BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4897_g1_i2 len=2059 path=[2077:0-1766 3843:1767-1858 42:1859-2058]

Length=2059
                                                                      Score     E

ref|XP_009597687.1|  PREDICTED: serine hydroxymethyltransferase, ...    959   0.0     
ref|XP_010027978.1|  PREDICTED: serine hydroxymethyltransferase, ...    951   0.0     
ref|XP_009597686.1|  PREDICTED: serine hydroxymethyltransferase, ...    948   0.0     
ref|XP_009604710.1|  PREDICTED: serine hydroxymethyltransferase, ...    946   0.0     
ref|XP_009800891.1|  PREDICTED: serine hydroxymethyltransferase, ...    945   0.0     
ref|NP_001237509.1|  serine hydroxymethyltransferase 5                  943   0.0     
ref|XP_003612954.1|  Serine hydroxymethyltransferase                    942   0.0     
ref|XP_011073635.1|  PREDICTED: serine hydroxymethyltransferase, ...    942   0.0     
ref|NP_001275486.1|  serine hydroxymethyltransferase, mitochondrial     942   0.0     
ref|XP_002262872.2|  PREDICTED: serine hydroxymethyltransferase, ...    941   0.0     Vitis vinifera
gb|KDP32169.1|  hypothetical protein JCGZ_12630                         937   0.0     
ref|XP_004231981.1|  PREDICTED: serine hydroxymethyltransferase, ...    936   0.0     
gb|KHN46622.1|  Serine hydroxymethyltransferase, mitochondrial          935   0.0     
ref|XP_004512553.1|  PREDICTED: serine hydroxymethyltransferase, ...    935   0.0     
gb|KHN03621.1|  Serine hydroxymethyltransferase, mitochondrial          935   0.0     
ref|XP_006426223.1|  hypothetical protein CICLE_v10025372mg             933   0.0     
gb|ABO61382.1|  mitochondrial serine hydroxymethyltransferase           933   0.0     Populus tremuloides
ref|XP_011046572.1|  PREDICTED: serine hydroxymethyltransferase 1...    932   0.0     
ref|XP_006466352.1|  PREDICTED: serine hydroxymethyltransferase, ...    932   0.0     
ref|XP_010244692.1|  PREDICTED: serine hydroxymethyltransferase, ...    931   0.0     
ref|XP_002527226.1|  serine hydroxymethyltransferase, putative          931   0.0     Ricinus communis
ref|XP_006584499.1|  PREDICTED: serine hydroxymethyltransferase 3...    931   0.0     
ref|XP_002310916.2|  Serine hydroxymethyltransferase family protein     931   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002315363.2|  Serine hydroxymethyltransferase family protein     930   0.0     Populus trichocarpa [western balsam poplar]
sp|P34899.1|GLYM_PEA  RecName: Full=Serine hydroxymethyltransfera...    930   0.0     Pisum sativum [garden pea]
gb|ABK96241.1|  unknown                                                 929   0.0     Populus trichocarpa x Populus deltoides
ref|XP_010254621.1|  PREDICTED: serine hydroxymethyltransferase, ...    928   0.0     
ref|XP_007047709.1|  Serine transhydroxymethyltransferase 1 isofo...    928   0.0     
gb|ABK96362.1|  unknown                                                 928   0.0     Populus trichocarpa x Populus deltoides
gb|AFK45159.1|  unknown                                                 927   0.0     
ref|XP_011033087.1|  PREDICTED: serine hydroxymethyltransferase 1...    927   0.0     
ref|XP_006651801.1|  PREDICTED: serine hydroxymethyltransferase, ...    927   0.0     
ref|XP_007205053.1|  hypothetical protein PRUPE_ppa004306mg             927   0.0     
emb|CDX69344.1|  BnaC01g01090D                                          926   0.0     
ref|XP_007156447.1|  hypothetical protein PHAVU_003G286600g             926   0.0     
emb|CDX75685.1|  BnaA01g00170D                                          925   0.0     
gb|EYU44561.1|  hypothetical protein MIMGU_mgv1a004699mg                925   0.0     
ref|XP_006283400.1|  hypothetical protein CARUB_v10004441mg             924   0.0     
ref|XP_010531344.1|  PREDICTED: serine hydroxymethyltransferase 1...    924   0.0     
ref|XP_006411834.1|  hypothetical protein EUTSA_v10024934mg             924   0.0     
ref|XP_010555423.1|  PREDICTED: serine hydroxymethyltransferase 1...    923   0.0     
ref|XP_009132042.1|  PREDICTED: serine hydroxymethyltransferase 1...    923   0.0     
ref|XP_008440509.1|  PREDICTED: serine hydroxymethyltransferase, ...    922   0.0     
ref|XP_010432013.1|  PREDICTED: serine hydroxymethyltransferase 1...    921   0.0     
emb|CDY49684.1|  BnaC03g61150D                                          921   0.0     
sp|P49357.1|GLYM1_FLAPR  RecName: Full=Serine hydroxymethyltransf...    921   0.0     Flaveria pringlei
ref|XP_006466351.1|  PREDICTED: serine hydroxymethyltransferase, ...    921   0.0     
ref|XP_010437163.1|  PREDICTED: serine hydroxymethyltransferase 1...    921   0.0     
ref|XP_009109405.1|  PREDICTED: serine hydroxymethyltransferase 1...    920   0.0     
gb|KCW54635.1|  hypothetical protein EUGRSUZ_I00580                     920   0.0     
ref|XP_009364793.1|  PREDICTED: serine hydroxymethyltransferase, ...    920   0.0     
sp|P49358.1|GLYM2_FLAPR  RecName: Full=Serine hydroxymethyltransf...    920   0.0     Flaveria pringlei
ref|XP_010446608.1|  PREDICTED: serine hydroxymethyltransferase 1...    919   0.0     
ref|XP_002866922.1|  hypothetical protein ARALYDRAFT_490821             919   0.0     
ref|NP_001051211.1|  Os03g0738400                                       919   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AAP44712.1|  putative glycine hydroxymethyltransferase               919   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010646403.1|  PREDICTED: serine hydroxymethyltransferase, ...    918   0.0     
