BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4902_g1_i1 len=331 path=[490:0-258 749:259-282 749:283-306
749:307-330]

Length=331
                                                                      Score     E

ref|XP_009783945.1|  PREDICTED: uncharacterized protein LOC104232429  63.2    4e-10   
emb|CDP06149.1|  unnamed protein product                              62.0    1e-09   
ref|XP_006447867.1|  hypothetical protein CICLE_v10017001mg           56.2    1e-07   
ref|XP_008794762.1|  PREDICTED: uncharacterized protein LOC103710688  55.5    2e-07   
ref|XP_006469401.1|  PREDICTED: uncharacterized protein LOC102626...  55.5    2e-07   
ref|XP_011098097.1|  PREDICTED: uncharacterized protein LOC105176861  55.1    2e-07   
ref|XP_006469400.1|  PREDICTED: uncharacterized protein LOC102626...  55.1    2e-07   
ref|XP_006348967.1|  PREDICTED: uncharacterized protein LOC102605417  53.9    6e-07   
ref|XP_004243215.1|  PREDICTED: uncharacterized protein LOC101251005  53.5    8e-07   
ref|XP_010246562.1|  PREDICTED: uncharacterized protein LOC104589819  53.1    1e-06   
ref|XP_011009814.1|  PREDICTED: uncharacterized protein LOC105114819  53.1    1e-06   
dbj|BAD17465.1|  hypothetical protein                                 52.8    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006375589.1|  hypothetical protein POPTR_0014s16960g           52.4    2e-06   
ref|XP_007049439.1|  Heavy metal transport/detoxification superfa...  52.4    2e-06   
ref|XP_011012621.1|  PREDICTED: uncharacterized protein LOC105116833  50.8    7e-06   
ref|XP_002320539.2|  heavy-metal-associated domain-containing fam...  50.8    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011012623.1|  PREDICTED: uncharacterized protein LOC105116834  50.8    8e-06   
ref|XP_004979957.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    8e-06   
ref|XP_004979953.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    9e-06   
ref|XP_004979958.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    9e-06   
ref|XP_002263660.1|  PREDICTED: uncharacterized protein LOC100258045  50.4    9e-06   Vitis vinifera
ref|XP_004979954.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    9e-06   
ref|XP_004979956.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    9e-06   
ref|XP_004979955.1|  PREDICTED: uncharacterized protein LOC101785...  53.5    9e-06   
emb|CDP08855.1|  unnamed protein product                              50.4    1e-05   
ref|XP_009625093.1|  PREDICTED: uncharacterized protein LOC104116027  50.4    1e-05   
gb|KDP22993.1|  hypothetical protein JCGZ_01715                       50.1    1e-05   
ref|XP_010036113.1|  PREDICTED: uncharacterized protein LOC104425192  50.1    1e-05   
gb|KCW47636.1|  hypothetical protein EUGRSUZ_K01379                   49.7    1e-05   
ref|XP_002268731.1|  PREDICTED: uncharacterized protein LOC100255094  49.7    2e-05   Vitis vinifera
gb|AES71738.2|  metal ion-binding protein, putative                   49.3    2e-05   
ref|XP_003601487.1|  hypothetical protein MTR_3g082210                49.3    2e-05   
ref|XP_002313367.2|  hypothetical protein POPTR_0009s05280g           49.3    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010038750.1|  PREDICTED: uncharacterized protein LOC104427343  49.3    2e-05   
ref|XP_006387353.1|  hypothetical protein POPTR_1183s00200g           49.3    2e-05   
gb|KDP22996.1|  hypothetical protein JCGZ_01718                       48.9    3e-05   
ref|XP_003601491.1|  ATFP4-like protein                               48.5    4e-05   
ref|NP_001152411.1|  ATFP4                                            48.5    5e-05   Zea mays [maize]
gb|AFW72061.1|  ATFP4                                                 48.5    5e-05   
ref|XP_009796820.1|  PREDICTED: uncharacterized protein LOC104243343  48.1    5e-05   
ref|XP_003575245.1|  PREDICTED: uncharacterized protein LOC100845716  48.1    6e-05   
gb|KDP22991.1|  hypothetical protein JCGZ_01713                       48.1    6e-05   
ref|XP_009793872.1|  PREDICTED: uncharacterized protein LOC104240694  48.1    7e-05   
ref|XP_010542497.1|  PREDICTED: uncharacterized protein LOC104815685  48.1    7e-05   
gb|KDP22994.1|  hypothetical protein JCGZ_01716                       47.8    8e-05   
ref|XP_009625092.1|  PREDICTED: uncharacterized protein LOC104116026  47.8    8e-05   
ref|XP_009796821.1|  PREDICTED: uncharacterized protein LOC104243344  47.8    8e-05   
ref|XP_006447868.1|  hypothetical protein CICLE_v10018068mg           47.4    1e-04   
ref|XP_010038748.1|  PREDICTED: uncharacterized protein LOC104427341  47.4    1e-04   
ref|XP_010241736.1|  PREDICTED: uncharacterized protein LOC104586261  47.0    1e-04   
ref|XP_010036115.1|  PREDICTED: uncharacterized protein LOC104425195  47.4    1e-04   
ref|XP_006469399.1|  PREDICTED: uncharacterized protein LOC102626447  47.4    1e-04   
gb|EYU41174.1|  hypothetical protein MIMGU_mgv1a016413mg              47.0    1e-04   
gb|EYU33985.1|  hypothetical protein MIMGU_mgv1a016390mg              47.0    1e-04   
gb|KDO42092.1|  hypothetical protein CISIN_1g033335mg                 47.0    1e-04   
ref|XP_004952921.1|  PREDICTED: uncharacterized protein LOC101786...  47.0    1e-04   
ref|XP_011032086.1|  PREDICTED: uncharacterized protein LOC105131...  47.0    2e-04   
ref|XP_002266819.2|  PREDICTED: uncharacterized protein LOC100242530  47.0    2e-04   Vitis vinifera
ref|XP_009625095.1|  PREDICTED: uncharacterized protein LOC104116030  47.0    2e-04   
ref|XP_009591620.1|  PREDICTED: uncharacterized protein LOC104088617  46.2    2e-04   
ref|XP_010036116.1|  PREDICTED: uncharacterized protein LOC104425196  46.6    2e-04   
gb|KCW47638.1|  hypothetical protein EUGRSUZ_K01380                   46.6    2e-04   
ref|XP_011032087.1|  PREDICTED: uncharacterized protein LOC105131...  46.6    2e-04   
ref|XP_009419205.1|  PREDICTED: uncharacterized protein LOC103999...  46.6    2e-04   
ref|XP_009391790.1|  PREDICTED: uncharacterized protein LOC103977867  46.6    2e-04   
ref|XP_009419204.1|  PREDICTED: uncharacterized protein LOC103999...  46.6    2e-04   
gb|KHF99125.1|  Fimbrial                                              46.2    2e-04   
ref|XP_011091863.1|  PREDICTED: uncharacterized protein LOC105172...  46.2    2e-04   
ref|XP_011091871.1|  PREDICTED: uncharacterized protein LOC105172...  46.2    3e-04   
ref|XP_004952920.1|  PREDICTED: uncharacterized protein LOC101786...  47.0    3e-04   
ref|XP_002454080.1|  hypothetical protein SORBIDRAFT_04g024270        46.2    3e-04   Sorghum bicolor [broomcorn]
ref|XP_006348966.1|  PREDICTED: uncharacterized protein LOC102605080  45.8    3e-04   
ref|XP_006349960.1|  PREDICTED: uncharacterized protein LOC102599063  46.2    4e-04   
gb|EYU34048.1|  hypothetical protein MIMGU_mgv1a020264mg              45.8    4e-04   
ref|XP_004243216.1|  PREDICTED: uncharacterized protein LOC101251303  45.8    4e-04   
ref|XP_003635014.1|  PREDICTED: uncharacterized protein LOC100853035  45.8    4e-04   
gb|KCW47632.1|  hypothetical protein EUGRSUZ_K01374                   45.4    4e-04   
emb|CBI28485.3|  unnamed protein product                              47.0    5e-04   
ref|XP_010942541.1|  PREDICTED: uncharacterized protein LOC105060501  45.4    5e-04   
ref|NP_001053015.1|  Os04g0464100                                     45.4    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006348965.1|  PREDICTED: uncharacterized protein LOC102604739  45.4    5e-04   
gb|AES60176.2|  metal ion-binding protein, putative                   45.1    5e-04   
ref|XP_007020387.1|  Heavy metal transport/detoxification superfa...  45.4    5e-04   
dbj|BAK39930.1|  NBS-LRR type protein                                 48.1    6e-04   
emb|CAD41036.1|  OSJNBa0060P14.7                                      45.1    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010253026.1|  PREDICTED: glutelin type-A 1-like                47.4    6e-04   
ref|XP_003589925.1|  ATFP4-like protein                               45.1    7e-04   
ref|XP_003594348.1|  hypothetical protein MTR_2g027600                44.3    8e-04   
gb|KEH15709.1|  heavy metal transport/detoxification superfamily ...  44.3    8e-04   
ref|XP_002533038.1|  metal ion binding protein, putative              44.7    0.001   Ricinus communis
ref|XP_003577912.1|  PREDICTED: uncharacterized protein LOC100824...  45.1    0.001   
ref|XP_006583442.1|  PREDICTED: uncharacterized protein LOC100812612  44.7    0.001   
gb|EMT17916.1|  hypothetical protein F775_42527                       44.7    0.001   



