCSSCPPADAVLADLARSGD--------VVALAYHVDYWDYLGWRDALGSPE  92

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSI  442
             T RQ+ Y ++L   +++TP  +V  Q    G  +D + +++
Sbjct  93   NTARQRAYAQALDNTSIYTPQAIVNGQRDMNGARRDRIWSAL  134



>ref|WP_039372559.1| hypothetical protein [Chryseobacterium taiwanense]
 gb|KIC61377.1| hypothetical protein RM51_17315 [Chryseobacterium taiwanense]
Length=259

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 67/105 (64%), Gaps = 5/105 (5%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
             V+ELF+S+GC++ P A+ L   +     D     P+ +L++HVDYW+  GWKD F  ++
Sbjct  45   AVLELFTSEGCSSCPPADKLMGEIEEKYKD----QPVYILSYHVDYWNNLGWKDKFSSAE  100

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
             + RQ+ Y ++L    ++TP ++V  + + VG+DQ+AV  SI++A
Sbjct  101  NSRRQQQYAQTLH-SQVYTPQLIVNGKKEFVGSDQEAVENSIQTA  144



>gb|EDM30647.1| hypothetical protein RTM1035_11580 [Roseovarius sp. TM1035]
Length=217

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+  F        DL     ++ L+ HVDYWDY GW+D FG
Sbjct  7    DHPVVVELFTSQGCSSCPPADAYF-------LDLVTRDDVIALSLHVDYWDYIGWEDSFG  59

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
                + RQ+ Y ++     ++TP M++   D  VG 
Sbjct  60   SPHNSNRQRGYAQASGRTMVYTPQMIINGADHVVGT  95



>ref|WP_025052568.1| hypothetical protein [Sulfitobacter sp. NB-68]
Length=232

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 9/97 (9%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRL-GRGDFDLEEVPPLVLLAFHVDYWDYTGWKDP  301
            ++ PVVVEL++SQGC++ P A+ +   L GR D        ++ LA HVDYWDY GWKD 
Sbjct  22   QNTPVVVELYTSQGCSSCPAADAIMHELAGRED--------VIALALHVDYWDYIGWKDV  73

Query  302  FGCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
            F       RQ+ Y  S    +++TP M+VQ     VG
Sbjct  74   FADPAHAARQRAYAASGNRRSIYTPEMIVQGSTDIVG  110



>ref|WP_037298533.1| hypothetical protein [Roseovarius sp. TM1035]
Length=234

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  128  DGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFG  307
            D PVVVELF+SQGC++ P A+  F        DL     ++ L+ HVDYWDY GW+D FG
Sbjct  24   DHPVVVELFTSQGCSSCPPADAYF-------LDLVTRDDVIALSLHVDYWDYIGWEDSFG  76

Query  308  CSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGN  415
                + RQ+ Y ++     ++TP M++   D  VG 
Sbjct  77   SPHNSNRQRGYAQASGRTMVYTPQMIINGADHVVGT  112



>ref|WP_027381749.1| hypothetical protein [Chryseobacterium daeguense]
Length=257

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 70/109 (64%), Gaps = 5/109 (5%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
             +G  V+ELF+S+GC++ P A+ L   + +   D     P+ +LA+HVDYW+  GWKD F
Sbjct  39   NNGFAVLELFTSEGCSSCPPADQLMGEIEKKYQD----QPVYILAYHVDYWNSLGWKDKF  94

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSA  451
               + ++RQ+ Y   LQ   ++TP ++V  +++ VG+D++AV  +I++A
Sbjct  95   SRPENSLRQQQYSRILQ-SQVYTPQLIVNGKEEFVGSDRNAVENAIQNA  142



>ref|WP_008560466.1| hypothetical protein [Ruegeria sp. R11]
 gb|EEB70749.1| conserved hypothetical protein [Ruegeria sp. R11]
Length=243

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            VVVELF+SQGC++ P A+ L  +L   D    +V PL   A HVDYWDY GWKD F    
Sbjct  31   VVVELFTSQGCSSCPPADALLHQLTARD----DVLPL---ALHVDYWDYIGWKDQFASPA  83

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGND  418
             T+RQK Y +      ++TP M++  QD  VG +
Sbjct  84   HTLRQKGYAQIGGRQMVYTPQMIINGQDDVVGAN  117