ref|NP_195506.1|  serine transhydroxymethyltransferase 1                917   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981838.1|  PREDICTED: serine hydroxymethyltransferase, ...    916   0.0     
ref|XP_008236601.1|  PREDICTED: serine hydroxymethyltransferase, ...    916   0.0     
gb|AAL06913.1|  AT4g37930/F20D10_50                                     916   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006379386.1|  hypothetical protein POPTR_0008s00350g             915   0.0     
ref|XP_010683048.1|  PREDICTED: serine hydroxymethyltransferase, ...    914   0.0     
ref|XP_008368015.1|  PREDICTED: serine hydroxymethyltransferase, ...    914   0.0     
emb|CBI19306.3|  unnamed protein product                                914   0.0     
ref|XP_003559966.1|  PREDICTED: serine hydroxymethyltransferase 1...    914   0.0     
ref|XP_009345858.1|  PREDICTED: serine hydroxymethyltransferase, ...    914   0.0     
ref|XP_008665373.1|  PREDICTED: serine hydroxymethyltransferase, ...    914   0.0     
ref|XP_002285605.1|  PREDICTED: serine hydroxymethyltransferase, ...    914   0.0     Vitis vinifera
gb|ABO61378.1|  mitochondrial serine hydroxymethyltransferase           914   0.0     Populus tremuloides
ref|XP_010520825.1|  PREDICTED: serine hydroxymethyltransferase 2...    913   0.0     
gb|KFK30424.1|  hypothetical protein AALP_AA7G259200                    913   0.0     
ref|XP_009411315.1|  PREDICTED: serine hydroxymethyltransferase, ...    912   0.0     
ref|XP_002302357.1|  hypothetical protein POPTR_0002s10990g             911   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008219190.1|  PREDICTED: serine hydroxymethyltransferase 2...    911   0.0     
gb|KDP41520.1|  hypothetical protein JCGZ_15927                         911   0.0     
ref|XP_004143436.1|  PREDICTED: serine hydroxymethyltransferase, ...    910   0.0     
ref|XP_002872234.1|  hypothetical protein ARALYDRAFT_489509             910   0.0     
ref|XP_010320237.1|  PREDICTED: serine hydroxymethyltransferase, ...    910   0.0     
ref|XP_006390781.1|  hypothetical protein EUTSA_v10018408mg             910   0.0     
ref|XP_010421535.1|  PREDICTED: serine hydroxymethyltransferase 2...    909   0.0     
ref|XP_007225719.1|  hypothetical protein PRUPE_ppa004304mg             909   0.0     
ref|XP_004160122.1|  PREDICTED: LOW QUALITY PROTEIN: serine hydro...    909   0.0     
ref|NP_851080.1|  serine hydroxymethyltransferase 2                     908   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016976.1|  PREDICTED: serine hydroxymethyltransferase 2...    908   0.0     
ref|XP_008810278.1|  PREDICTED: serine hydroxymethyltransferase, ...    908   0.0     
ref|XP_006364981.1|  PREDICTED: serine hydroxymethyltransferase, ...    908   0.0     
ref|XP_009765987.1|  PREDICTED: serine hydroxymethyltransferase, ...    907   0.0     
ref|XP_006856608.1|  hypothetical protein AMTR_s00046p00219150          907   0.0     
gb|EPS63381.1|  serine hydroxymethyltransferase                         907   0.0     
ref|XP_010918336.1|  PREDICTED: serine hydroxymethyltransferase, ...    906   0.0     
gb|AAK59622.1|  putative glycine hydroxymethyltransferase               905   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010064700.1|  PREDICTED: serine hydroxymethyltransferase 2...    905   0.0     
ref|XP_008378620.1|  PREDICTED: serine hydroxymethyltransferase, ...    904   0.0     
ref|XP_009628185.1|  PREDICTED: serine hydroxymethyltransferase, ...    904   0.0     
ref|XP_008338989.1|  PREDICTED: serine hydroxymethyltransferase, ...    903   0.0     
ref|XP_004148411.1|  PREDICTED: serine hydroxymethyltransferase, ...    903   0.0     
ref|XP_002527346.1|  serine hydroxymethyltransferase, putative          903   0.0     Ricinus communis
ref|XP_011074288.1|  PREDICTED: serine hydroxymethyltransferase 2...    902   0.0     
ref|XP_007018307.1|  Serine hydroxymethyltransferase 2 isoform 1        902   0.0     
ref|XP_006379385.1|  hypothetical protein POPTR_0008s00350g             901   0.0     
emb|CDX68316.1|  BnaA07g23560D                                          900   0.0     
ref|NP_851081.1|  serine hydroxymethyltransferase 2                     900   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003519208.1|  PREDICTED: serine hydroxymethyltransferase, ...    900   0.0     
emb|CDP19594.1|  unnamed protein product                                899   0.0     
ref|XP_008444959.1|  PREDICTED: serine hydroxymethyltransferase 2...    899   0.0     
ref|XP_007141299.1|  hypothetical protein PHAVU_008G184200g             898   0.0     
ref|XP_009105803.1|  PREDICTED: serine hydroxymethyltransferase 2...    897   0.0     
ref|XP_006433761.1|  hypothetical protein CICLE_v10000875mg             897   0.0     
ref|XP_007018308.1|  Serine hydroxymethyltransferase 2 isoform 2        897   0.0     
ref|XP_009104919.1|  PREDICTED: serine hydroxymethyltransferase 2...    895   0.0     
emb|CDX96315.1|  BnaA07g29260D                                          895   0.0     
gb|KDO81280.1|  hypothetical protein CISIN_1g010058mg                   894   0.0     
ref|XP_006289490.1|  hypothetical protein CARUB_v10003023mg             894   0.0     
emb|CDY49212.1|  BnaCnng17010D                                          893   0.0     
ref|XP_003544839.1|  PREDICTED: serine hydroxymethyltransferase, ...    893   0.0     