>ref|XP_009783945.1| PREDICTED: uncharacterized protein LOC104232429 [Nicotiana sylvestris]
Length=149

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +2

Query  11   MLKAMLPFECVSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVE  187
             LK     +C    ++ S  +N+SK + IA     V   A+EG+ K+EL+V G  ID  E
Sbjct  26   FLKLKYLAKCWGNNYQDSRSKNQSKVLLIAAKIPGVEKVAIEGEEKNELMVIGEEIDAAE  85

Query  188  LVTVLRDKVGGAHIKSVGPADD  253
            LVT+LR KVG A+I S+GP DD
Sbjct  86   LVTILRKKVGFANIVSIGPVDD  107



>emb|CDP06149.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +2

Query  5    VGMLKAMLPFECVSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG--RID  178
            + ++KAM+P E +    K SA +NK KAMQI      V S AL+G+ K++LVV G    D
Sbjct  63   IQVMKAMMPCELLWNQLKPSAAKNKIKAMQIVARTRGVASIALDGEEKNQLVVSGDDDFD  122

Query  179  PVELVTVLRDKVGGAHIKSV  238
            PV+L T+LR  +G A+I SV
Sbjct  123  PVKLATLLRRHLGIANIVSV  142



>ref|XP_006447867.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
 gb|ESR61107.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
Length=164

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +++SKA++IAVG   V SA+L+GD K ++ V G  +DPV L ++LR KVG A + SVGPA
Sbjct  55   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSVGPA  114



>ref|XP_008794762.1| PREDICTED: uncharacterized protein LOC103710688 [Phoenix dactylifera]
Length=111

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            + +SKA++  VGF+ + SA+L+G  KD++VV G  IDPV LV  LR ++  A + SV PA
Sbjct  16   KQRSKALKTVVGFNGITSASLDGKEKDQIVVVGDGIDPVTLVKKLRKRMNYAELLSVAPA  75

Query  248  DD  253
            D+
Sbjct  76   DE  77



>ref|XP_006469401.1| PREDICTED: uncharacterized protein LOC102626749 isoform X2 [Citrus 
sinensis]
Length=124

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +++SKA++IAVG   V SA+L+GD K ++ V G  +DPV L ++LR KVG A + SVGPA
Sbjct  15   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSVGPA  74