>ref|WP_011582668.1| hypothetical protein [Chelativorans sp. BNC1]
 ref|YP_675892.1| hypothetical protein Meso_3356 [Chelativorans sp. BNC1]
 gb|ABG64727.1| protein of unknown function DUF1223 [Chelativorans sp. BNC1]
Length=252

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 8/105 (8%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC+  P A+ LF+       +L E   ++ L++H+DYWDY GW D F   + 
Sbjct  36   VVELFTSQGCSRCPPADALFA-------ELAERNDIIALSYHIDYWDYLGWDDQFATPEN  88

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAP  454
            T RQ+ Y E L    ++TP +VV      VG D++A+  +++S+P
Sbjct  89   TDRQRAYGEVLGTG-VYTPQIVVNGHIDVVGADRNALSQALRSSP  132



>ref|WP_036355554.1| hypothetical protein [Microvirga lupini]
Length=245

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 7/102 (7%)
 Frame = +2

Query  140  VVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQW  319
            VVELF+SQGC++ P A+ L     R        P ++ L+  V+YWDY GWKD      +
Sbjct  29   VVELFTSQGCSSCPPADELLVEYSRQ-------PDIIALSLPVNYWDYLGWKDTLAHVAF  81

Query  320  TVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIK  445
            T RQK Y  S +   +FTP M+V  +  C+G+D+D +  +I+
Sbjct  82   TERQKAYAHSRKDRQVFTPQMIVNGKKSCIGSDRDQIEKAIQ  123



>ref|WP_036744864.1| hypothetical protein, partial [Paracoccus sp. N5]
Length=223

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 74/138 (54%), Gaps = 7/138 (5%)
 Frame = +2

Query  134  PVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCS  313
            PVVVELF+SQGC++ P A+ +         DL +   ++ L++HVDYWDY GW D F   
Sbjct  1    PVVVELFTSQGCSSCPPADEMLG-------DLADRDDVLALSWHVDYWDYLGWADEFARP  53

Query  314  QWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVGNDQDAVLTSIKSAPRFPPLSFQATFEK  493
            ++T RQ+ Y        ++TP M+V   D  +      ++  ++     PP+   ++ ++
Sbjct  54   EFTRRQQAYAHQSGERAIYTPQMIVGGSDTLIALRPAELMGLVQGQMARPPMVMVSSSQQ  113

Query  494  PTPDTLEVSLTGTLRNKV  547
                 +E++  G +R++V
Sbjct  114  AEGYRIELTPRGAIRDRV  131



>ref|WP_039536311.1| hypothetical protein [Ruegeria sp. ANG-R]
 gb|KIC43105.1| hypothetical protein RA27_07290 [Ruegeria sp. ANG-R]
Length=233

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +2

Query  125  RDGPVVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPF  304
            ++ PVVVELF+SQGC++ P A+ +   L + D        ++ LA HVDYWDY GWKD +
Sbjct  22   QEDPVVVELFTSQGCSSCPPADRIMHELAKRD-------DVIGLALHVDYWDYIGWKDEY  74

Query  305  GCSQWTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
                 T+RQ+ Y        ++TP MVV  Q   VG
Sbjct  75   ADPDHTLRQRAYAREGGRSMIYTPQMVVNGQQDVVG  110



>ref|WP_008329322.1| hypothetical protein [Maritimibacter alkaliphilus]
 gb|EAQ11045.1| hypothetical protein RB2654_05155 [Rhodobacterales bacterium 
HTCC2654]
Length=236

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = +2

Query  137  VVVELFSSQGCATSPEAELLFSRLGRGDFDLEEVPPLVLLAFHVDYWDYTGWKDPFGCSQ  316
            V++ELF+SQGC + P A+ L + L   D    +V PL   A HVDYWDY GWKD F   +
Sbjct  28   VLIELFTSQGCNSCPPADALLAELAVRD----DVLPL---ALHVDYWDYIGWKDKFARPE  80

Query  317  WTVRQKTYVESLQLDTMFTPLMVVQSQDQCVG  412
             T RQK Y       T++TP MVV   D  VG
Sbjct  81   HTARQKAYAHVAGASTIYTPQMVVGGTDHVVG  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 729814547172