dbj|BAJ89749.1|  predicted protein                                      892   0.0     
ref|XP_010519153.1|  PREDICTED: serine hydroxymethyltransferase 2...    891   0.0     
ref|XP_006472402.1|  PREDICTED: serine hydroxymethyltransferase, ...    891   0.0     
gb|ABJ15727.1|  serine hydroxymethyltransferase                         890   0.0     Triticum monococcum [einkorn wheat]
ref|XP_009405786.1|  PREDICTED: serine hydroxymethyltransferase, ...    889   0.0     
emb|CDX72795.1|  BnaC06g32430D                                          888   0.0     
gb|KFK26442.1|  hypothetical protein AALP_AA8G249100                    887   0.0     
gb|EMT02084.1|  Serine hydroxymethyltransferase, mitochondrial          887   0.0     
ref|XP_004287403.1|  PREDICTED: serine hydroxymethyltransferase, ...    886   0.0     
ref|XP_010671051.1|  PREDICTED: serine hydroxymethyltransferase 2...    884   0.0     
gb|ABK24431.1|  unknown                                                 882   0.0     Picea sitchensis
emb|CCC55420.1|  mitochondrial serine hydroxymethyltransferase          881   0.0     
ref|XP_004490468.1|  PREDICTED: serine hydroxymethyltransferase, ...    876   0.0     
ref|XP_009394286.1|  PREDICTED: serine hydroxymethyltransferase, ...    875   0.0     
gb|KHG09155.1|  Serine hydroxymethyltransferase 1, mitochondrial        874   0.0     
gb|KHN39975.1|  Serine hydroxymethyltransferase, mitochondrial          874   0.0     
gb|KHN38901.1|  Serine hydroxymethyltransferase, mitochondrial          872   0.0     
gb|KCW54638.1|  hypothetical protein EUGRSUZ_I00580                     871   0.0     
ref|XP_003534254.2|  PREDICTED: serine hydroxymethyltransferase, ...    871   0.0     
pir||T01759  glycine hydroxymethyltransferase (EC 2.1.2.1) A_IG00...    869   0.0  
ref|XP_003615366.1|  Serine hydroxymethyltransferase                    868   0.0     
gb|AFK45020.1|  unknown                                                 860   0.0     
gb|EEE59895.1|  hypothetical protein OsJ_12499                          854   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006426224.1|  hypothetical protein CICLE_v10025372mg             853   0.0     
gb|KGN62770.1|  hypothetical protein Csa_2G372170                       848   0.0     
gb|KCW54637.1|  hypothetical protein EUGRSUZ_I00580                     842   0.0     
gb|AAZ67146.1|  serine hydroxymethyltransferase                         839   0.0     Medicago truncatula
ref|XP_001756110.1|  predicted protein                                  837   0.0     
emb|CAN83325.1|  hypothetical protein VITISV_000671                     837   0.0     Vitis vinifera
ref|XP_001765821.1|  predicted protein                                  834   0.0     
ref|XP_002982415.1|  hypothetical protein SELMODRAFT_271551             835   0.0     
ref|XP_002966577.1|  hypothetical protein SELMODRAFT_270566             834   0.0     
ref|XP_007047710.1|  Serine transhydroxymethyltransferase 1 isofo...    828   0.0     
dbj|BAG94588.1|  unnamed protein product                                828   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|NP_001237491.1|  serine hydroxymethyltransferase 3                  832   0.0     
ref|XP_006411835.1|  hypothetical protein EUTSA_v10024934mg             821   0.0     
gb|KCW68539.1|  hypothetical protein EUGRSUZ_F02167                     816   0.0     
gb|KHG13288.1|  Serine hydroxymethyltransferase, mitochondrial          806   0.0     
gb|ABR16633.1|  unknown                                                 787   0.0     Picea sitchensis
gb|ABF98773.1|  Serine hydroxymethyltransferase, mitochondrial pr...    770   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KCW68544.1|  hypothetical protein EUGRSUZ_F02167                     755   0.0     
ref|XP_005643716.1|  SHMT-domain-containing protein                     751   0.0     
gb|KCW68543.1|  hypothetical protein EUGRSUZ_F02167                     739   0.0     
ref|XP_001701451.1|  serine hydroxymethyltransferase                    723   0.0     Chlamydomonas reinhardtii
ref|XP_001422748.1|  predicted protein                                  723   0.0     Ostreococcus lucimarinus CCE9901
gb|KFM26246.1|  Serine hydroxymethyltransferase, mitochondrial          719   0.0     
gb|KHN26165.1|  Serine hydroxymethyltransferase, mitochondrial          711   0.0     
emb|CEG02148.1|  Serine hydroxymethyltransferase, pyridoxal phosp...    712   0.0     
ref|XP_003083071.1|  serine hydroxymet (ISS)                            710   0.0     
ref|XP_002505413.1|  predicted protein                                  702   0.0     Micromonas commoda
ref|XP_007141300.1|  hypothetical protein PHAVU_008G184200g             697   0.0     
gb|KDD76609.1|  serine hydroxymethyltransferase                         702   0.0     
gb|AAR07090.1|  putative glycine hydroxymethyltransferase               699   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006596396.1|  PREDICTED: serine hydroxymethyltransferase, ...    696   0.0     
ref|XP_003059685.1|  predicted protein                                  693   0.0     
gb|AAL33594.1|  serine hydroxymethyltransferase                         685   0.0     Zea mays [maize]
ref|XP_007510016.1|  serine hydroxymethyltransferase                    692   0.0     
ref|XP_005843102.1|  serine hydroxymethyltransferase                    681   0.0     
ref|XP_005852729.1|  glycine hydroxymethyltransferase                   668   0.0     