>ref|XP_011098097.1| PREDICTED: uncharacterized protein LOC105176861 [Sesamum indicum]
Length=111

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +2

Query  5    VGMLKAMLPFECVSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDP  181
            + +LK M+P++ + K    S  +  +KAM+IAV    V S AL G+ K++LVV G  +D 
Sbjct  26   IYVLKLMMPYDIIWKKSSISTAKITTKAMKIAVTSPGVASVALTGEEKNQLVVTGEGVDA  85

Query  182  VELVTVLRDKVGGAHIKSVGP  244
            V L  V+R  +G A + SV P
Sbjct  86   VNLTRVIRQNIGFAVLLSVEP  106



>ref|XP_006469400.1| PREDICTED: uncharacterized protein LOC102626749 isoform X1 [Citrus 
sinensis]
Length=145

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +++SKA++IAVG   V SA+L+GD K ++ V G  +DPV L ++LR KVG A + SVGPA
Sbjct  36   KSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKKVGYAELVSVGPA  95



>ref|XP_006348967.1| PREDICTED: uncharacterized protein LOC102605417 [Solanum tuberosum]
Length=131

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++KA +IAV    V SAA+ GDGK++L V G +D V L+ +LR  +G A + SVGPA
Sbjct  19   RTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAVALMMLLRKNLGQADLVSVGPA  75



>ref|XP_004243215.1| PREDICTED: uncharacterized protein LOC101251005 [Solanum lycopersicum]
Length=129

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +2

Query  50   PFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHI  229
                +  ++++KA +IAV    V SAA+ GDGK++L V G +D   L ++LR  +G A +
Sbjct  10   SLNGNGQKDRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLRKNLGQADL  69

Query  230  KSVGPA  247
             SVGPA
Sbjct  70   VSVGPA  75



>ref|XP_010246562.1| PREDICTED: uncharacterized protein LOC104589819 [Nelumbo nucifera]
Length=116

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +2

Query  65   APENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            + +++SKAM+  VG   V +AAL+GD K+++ V G  ID +EL T LR K G A + +VG
Sbjct  14   SAKDRSKAMRTVVGVSGVETAALQGDDKNQIAVIGEGIDSIELTTSLRKKFGYADLLTVG  73

Query  242  P  244
            P
Sbjct  74   P  74



>ref|XP_011009814.1| PREDICTED: uncharacterized protein LOC105114819 [Populus euphratica]
Length=121

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S P+++SK++QIAVGF  V SA L G  K ++ V G  +D VEL   LR KVG A I SV
Sbjct  12   SGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAEIVSV  71



>dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group]
Length=119

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            +SKAM +      V+S AL GDGKD+LVV G  +D +EL T LR KVG A + +VG
Sbjct  18   RSKAMALVASTTGVDSVALAGDGKDQLVVVGDGVDSIELTTALRKKVGHATLMTVG  73



>ref|XP_006375589.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
 gb|ERP53386.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
Length=121

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            + P+++SK++QIAVGF  V SA L G  K ++ V G  +D VEL   LR KVG A I SV
Sbjct  12   NGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGHGVDAVELTNCLRKKVGYAEIVSV  71



>ref|XP_007049439.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOX93596.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +++SKA++IAVG   V SA+L+GD K ++ + G  +DPV+L ++LR  VG A + SV   
Sbjct  15   KSRSKALKIAVGLAGVESASLKGDDKSQIEITGEGVDPVQLTSLLRKSVGHAELVSVSAV  74

Query  248  D  250
            D
Sbjct  75   D  75



>ref|XP_011012621.1| PREDICTED: uncharacterized protein LOC105116833 [Populus euphratica]
Length=121

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            + P+++SK++QIAVGF  V SA L G  K ++ V G  +D VEL   LR KVG A + SV
Sbjct  12   NGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAELVSV  71



>ref|XP_002320539.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE98854.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=123

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            + P+++SK++QIAVGF  V SA L G  K ++ V G  +D VEL   LR KVG A I SV
Sbjct  14   NGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNRLRKKVGYAEIVSV  73



>ref|XP_011012623.1| PREDICTED: uncharacterized protein LOC105116834 [Populus euphratica]
Length=121

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            + P+++SK++QIAVGF  V SA L G  K ++ V G  +D VEL   LR KVG A + SV
Sbjct  12   NGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRKKVGYAELVSV  71



>ref|XP_004979957.1| PREDICTED: uncharacterized protein LOC101785879 isoform X5 [Setaria 
italica]
Length=938

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  827  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  882



>ref|XP_004979953.1| PREDICTED: uncharacterized protein LOC101785879 isoform X1 [Setaria 
italica]
Length=971

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  860  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  915



>ref|XP_004979958.1| PREDICTED: uncharacterized protein LOC101785879 isoform X6 [Setaria 
italica]
Length=893

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  782  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  837



>ref|XP_002263660.1| PREDICTED: uncharacterized protein LOC100258045 [Vitis vinifera]
Length=127

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 1/60 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++++KA++IAVG   V SAAL+G  KDE+ V G  ID V L  +LR  VG A + SVG A
Sbjct  15   KSRTKALKIAVGVSGVESAALKGQEKDEIEVTGEEIDVVALTFLLRKNVGNAEVVSVGAA  74



>ref|XP_004979954.1| PREDICTED: uncharacterized protein LOC101785879 isoform X2 [Setaria 
italica]
Length=964

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  853  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  908



>ref|XP_004979956.1| PREDICTED: uncharacterized protein LOC101785879 isoform X4 [Setaria 
italica]
Length=938

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  827  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  882



>ref|XP_004979955.1| PREDICTED: uncharacterized protein LOC101785879 isoform X3 [Setaria 
italica]
Length=957

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++ AMQ+      V+S AL GD +D+LVV G  +DPV LVT LR+KVG A++  VG
Sbjct  846  RTTAMQLVAATPGVDSVALAGDARDQLVVVGHGVDPVRLVTALRNKVGPANLLQVG  901