emb|CDX90395.1|  BnaA08g15890D                                          662   0.0     
ref|XP_006675126.1|  hypothetical protein BATDEDRAFT_15526              667   0.0     
ref|XP_002959040.1|  serine hydroxymethyltransferase                    660   0.0     
ref|XP_002177340.1|  serine hydroxymethyltransferase                    661   0.0     Phaeodactylum tricornutum CCAP 1055/1
gb|ESA09573.1|  hypothetical protein GLOINDRAFT_203282                  660   0.0     
ref|XP_002683182.1|  hydroxymethyltransferase                           660   0.0     Naegleria gruberi strain NEG-M
gb|EXX50872.1|  glycine hydroxymethyltransferase SHM2                   657   0.0     
gb|EYU36434.1|  hypothetical protein MIMGU_mgv1a0053861mg               649   0.0     
ref|XP_008866643.1|  hypothetical protein H310_04194                    654   0.0     
ref|XP_005717158.1|  serine hydroxymethyltransferase, cytosolic (...    652   0.0     
gb|KDO26013.1|  serine hydroxymethyltransferase                         652   0.0     
ref|XP_008608875.1|  serine hydroxymethyltransferase, mitochondrial     650   0.0     
gb|ETI42217.1|  hypothetical protein F443_12615                         650   0.0     
ref|XP_008908968.1|  hypothetical protein PPTG_13257                    650   0.0     
ref|XP_009534723.1|  hypothetical protein PHYSODRAFT_361869             649   0.0     
gb|EYU36435.1|  hypothetical protein MIMGU_mgv1a0053861mg               642   0.0     
gb|ETP40070.1|  hypothetical protein F442_12532                         648   0.0     
emb|CEG84714.1|  Putative Serine hydroxymethyltransferase               647   0.0     
ref|XP_002998553.1|  serine hydroxymethyltransferase, mitochondri...    647   0.0     
emb|CEG73561.1|  Putative Serine hydroxymethyltransferase               646   0.0     
emb|CBN75444.1|  serine hydroxymethyltransferase 2                      645   0.0     
ref|XP_002295557.1|  glycine or serine hydroxymethyltransferase, ...    647   0.0     Thalassiosira pseudonana CCMP1335
gb|EPB83205.1|  serine hydroxymethyltransferase, mitochondrial          645   0.0     
gb|EIE82694.1|  hypothetical protein RO3G_07399                         645   0.0     
emb|CDS07753.1|  hypothetical protein LRAMOSA01702                      644   0.0     
emb|CDH48796.1|  serine hydroxymethyltransferase                        643   0.0     
ref|XP_009832078.1|  hypothetical protein H257_08015                    642   0.0     
ref|XP_005826504.1|  hypothetical protein GUITHDRAFT_160011             640   0.0     
emb|CCA16797.1|  unnamed protein product                                641   0.0     
emb|CCI42335.1|  unnamed protein product                                640   0.0     
emb|CEJ01602.1|  Putative Serine hydroxymethyltransferase               639   0.0     
ref|XP_005785878.1|  hypothetical protein EMIHUDRAFT_429491             638   0.0     
ref|XP_005704469.1|  glycine/serine hydroxymethyltransferase            636   0.0     
ref|XP_006379384.1|  hypothetical protein POPTR_0008s00350g             630   0.0     
emb|CEG73562.1|  Putative Serine hydroxymethyltransferase               635   0.0     
ref|XP_010104572.1|  Serine hydroxymethyltransferase                    628   0.0     
ref|XP_009776303.1|  PREDICTED: serine hydroxymethyltransferase, ...    625   0.0     
gb|KDO78681.1|  hypothetical protein CISIN_1g018231mg                   625   0.0     
gb|EWY91189.1|  serine hydroxymethyltransferase, mitochondrial          622   0.0     
ref|XP_002175037.2|  serine hydroxymethyltransferase Shm2               620   0.0     Schizosaccharomyces japonicus yFS275
ref|XP_005537546.1|  serine hydroxymethyltransferase, cytosolic         620   0.0     
gb|EXM32275.1|  serine hydroxymethyltransferase, mitochondrial          620   0.0     
gb|EMT63779.1|  Putative serine hydroxymethyltransferase, mitocho...    619   0.0     
gb|ENH62761.1|  Putative serine hydroxymethyltransferase, mitocho...    619   0.0     
gb|EGU80240.1|  hypothetical protein FOXB_09167                         619   0.0     
ref|XP_002494026.1|  Mitochondrial serine hydroxymethyltransferase      618   0.0     Komagataella phaffii GS115
gb|KFH72243.1|  glycine hydroxymethyltransferase                        619   0.0     
gb|EXK39849.1|  serine hydroxymethyltransferase, mitochondrial          618   0.0     
ref|XP_005098438.1|  PREDICTED: serine hydroxymethyltransferase, ...    616   0.0     
gb|EWG39983.1|  serine hydroxymethyltransferase, mitochondrial          617   0.0     
gb|KDO78680.1|  hypothetical protein CISIN_1g018231mg                   611   0.0     
gb|KGO39556.1|  Pyridoxal phosphate-dependent transferase, major ...    618   0.0     
gb|EYU24308.1|  hypothetical protein MIMGU_mgv1a0229941mg               610   0.0     
gb|KFP04745.1|  hypothetical protein N300_00700                         613   0.0     
gb|ESX01441.1|  Serine hydroxymethyltransferase, mitochondrial          615   0.0     
ref|XP_003612955.1|  Serine hydroxymethyltransferase                    608   0.0     
ref|XP_003126345.1|  PREDICTED: serine hydroxymethyltransferase, ...    614   0.0     
gb|ESU16513.1|  serine hydroxymethyltransferase                         615   0.0     
ref|XP_010285381.1|  PREDICTED: serine hydroxymethyltransferase, ...    613   0.0     
emb|CCT68776.1|  probable glycine hydroxymethyltransferase              615   0.0     
gb|EKV13325.1|  Serine hydroxymethyltransferase                         615   0.0     
emb|CCG80581.1|  Probable serine hydroxymethyltransferase, cytosolic    613   0.0     
gb|KGO64975.1|  Pyridoxal phosphate-dependent transferase, major ...    615   0.0     
ref|XP_002550843.1|  serine hydroxymethyltransferase, mitochondri...    613   0.0     Candida tropicalis MYA-3404
gb|ADE75872.1|  unknown                                                 615   0.0     
emb|CDM26957.1|  Putative serine hydroxymethyltransferase, mitoch...    615   0.0     
ref|XP_002837687.1|  hypothetical protein                               613   0.0     Tuber melanosporum Mel28
ref|XP_003002478.1|  serine hydroxymethyltransferase                    614   0.0     
ref|XP_711664.1|  hypothetical protein CaO19.8922                       613   0.0     Candida albicans SC5314
ref|XP_002558936.1|  Pc13g05010                                         614   0.0     Penicillium rubens Wisconsin 54-1255
ref|XP_009261600.1|  hypothetical protein FPSE_10208                    613   0.0     
ref|XP_003481682.1|  PREDICTED: serine hydroxymethyltransferase, ...    613   0.0     
ref|XP_005986325.1|  PREDICTED: serine hydroxymethyltransferase, ...    612   0.0     
gb|KGQ82275.1|  serine hydroxymethyltransferase, mitochondrial          612   0.0     
gb|KGQ83654.1|  serine hydroxymethyltransferase, mitochondrial          612   0.0     
ref|XP_005514191.1|  PREDICTED: serine hydroxymethyltransferase, ...    615   0.0     
ref|XP_008497057.1|  PREDICTED: serine hydroxymethyltransferase, ...    618   0.0     
ref|XP_002421509.1|  glycine hydroxymethyltransferase, putative; ...    612   0.0     Candida dubliniensis CD36
gb|ACI34054.1|  Serine hydroxymethyltransferase, mitochondrial pr...    612   0.0     Salmo salar
emb|CBN80827.1|  Serine hydroxymethyltransferase, mitochondrial         612   0.0     
ref|XP_005986324.1|  PREDICTED: serine hydroxymethyltransferase, ...    613   0.0     
emb|CDR41489.1|  CYFA0S07e02806g1_1                                     610   0.0     
gb|EDK41513.2|  conserved hypothetical protein                          611   0.0     Meyerozyma guilliermondii
ref|XP_007548565.1|  PREDICTED: serine hydroxymethyltransferase, ...    612   0.0     
ref|XP_003871181.1|  Shm1 mitochondrial serine hydroxymethyltrans...    611   0.0     
ref|XP_009957049.1|  PREDICTED: serine hydroxymethyltransferase, ...    610   0.0     
ref|XP_711682.1|  hypothetical protein CaO19.1342                       611   0.0     Candida albicans SC5314
ref|XP_006897659.1|  PREDICTED: serine hydroxymethyltransferase, ...    611   0.0     
gb|KGR02410.1|  serine hydroxymethyltransferase, mitochondrial          611   0.0     
ref|XP_002973033.1|  hypothetical protein SELMODRAFT_232016             609   0.0     
gb|AAA63258.1|  serine hydroxymethyltransferase                         610   0.0     Homo sapiens [man]
gb|KDR12053.1|  Serine hydroxymethyltransferase, mitochondrial          610   0.0     
ref|XP_007425282.1|  PREDICTED: serine hydroxymethyltransferase, ...    611   0.0     
gb|EEQ47107.1|  serine hydroxymethyltransferase, mitochondrial pr...    610   0.0     Candida albicans
ref|XP_001482591.1|  conserved hypothetical protein                     610   0.0     Meyerozyma guilliermondii ATCC 6260
ref|XP_009564565.1|  PREDICTED: serine hydroxymethyltransferase, ...    611   0.0     
ref|XP_001385618.1|  Serine hydroxymethyltransferase, mitochondri...    610   0.0     Scheffersomyces stipitis CBS 6054
ref|XP_009467001.1|  PREDICTED: serine hydroxymethyltransferase, ...    611   0.0     
ref|XP_010387288.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_009246208.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
gb|KGQ84845.1|  serine hydroxymethyltransferase, mitochondrial          610   0.0     
ref|XP_010563501.1|  PREDICTED: serine hydroxymethyltransferase, ...    610   0.0     
ref|XP_010862895.1|  PREDICTED: serine hydroxymethyltransferase, ...    610   0.0     
emb|CAF96501.1|  unnamed protein product                                610   0.0     Tetraodon nigroviridis
ref|XP_004053472.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
gb|KFR01015.1|  hypothetical protein Y956_13687                         608   0.0     
ref|XP_001696797.1|  serine hydroxymethyltransferase 3                  609   0.0     
ref|XP_010387287.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_009280549.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_006077924.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
emb|CCE45351.1|  hypothetical protein CPAR2_703640                      609   0.0     
ref|XP_008283523.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_008926329.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|NP_001124748.1|  serine hydroxymethyltransferase, mitochondrial     609   0.0     
ref|XP_006093657.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_006757415.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
gb|KFO80130.1|  hypothetical protein N303_09846                         607   0.0     
ref|XP_010005897.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_004582986.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_005879073.1|  PREDICTED: serine hydroxymethyltransferase, ...    609   0.0     
ref|XP_005571357.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
gb|KFQ74962.1|  hypothetical protein N335_10412                         607   0.0     