>emb|CDP08855.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  80   SKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGP  244
            SKAMQIAV    +   AL+G+ KD++VV G  ID V L ++LR K+G   + SV P
Sbjct  19   SKAMQIAVSVAGIERVALQGENKDQIVVVGEGIDAVNLTSLLRKKLGSVELVSVIP  74



>ref|XP_009625093.1| PREDICTED: uncharacterized protein LOC104116027 [Nicotiana tomentosiformis]
Length=128

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++KA++IAV    V SAA+ G+ K++L V G ID  +L ++LR  +G A + SVGPA
Sbjct  19   RTKALKIAVSQPGVESAAMTGEEKNQLEVVGEIDAADLTSLLRKNLGQAELVSVGPA  75



>gb|KDP22993.1| hypothetical protein JCGZ_01715 [Jatropha curcas]
Length=125

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +2

Query  53   FKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHI  229
            F  S+ +++SKAM+IAVG   V SAAL G  K ++ V G  +D V+L T+LR  VG + I
Sbjct  9    FSLSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVIGDGVDAVQLTTLLRKHVGYSEI  68

Query  230  KSVGPADD  253
             SV   + 
Sbjct  69   MSVSAVEQ  76



>ref|XP_010036113.1| PREDICTED: uncharacterized protein LOC104425192 [Eucalyptus grandis]
Length=117

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  80   SKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPADD  253
            SKAM++A GF  V S AL GD +D + V G +D V L  +LR KVG A I +V  AD+
Sbjct  18   SKAMKLAGGFQGVQSVALVGD-RDRIEVTGDVDAVNLTNLLRKKVGFAEIVTVSKADE  74



>gb|KCW47636.1| hypothetical protein EUGRSUZ_K01379 [Eucalyptus grandis]
Length=109

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  68   PENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPA  247
            P +KSK ++ A  F  V S  + GDGKD++ V G  DPV L  +LR KVG A I +V   
Sbjct  24   PSSKSKVVKAASDFRGVKSVTI-GDGKDQIEVTGDFDPVNLTVLLRKKVGSAEIITVSKD  82

Query  248  D  250
            D
Sbjct  83   D  83



>ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera]
Length=124

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPADD  253
            +SKAMQ AVG   V S ALEG+ K+++VV G  +D V L  +LR K G A + SV    +
Sbjct  18   RSKAMQTAVGVPGVESIALEGEDKNQIVVIGDSVDSVNLTCLLRKKFGSAELLSVSAVSE  77



>gb|AES71738.2| metal ion-binding protein, putative [Medicago truncatula]
Length=103

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVG  241
            +++SKAM+IAVG   V SAA++GD KD++ V G +ID  +L  +LR K   A + SVG
Sbjct  5    KSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCLLRKKFCHADLVSVG  62



>ref|XP_003601487.1| hypothetical protein MTR_3g082210 [Medicago truncatula]
Length=115

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVG  241
            +++SKAM+IAVG   V SAA++GD KD++ V G +ID  +L  +LR K   A + SVG
Sbjct  17   KSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCLLRKKFCHADLVSVG  74



>ref|XP_002313367.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
 gb|EEE87322.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
Length=114

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   PENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            P+++SKA+QIAVG   V SA L G+ K ++ V G  +D V+L  +LR KVG A + SV
Sbjct  14   PKSRSKALQIAVGLSGVESAGLGGEDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_010038750.1| PREDICTED: uncharacterized protein LOC104427343 [Eucalyptus grandis]
Length=121

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +2

Query  53   FKHSAPEN-KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHI  229
            F    P+N  SKA+++A GF  V S AL GD +D + V G +D V L T+LR KVG A I
Sbjct  18   FCCFGPQNPHSKALKVAGGFQGVQSVALTGD-QDRIEVTGDLDAVNLTTLLRKKVGFAEI  76

Query  230  KSV  238
             SV
Sbjct  77   VSV  79



>ref|XP_006387353.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
 gb|ERP46267.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
Length=128

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   PENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            P+++SKA+QIAVG   V SA L G  K ++ V G  +D V+L  +LR KVG A + SV
Sbjct  28   PKSRSKALQIAVGLSGVESAGLGGQDKSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>gb|KDP22996.1| hypothetical protein JCGZ_01718 [Jatropha curcas]
Length=115

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ +++SKAM+IAVG   V SAAL G  K E+ V G  +D V+L T+LR +VG + + SV
Sbjct  12   SSQKSRSKAMKIAVGVAGVESAALGGQDKSEIEVVGDGVDSVKLTTLLRKQVGYSELLSV  71



>ref|XP_003601491.1| ATFP4-like protein [Medicago truncatula]
 gb|AES71742.1| metal ion-binding protein, putative [Medicago truncatula]
Length=115

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGP  244
            +SKAM IA G   V   A++G+ KD++ V G +ID V L ++LR K   A + SVGP
Sbjct  18   RSKAMTIAAGVSGVEGTAIQGENKDQIEVTGEQIDSVRLTSLLRKKFCHAELVSVGP  74



>ref|NP_001152411.1| ATFP4 [Zea mays]
 gb|ACG47476.1| ATFP4 [Zea mays]
Length=122

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            +++SKAM +      VNS A+ GDGKD++VV G  +D ++L T+LR K+G A +  V 
Sbjct  16   KSRSKAMALVAAAGGVNSVAIAGDGKDQVVVVGEGVDSIKLTTILRKKMGDAQLVEVA  73



>gb|AFW72061.1| ATFP4 [Zea mays]
Length=122

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            +++SKAM +      VNS A+ GDGKD++VV G  +D ++L T+LR K+G A +  V 
Sbjct  16   KSRSKAMALVAAAGGVNSVAIAGDGKDQVVVVGEGVDSIKLTTILRKKMGDAQLVEVA  73