ref|XP_010730423.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_005206589.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
gb|KFA60752.1|  hypothetical protein S40285_04727                       609   0.0     
ref|XP_003824922.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_005805324.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
gb|KEY66738.1|  hypothetical protein S7711_06784                        609   0.0     
ref|XP_004053470.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
gb|ESW98677.1|  Serine hydroxymethyltransferase, cytosolic              607   0.0     
gb|KFA47192.1|  hypothetical protein S40293_06715                       609   0.0     
ref|XP_010775142.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_002609556.1|  hypothetical protein BRAFLDRAFT_285686             608   0.0     
gb|KFA74486.1|  hypothetical protein S40288_08512                       609   0.0     
emb|CEJ92216.1|  Putative Serine hydroxymethyltransferase               609   0.0     
ref|XP_008146903.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_006629448.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|NP_001159829.1|  serine hydroxymethyltransferase, mitochondri...    607   0.0     
gb|ELU01860.1|  hypothetical protein CAPTEDRAFT_151243                  607   0.0     
ref|NP_001029454.1|  serine hydroxymethyltransferase, mitochondri...    608   0.0     
gb|EHK43590.1|  cytosolic glycine/serine hydroxymethyltransferase       608   0.0     
ref|XP_004582984.1|  PREDICTED: serine hydroxymethyltransferase, ...    610   0.0     
ref|XP_002740742.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
pdb|3OU5|A  Chain A, Human Mitochondrial Serine Hydroxymethyltran...    607   0.0     
ref|XP_006077923.1|  PREDICTED: serine hydroxymethyltransferase, ...    608   0.0     
ref|XP_005236867.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_002984501.1|  hypothetical protein SELMODRAFT_234535             605   0.0     
ref|XP_003405192.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_004068738.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
gb|AAP36780.1|  Homo sapiens serine hydroxymethyltransferase 2 (m...    607   0.0     
ref|XP_003906688.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_003824920.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
gb|KFM72735.1|  Serine hydroxymethyltransferase, mitochondrial          607   0.0     
gb|KFY72719.1|  hypothetical protein V499_07140                         609   0.0     
gb|KFP81286.1|  Serine hydroxymethyltransferase, cytosolic              606   0.0     
ref|NP_005403.2|  serine hydroxymethyltransferase, mitochondrial ...    607   0.0     
ref|XP_006685604.1|  serine hydroxymethyltransferase mitochondria...    606   0.0     
ref|XP_007253455.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_009074236.1|  PREDICTED: serine hydroxymethyltransferase, ...    606   0.0     
gb|EAW96996.1|  serine hydroxymethyltransferase 2 (mitochondrial)...    607   0.0     
ref|XP_007247897.1|  PREDICTED: serine hydroxymethyltransferase, ...    606   0.0     
ref|XP_006908996.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
dbj|BAD97275.1|  serine hydroxymethyltransferase 2 (mitochondrial...    607   0.0     
ref|XP_004200896.1|  Piso0_003506                                       606   0.0     
ref|NP_001007880.1|  serine hydroxymethyltransferase, mitochondrial     606   0.0     
gb|KFQ01222.1|  hypothetical protein N330_08401                         604   0.0     
ref|XP_008406674.1|  PREDICTED: serine hydroxymethyltransferase, ...    606   0.0     
emb|CDK27921.1|  unnamed protein product                                605   0.0     
ref|XP_008001935.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
emb|CAI46021.1|  hypothetical protein                                   605   0.0     
ref|XP_010306229.1|  PREDICTED: LOW QUALITY PROTEIN: serine hydro...    604   0.0     
ref|XP_003052972.1|  predicted protein                                  606   0.0     
ref|XP_008052815.1|  PREDICTED: serine hydroxymethyltransferase, ...    606   0.0     
gb|KFM09536.1|  hypothetical protein AS27_09768                         604   0.0     
ref|XP_005611386.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
sp|Q7S5N8.2|GLYM_NEUCR  RecName: Full=Putative serine hydroxymeth...    607   0.0     
gb|EKC19381.1|  Serine hydroxymethyltransferase, mitochondrial          605   0.0     
ref|XP_007907505.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_004547770.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_001488586.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_009033928.1|  hypothetical protein AURANDRAFT_20758              603   0.0     
ref|XP_001774400.1|  predicted protein                                  603   0.0     
ref|XP_004601688.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_005335721.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_004006603.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_005435806.1|  PREDICTED: serine hydroxymethyltransferase, ...    607   0.0     
ref|XP_009894960.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_008001934.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_004429349.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_005680363.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_005970657.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
gb|KFU83645.1|  hypothetical protein M959_12152                         602   0.0     
ref|XP_005282781.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_007467744.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
emb|CAH89659.1|  hypothetical protein                                   604   0.0     
gb|ELR05714.1|  glycine hydroxymethyltransferase                        605   0.0     
ref|XP_005680362.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
ref|XP_007103931.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
gb|KFQ89871.1|  hypothetical protein N337_03842                         602   0.0     
ref|XP_004601689.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_009479457.1|  PREDICTED: serine hydroxymethyltransferase, ...    603   0.0     
ref|NP_593668.2|  serine hydroxymethyltransferase Shm2 (predicted)      603   0.0     
ref|XP_004332684.1|  PREDICTED: LOW QUALITY PROTEIN: serine hydro...    604   0.0     
ref|XP_004650059.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_004650060.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_002916051.1|  PREDICTED: serine hydroxymethyltransferase, ...    604   0.0     
ref|XP_009260352.1|  hypothetical protein FPSE_08959                    604   0.0     
ref|XP_002617534.1|  serine hydroxymethyltransferase, mitochondri...    605   0.0     
ref|XP_007060119.1|  PREDICTED: serine hydroxymethyltransferase, ...    603   0.0     
gb|ETS00316.1|  serine hydroxymethyltransferase                         605   0.0     
gb|EFB28875.1|  hypothetical protein PANDA_004114                       603   0.0     
gb|ENH88060.1|  serine hydroxymethyltransferase                         604   0.0     
ref|XP_008531788.1|  PREDICTED: serine hydroxymethyltransferase, ...    605   0.0     
emb|CDK28516.1|  unnamed protein product                                602   0.0     
ref|XP_003476208.1|  PREDICTED: serine hydroxymethyltransferase, ...    603   0.0     
ref|XP_003710851.1|  serine hydroxymethyltransferase                    603   0.0     
ref|XP_004276574.1|  PREDICTED: serine hydroxymethyltransferase, ...    603   0.0     
ref|XP_003066194.1|  serine hydroxymethyltransferase, cytosolic, ...    603   0.0     
gb|KEZ40618.1|  Serine hydroxymethyltransferase, mitochondrial          604   0.0     
ref|XP_008600263.1|  serine hydroxymethyltransferase                    604   0.0     
ref|XP_004466224.1|  PREDICTED: serine hydroxymethyltransferase, ...    603   0.0     
ref|XP_007948206.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
dbj|BAG58915.1|  unnamed protein product                                602   0.0     
ref|XP_004379951.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
gb|KFO24543.1|  Serine hydroxymethyltransferase, mitochondrial          602   0.0     
ref|XP_010041224.1|  PREDICTED: serine hydroxymethyltransferase 3...    603   0.0     
ref|XP_001774431.1|  predicted protein                                  605   0.0     
ref|XP_010335519.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
gb|KID83411.1|  serine hydroxymethyltransferase                         603   0.0     
ref|XP_010642932.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|XP_007948205.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|XP_003228351.1|  PREDICTED: LOW QUALITY PROTEIN: serine hydro...    602   0.0     
ref|XP_388526.1|  hypothetical protein FG08350.1                        602   0.0     
ref|XP_008682075.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|NP_001087369.1|  serine hydroxymethyltransferase 2 (mitochond...    602   0.0     
ref|XP_006859526.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|XP_009159174.1|  serine hydroxymethyltransferase, cytosolic         601   0.0     
gb|KID97220.1|  serine hydroxymethyltransferase                         602   0.0     
ref|XP_001247153.1|  hypothetical serine hydroxymethyltransferase...    603   0.0     
gb|EFX79152.1|  hypothetical protein DAPPUDRAFT_52799                   600   0.0     
emb|CBX19676.1|  serine hydroxylmethyltransferase                       601   0.0     
ref|NP_001239245.1|  serine hydroxymethyltransferase, mitochondri...    602   0.0     
ref|XP_005397407.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|XP_010738588.1|  PREDICTED: serine hydroxymethyltransferase, ...    602   0.0     
ref|XP_007824431.1|  serine hydroxymethyltransferase                    602   0.0     
ref|XP_010390617.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
ref|XP_004071826.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
gb|EFW15703.1|  serine hydroxymethyltransferase                         602   0.0     
gb|EPS29141.1|  hypothetical protein PDE_04090                          602   0.0     
gb|KID66928.1|  serine hydroxymethyltransferase                         602   0.0     
ref|XP_005625593.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_005358065.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
ref|XP_005358064.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
ref|XP_849244.1|  PREDICTED: serine hydroxymethyltransferase, mit...    601   0.0     
ref|XP_007425110.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
gb|EQB48549.1|  serine hydroxymethyltransferase                         602   0.0     
ref|XP_006695078.1|  serine hydroxymethyltransferase-like protein       602   0.0     
ref|XP_004379949.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
gb|KFH46791.1|  putative serine hydroxymethyltransferase-like pro...    602   0.0     
ref|XP_008113294.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