>ref|XP_009796820.1| PREDICTED: uncharacterized protein LOC104243343 [Nicotiana sylvestris]
Length=129

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++KA +IAV    V SAA+ G  K++L V G ID  +L ++LR  +G A + SVGPA
Sbjct  19   RTKAFKIAVSQPGVESAAMTGQEKNQLEVVGEIDAADLTSLLRKNLGQAELVSVGPA  75



>ref|XP_003575245.1| PREDICTED: uncharacterized protein LOC100845716 [Brachypodium 
distachyon]
Length=139

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +SKAM +      V+S AL GDGKD++VV G  +D + L + LR KVG A I  VG A
Sbjct  19   RSKAMALVAATPGVDSVALAGDGKDQVVVVGEGVDSINLTSALRKKVGPAEIVQVGEA  76



>gb|KDP22991.1| hypothetical protein JCGZ_01713 [Jatropha curcas]
Length=123

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ +++SKAM+IAVG   V SAAL G  K ++ V G  +D V+L T+LR ++G + + SV
Sbjct  12   SSQKSRSKAMKIAVGVAGVESAALRGQDKSQIEVVGDGVDAVKLTTLLRKQIGYSELVSV  71



>ref|XP_009793872.1| PREDICTED: uncharacterized protein LOC104240694 [Nicotiana sylvestris]
Length=132

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +2

Query  53   FKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHI  229
            F  +  + +SKA +IAV    V SAA+ GDGK++L V G  ID V L  +LR  +  A +
Sbjct  11   FNGNDQKYRSKAFKIAVSQPGVESAAMRGDGKNQLEVVGDDIDAVTLTNLLRKNLRQAEL  70

Query  230  KSVGPA  247
             SVGPA
Sbjct  71   VSVGPA  76



>ref|XP_010542497.1| PREDICTED: uncharacterized protein LOC104815685 [Tarenaya hassleriana]
Length=136

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +2

Query  65   APENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVG  241
            +P+++SKAM+IA G   V S +++G+  D+LVV G  ID VEL   LR KVG A I +V 
Sbjct  14   SPKSRSKAMKIASGTSGVRSVSIQGEN-DQLVVLGEEIDTVELTRELRKKVGHAKIVTVQ  72

Query  242  PA  247
             A
Sbjct  73   AA  74



>gb|KDP22994.1| hypothetical protein JCGZ_01716 [Jatropha curcas]
Length=119

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ +++SKAM+IAVG   V SAAL G  K ++ V G  +D V+L T+LR +VG + + SV
Sbjct  12   SSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVVGDGVDAVKLTTLLRKQVGYSELVSV  71



>ref|XP_009625092.1| PREDICTED: uncharacterized protein LOC104116026 [Nicotiana tomentosiformis]
Length=132

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            +SKA +IAV    V SAA++G+ K++L V G  ID V L  +LR  +G A + SVGPA
Sbjct  19   RSKAFKIAVSQPGVESAAMKGEEKNQLEVVGDEIDAVTLTNLLRKNLGQAQLVSVGPA  76



>ref|XP_009796821.1| PREDICTED: uncharacterized protein LOC104243344 [Nicotiana sylvestris]
Length=132

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            +SKA +IAV    V SAA+ G+ K++L V G  ID V L ++LR  +G A + SVGPA
Sbjct  19   RSKAFKIAVSQPGVESAAMRGEEKNQLEVVGDEIDAVTLTSLLRKNLGQAELVSVGPA  76



>ref|XP_006447868.1| hypothetical protein CICLE_v10018068mg [Citrus clementina]
 gb|ESR61108.1| hypothetical protein CICLE_v10018068mg [Citrus clementina]
Length=123

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SKA+++AVGF  V S AL+GD   ++ V G  +D V L T LR KVG A + SV
Sbjct  11   KSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRKKVGYAEVVSV  67



>ref|XP_010038748.1| PREDICTED: uncharacterized protein LOC104427341 [Eucalyptus grandis]
Length=120

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   NKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPAD  250
            ++SKA+ +  GF  V S  +E D KD++ + G  D V L T+LR KVG A I +V  AD
Sbjct  25   SRSKALSVVSGFQGVKSVKIEDD-KDQIEMTGVFDSVALTTLLRKKVGFAQIITVSEAD  82



>ref|XP_010241736.1| PREDICTED: uncharacterized protein LOC104586261, partial [Nelumbo 
nucifera]
Length=85

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSV  238
            +SKAM+IA     V S ALEGD KD+LVV G  +D   L  +LR KVG A I ++
Sbjct  17   RSKAMKIAASTQGVTSVALEGDFKDKLVVMGEEVDSTCLTRLLRKKVGHAVIVTI  71



>ref|XP_010036115.1| PREDICTED: uncharacterized protein LOC104425195 [Eucalyptus grandis]
 gb|KCW47635.1| hypothetical protein EUGRSUZ_K01377 [Eucalyptus grandis]
Length=129

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  53   FKHSAPEN-KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHI  229
            F   +P N  SKA+++A GF  V S AL GD +D + V G +D V L T+LR KVG A I
Sbjct  18   FFCFSPRNPHSKALKLAGGFQGVQSVALVGD-QDRIEVTGDVDAVNLTTLLRKKVGFAKI  76

Query  230  KSVG  241
             +V 
Sbjct  77   VTVS  80



>ref|XP_006469399.1| PREDICTED: uncharacterized protein LOC102626447 [Citrus sinensis]
Length=127

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SKA+++AVGF  V S AL+GD   ++ V G  +D V L T LR KVG A + SV
Sbjct  15   KSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRKKVGYAEVVSV  71



>gb|EYU41174.1| hypothetical protein MIMGU_mgv1a016413mg [Erythranthe guttata]
Length=123

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++++KAMQI+VG   V SAAL G  +D + V G  +D VEL   LR  V  A + SVG A
Sbjct  15   KSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLRKNVAYAELVSVGEA  74

Query  248  DD  253
             +
Sbjct  75   KN  76



>gb|EYU33985.1| hypothetical protein MIMGU_mgv1a016390mg [Erythranthe guttata]
 gb|EYU33987.1| hypothetical protein MIMGU_mgv1a016402mg [Erythranthe guttata]
Length=123

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            ++++KAMQI+VG   V SAAL G  +D + V G  +D VEL   LR  V  A + SVG A
Sbjct  15   KSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLRKNVAYAELVSVGEA  74

Query  248  DD  253
             +
Sbjct  75   KN  76



>gb|KDO42092.1| hypothetical protein CISIN_1g033335mg [Citrus sinensis]
Length=121

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SKA+++AVGF  V S AL+GD   ++ V G  +D V L T LR KVG A + SV
Sbjct  11   KSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRKKVGYAEVVSV  67



>ref|XP_004952921.1| PREDICTED: uncharacterized protein LOC101786087 isoform X2 [Setaria 
italica]
Length=125

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ + +SKAM +      V+S AL GDGKD++VV G  +D ++L   LR KVG A +  V
Sbjct  13   SSDKCRSKAMALVASTGGVDSVALAGDGKDQVVVVGEGVDSIKLTEALRKKVGDAQLVQV  72

Query  239  G  241
            G
Sbjct  73   G  73



>ref|XP_011032086.1| PREDICTED: uncharacterized protein LOC105131028 isoform X1 [Populus 
euphratica]
 ref|XP_011032088.1| PREDICTED: uncharacterized protein LOC105131029 isoform X1 [Populus 
euphratica]
Length=128

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SKA+QIAVG   V SA L G+ K ++ V G  +D V+L  +LR KVG A + SV
Sbjct  29   KSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>ref|XP_002266819.2| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera]
Length=152

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SK++++AVG   V SAAL+G  K+++ V G  ID V L T+LR KVG A + SV
Sbjct  49   KSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLLRKKVGFAELVSV  105



>ref|XP_009625095.1| PREDICTED: uncharacterized protein LOC104116030 [Nicotiana tomentosiformis]
Length=149

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 42/78 (54%), Gaps = 8/78 (10%)
 Frame = +2

Query  11   MLKAMLPFECVSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVE  187
            +L  ++PF          A   K+K M IA     V   ++E + K+EL V G  IDPV+
Sbjct  24   VLGCLVPF------LVQEAATCKNKVMSIATTLSGVEKVSIEVE-KNELTVIGEGIDPVK  76

Query  188  LVTVLRDKVGGAHIKSVG  241
            LV +LR KVG A I SVG
Sbjct  77   LVNILRKKVGFAQIVSVG  94



>ref|XP_009591620.1| PREDICTED: uncharacterized protein LOC104088617 [Nicotiana tomentosiformis]
Length=75

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +2

Query  53   FKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHI  229
             KH   + +SK++ IA     VNS AL+G+ KDE+V+ G ++D   + T+LR KVG A +
Sbjct  9    VKHKCQKCQSKSLMIAAMSTGVNSVALQGEKKDEVVIIGEQVDAAGITTLLRKKVGHASL  68



>ref|XP_010036116.1| PREDICTED: uncharacterized protein LOC104425196 [Eucalyptus grandis]
Length=131

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   NKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPAD  250
            +++KA+++A GF  V S    GDGKD++ + G  D V L  +LR KVG A I +V  AD
Sbjct  25   SRAKALRVAGGFRGVESVKT-GDGKDQIEMTGNFDSVALTNLLRKKVGFAEIIAVSEAD  82



>gb|KCW47638.1| hypothetical protein EUGRSUZ_K01380 [Eucalyptus grandis]
Length=132

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   NKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPAD  250
            +++KA+++A GF  V S    GDGKD++ + G  D V L  +LR KVG A I +V  AD
Sbjct  26   SRAKALRVAGGFRGVESVKT-GDGKDQIEMTGNFDSVALTNLLRKKVGFAEIIAVSEAD  83



>ref|XP_011032087.1| PREDICTED: uncharacterized protein LOC105131028 isoform X2 [Populus 
euphratica]
 ref|XP_011032089.1| PREDICTED: uncharacterized protein LOC105131029 isoform X2 [Populus 
euphratica]
Length=114

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SKA+QIAVG   V SA L G+ K ++ V G  +D V+L  +LR KVG A + SV
Sbjct  15   KSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLRKKVGYAELASV  71



>ref|XP_009419205.1| PREDICTED: uncharacterized protein LOC103999243 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=115

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHI  229
            +SKAMQ+      V+S A+EG+ KD+LV+ G  +DP  +  VLR KVG A I
Sbjct  16   RSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLRKKVGRATI  67



>ref|XP_009391790.1| PREDICTED: uncharacterized protein LOC103977867 [Musa acuminata 
subsp. malaccensis]
Length=124

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +SKAM++      V+S A+EG+ KD+LV+ G  +DP +L   LR KVG A+I  V
Sbjct  17   RSKAMRLVASAEGVDSVAVEGEDKDQLVLVGDGVDPADLTCTLRKKVGHAYIVKV  71



>ref|XP_009419204.1| PREDICTED: uncharacterized protein LOC103999243 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=116

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHI  229
            +SKAMQ+      V+S A+EG+ KD+LV+ G  +DP  +  VLR KVG A I
Sbjct  17   RSKAMQLVAEADGVDSVAIEGENKDQLVIVGDGVDPANVTLVLRKKVGRATI  68



>gb|KHF99125.1| Fimbrial [Gossypium arboreum]
Length=115

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            +++SKA+++ VGF  V SA+L+GD K ++ V G  +D V+L + LR  VG A + SV 
Sbjct  15   KSRSKALKVVVGFSGVESASLKGDDKSQIEVTGDGVDAVQLTSRLRKSVGHAELVSVS  72



>ref|XP_011091863.1| PREDICTED: uncharacterized protein LOC105172196 isoform X1 [Sesamum 
indicum]
Length=105

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            +  SKAM+IA G   V S  L G+ KD+++V G  ID V L   +R K+G A + S+ P 
Sbjct  19   QYSSKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCMRKKLGSAELISLAPI  78

Query  248  DD  253
             D
Sbjct  79   GD  80



>ref|XP_011091871.1| PREDICTED: uncharacterized protein LOC105172196 isoform X2 [Sesamum 
indicum]
Length=101

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +2

Query  80   SKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPADD  253
            SKAM+IA G   V S  L G+ KD+++V G  ID V L   +R K+G A + S+ P  D
Sbjct  18   SKAMKIAAGVSGVESMTLLGENKDQIMVIGAGIDAVNLTKCMRKKLGSAELISLAPIGD  76



>ref|XP_004952920.1| PREDICTED: uncharacterized protein LOC101786087 isoform X1 [Setaria 
italica]
Length=167

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ + +SKAM +      V+S AL GDGKD++VV G  +D ++L   LR KVG A +  V
Sbjct  55   SSDKCRSKAMALVASTGGVDSVALAGDGKDQVVVVGEGVDSIKLTEALRKKVGDAQLVQV  114

Query  239  G  241
            G
Sbjct  115  G  115



>ref|XP_002454080.1| hypothetical protein SORBIDRAFT_04g024270 [Sorghum bicolor]
 gb|EES07056.1| hypothetical protein SORBIDRAFT_04g024270 [Sorghum bicolor]
Length=127

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            S+ +++SKAM +      V+S A+ GDGKD++VV G  +D ++L T LR K+G A +  V
Sbjct  13   SSDKSRSKAMALVAAAGGVHSVAIAGDGKDQVVVVGEGVDSIKLTTDLRKKMGDAQLVEV  72

Query  239  G  241
            G
Sbjct  73   G  73



>ref|XP_006348966.1| PREDICTED: uncharacterized protein LOC102605080 [Solanum tuberosum]
Length=119

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSV  238
            ++KA +IA     V SAA+ GDGK++L V G +D V L ++LR  +G A + SV
Sbjct  19   RTKAFKIAASQSGVESAAITGDGKNQLEVVGEVDAVTLTSLLRKNLGLADLVSV  72



>ref|XP_006349960.1| PREDICTED: uncharacterized protein LOC102599063 [Solanum tuberosum]
Length=149

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 7/80 (9%)
 Frame = +2

Query  5    VGMLKAMLPFECVSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPV  184
            +G LK M+P  C+   FKH+  +NK   M IA     V   +LE +     V+  RID V
Sbjct  25   LGWLKPMVP--CL---FKHTTCKNK--VMTIAATLPGVEKVSLEEEKNLLTVIGERIDAV  77

Query  185  ELVTVLRDKVGGAHIKSVGP  244
            EL+  +R KVG A + S GP
Sbjct  78   ELLNKIRKKVGFAKLVSQGP  97



>gb|EYU34048.1| hypothetical protein MIMGU_mgv1a020264mg [Erythranthe guttata]
Length=118

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   NKSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSVGPA  247
            +++KAMQI+VG   V SAA+ G  +D + V G  +D VEL   LR  V  A + SVG A
Sbjct  6    SRTKAMQISVGISGVESAAITGQERDRVEVVGDDVDAVELTRQLRKNVAYAELVSVGEA  64



>ref|XP_004243216.1| PREDICTED: uncharacterized protein LOC101251303 [Solanum lycopersicum]
Length=127

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKS  235
            ++KA +IAV    V SAA+ GDGK++L V G +D   L ++LR  +G A + S
Sbjct  19   RTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLRKNLGKADLVS  71



>ref|XP_003635014.1| PREDICTED: uncharacterized protein LOC100853035 [Vitis vinifera]
Length=126

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 37/73 (51%), Gaps = 8/73 (11%)
 Frame = +2

Query  41   VSKPFKHSAP-------ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTV  199
            VS  +K S P          SKAM+I  GFH V S   + D K +L V G IDPV L   
Sbjct  9    VSLSYKKSWPCFLFGELTCPSKAMKIVSGFHGVESVTWKDD-KSKLEVTGEIDPVCLTRK  67

Query  200  LRDKVGGAHIKSV  238
            LR K+G   I SV
Sbjct  68   LRKKIGPITIISV  80



>gb|KCW47632.1| hypothetical protein EUGRSUZ_K01374 [Eucalyptus grandis]
Length=97

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  89   MQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPADD  253
            M++A GF  V S AL GD +D + V G +D V L  +LR KVG A I +V  AD+
Sbjct  1    MKLAGGFQGVQSVALVGD-RDRIEVTGDVDAVNLTNLLRKKVGFAEIVTVSKADE  54



>emb|CBI28485.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +++SK++++AVG   V SAAL+G  K+++ V G  ID V L T+LR KVG A + SV
Sbjct  49   KSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLLRKKVGFAELVSV  105



>ref|XP_010942541.1| PREDICTED: uncharacterized protein LOC105060501 [Elaeis guineensis]
Length=113

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVGPA  247
            + +SKA++I VG   V SA+++G+ KD++VV G  ID   LV  LR ++  A + SV P 
Sbjct  16   KKRSKALKIVVGLDGVTSASVDGNEKDQIVVVGDGIDSFALVRKLRKRMKYAELVSVAPE  75

Query  248  DD  253
            D+
Sbjct  76   DE  77



>ref|NP_001053015.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAF14929.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAH00062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 38/72 (53%), Gaps = 5/72 (7%)
 Frame = +2

Query  41   VSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVG  217
            VS P + S    +SKAM +      VNS  + GDGKD L V G  +DPV LV  LR K+G
Sbjct  9    VSMPCEKS----RSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACLRRKIG  64

Query  218  GAHIKSVGPADD  253
             A I  V    D
Sbjct  65   YAEIVQVEEVKD  76



>ref|XP_006348965.1| PREDICTED: uncharacterized protein LOC102604739 [Solanum tuberosum]
Length=127

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKS  235
            ++KA +IAV    V SAA+ GDGK++L V G +D   L ++LR  +G A + S
Sbjct  19   RTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLRKNLGQADLVS  71



>gb|AES60176.2| metal ion-binding protein, putative [Medicago truncatula]
Length=106

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSV  238
            ++KAM IAVG   V  A ++GD KD++ V G  ID V+L ++LR K G A + S+
Sbjct  7    RNKAMAIAVGVSGVEGATIKGDNKDQIEVTGEEIDSVKLASLLRKKFGYADLVSI  61



>ref|XP_007020387.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11912.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
            ++KAM+IA   + V+S A+ G+ KD++VV G  ID   L  +LR K+G A I SVG
Sbjct  17   RTKAMKIAAVANGVSSVAIAGNDKDQVVVTGEGIDSANLTCLLRKKLGYAAIISVG  72



>dbj|BAK39930.1| NBS-LRR type protein [Oryza sativa Japonica Group]
Length=1116

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  71    ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHI  229
             ++++KAM +A   + V+S  + G+ KD LVV GR IDPV LV +LR+K G A +
Sbjct  1010  KSRAKAMALAASVNGVDSVEITGEDKDRLVVVGRGIDPVRLVALLREKCGLAEL  1063



>emb|CAD41036.1| OSJNBa0060P14.7 [Oryza sativa Japonica Group]
 gb|EAY94438.1| hypothetical protein OsI_16209 [Oryza sativa Indica Group]
 gb|EAY94440.1| hypothetical protein OsI_16211 [Oryza sativa Indica Group]
 gb|EAZ31005.1| hypothetical protein OsJ_15087 [Oryza sativa Japonica Group]
Length=119

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 38/72 (53%), Gaps = 5/72 (7%)
 Frame = +2

Query  41   VSKPFKHSAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVG  217
            VS P + S    +SKAM +      VNS  + GDGKD L V G  +DPV LV  LR K+G
Sbjct  10   VSMPCEKS----RSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACLRRKIG  65

Query  218  GAHIKSVGPADD  253
             A I  V    D
Sbjct  66   YAEIVQVEEVKD  77



>ref|XP_010253026.1| PREDICTED: glutelin type-A 1-like [Nelumbo nucifera]
Length=359

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            +SKAM IA     V S A+EGD KD LVV G  +D  +L T LR KVG A I SV
Sbjct  17   RSKAMSIASVAEGVISVAIEGDDKDRLVVIGDGVDSAKLTTSLRKKVGHATIISV  71



>ref|XP_003589925.1| ATFP4-like protein [Medicago truncatula]
Length=117

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKG-RIDPVELVTVLRDKVGGAHIKSV  238
            ++KAM IAVG   V  A ++GD KD++ V G  ID V+L ++LR K G A + S+
Sbjct  18   RNKAMAIAVGVSGVEGATIKGDNKDQIEVTGEEIDSVKLASLLRKKFGYADLVSI  72



>ref|XP_003594348.1| hypothetical protein MTR_2g027600 [Medicago truncatula]
 gb|ABN08867.1| Heavy metal transport/detoxification protein [Medicago truncatula]
 gb|AES64599.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=77

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  65   APENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
              + ++KA+++  G + VN   LEGD KD++VV G  +D V L   LR KVG   I S+G
Sbjct  13   CQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKKVGQTEIVSLG  72

Query  242  P  244
             
Sbjct  73   E  73



>gb|KEH15709.1| heavy metal transport/detoxification superfamily protein, partial 
[Medicago truncatula]
Length=75

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +2

Query  65   APENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSVG  241
              + ++KA+++  G + VN   LEGD KD++VV G  +D V L   LR KVG   I S+G
Sbjct  11   CQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKKVGQTEIVSLG  70

Query  242  P  244
             
Sbjct  71   E  71



>ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis]
Length=119

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   KSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHIKSV  238
            ++KAMQ A     VNS ALEGD KD+LVV G  +D   L   LR K+  A I +V
Sbjct  17   RTKAMQTAAVADGVNSVALEGDDKDKLVVIGEMVDAACLTKALRKKINYAEIVTV  71



>ref|XP_003577912.1| PREDICTED: uncharacterized protein LOC100824539 isoform X2 [Brachypodium 
distachyon]
Length=143

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSVGPAD  250
              + KA + AVG   V SA +EGD    ++V   IDP+ L T+LR ++G A + SV   D
Sbjct  16   RKRRKAFKAAVGIAGVTSATMEGD--KMIIVGDGIDPISLTTMLRRRLGHAELLSVSSGD  73

Query  251  D  253
            D
Sbjct  74   D  74



>ref|XP_006583442.1| PREDICTED: uncharacterized protein LOC100812612 [Glycine max]
 gb|KHN44586.1| hypothetical protein glysoja_027197 [Glycine soja]
Length=123

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  71   ENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGRIDPVELVTVLRDKVGGAHIKSV  238
            +++SKA++IA     V+S ALEGD KD+L V G +D V L  VLR K     + SV
Sbjct  15   KSRSKALKIAAQEIGVSSVALEGDNKDKLTVTGDVDAVHLGRVLRKKFQCVTLVSV  70



>gb|EMT17916.1| hypothetical protein F775_42527 [Aegilops tauschii]
Length=127

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = +2

Query  62   SAPENKSKAMQIAVGFHDVNSAALEGDGKDELVVKGR-IDPVELVTVLRDKVGGAHI  229
            S  +++SKA+ +A     V S  + GDG+D+L V G  +DPV LV+ LR K+G A I
Sbjct  12   SCDKSRSKALTLAARAAGVTSMGITGDGRDQLEVVGDGVDPVCLVSCLRKKLGHAQI  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688