gb|KDB16190.1|  serine hydroxymethyltransferase precursor               600   0.0     
ref|NP_001080356.1|  serine hydroxymethyltransferase 1 (soluble)        600   0.0     
pir||A33696  glycine hydroxymethyltransferase (EC 2.1.2.1), mitoc...    600   0.0  
gb|KFM28420.1|  Serine hydroxymethyltransferase, mitochondrial          602   0.0     
ref|XP_005625592.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
gb|KEQ59449.1|  serine hydroxymethyltransferas-like protein             601   0.0     
emb|CAG03229.1|  unnamed protein product                                601   0.0     
ref|XP_007081592.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
ref|NP_082506.1|  serine hydroxymethyltransferase, mitochondrial ...    601   0.0     
ref|XP_006241515.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_004700588.1|  PREDICTED: serine hydroxymethyltransferase, ...    601   0.0     
ref|XP_003790603.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|NP_001008323.1|  serine hydroxymethyltransferase, mitochondrial     600   0.0     
ref|XP_008577885.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_006973338.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
emb|CCX31350.1|  Similar to Putative serine hydroxymethyltransfer...    600   0.0     
ref|XP_008631647.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|NP_001015914.1|  serine hydroxymethyltransferase, cytosolic         600   0.0     
gb|EPE08291.1|  serine hydroxymethyltransferase                         602   0.0     
ref|XP_008842308.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_003988982.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_003062849.1|  predicted protein                                  600   0.0     
ref|XP_006171967.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_010944589.1|  PREDICTED: serine hydroxymethyltransferase, ...    599   0.0     
ref|XP_003790601.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_009002311.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_006182551.1|  PREDICTED: serine hydroxymethyltransferase, ...    600   0.0     
ref|XP_007829867.1|  serine hydroxymethyltransferase                    602   0.0     
ref|XP_005189599.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_005189598.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
sp|O13425.1|GLYM_CANAX  RecName: Full=Serine hydroxymethyltransfe...    599   0.0     
ref|XP_504017.1|  YALI0E16346p                                          598   0.0     
ref|XP_003664637.1|  hypothetical protein MYCTH_2307642                 601   0.0     
gb|EDL24511.1|  serine hydroxymethyl transferase 2 (mitochondrial...    600   0.0     
ref|XP_009380456.1|  PREDICTED: serine hydroxymethyltransferase 3...    600   0.0     
gb|EYE97343.1|  cytosolic hydroxymethyltransferase                      600   0.0     
ref|XP_004401766.1|  PREDICTED: serine hydroxymethyltransferase, ...    599   0.0     
gb|EPY53340.1|  glycine hydroxymethyltransferase                        598   0.0     
emb|CEG01896.1|  Serine hydroxymethyltransferase                        599   0.0     
ref|XP_005289056.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_003651073.1|  hypothetical protein THITE_2111027                 601   0.0     
gb|KHN96163.1|  serine hydroxymethyltransferase                         599   0.0     
ref|XP_002126094.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
gb|EWC46927.1|  mitochondrial putative serine hydroxymethyltransf...    598   0.0     
ref|XP_008318876.1|  PREDICTED: serine hydroxymethyltransferase, ...    599   0.0     
gb|AAH04825.1|  Serine hydroxymethyltransferase 2 (mitochondrial)       599   0.0     
ref|XP_002493843.1|  Cytosolic serine hydroxymethyltransferase          597   0.0     
ref|XP_006740129.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_010944588.1|  PREDICTED: serine hydroxymethyltransferase, ...    599   0.0     
ref|XP_006740127.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_009560478.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
gb|ETN65192.1|  serine hydroxymethyltransferase                         597   0.0     
ref|XP_005523122.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_004891999.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
gb|EEH07765.1|  serine hydroxymethyltransferase                         600   0.0     
ref|XP_006217993.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
ref|XP_009090019.1|  PREDICTED: serine hydroxymethyltransferase, ...    597   0.0     
ref|NP_001171839.1|  serine hydroxymethyltransferase, mitochondri...    597   0.0     
ref|XP_003084275.1|  glycine hydroxymethyltransferase, putative /...    600   0.0     
gb|KFX94924.1|  hypothetical protein V490_04088                         608   0.0     
gb|EFQ34050.1|  serine hydroxymethyltransferase                         599   0.0     
ref|XP_005079807.1|  PREDICTED: serine hydroxymethyltransferase, ...    598   0.0     
gb|EGC41874.1|  serine hydroxymethyltransferase                         599   0.0     
ref|XP_003051081.1|  predicted protein                                  598   0.0     
emb|CCF34562.1|  serine hydroxymethyltransferase                        598   0.0     



>ref|XP_009597687.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=519

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/509 (93%), Positives = 493/509 (97%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SS+++KP+K LYN GGSLYYMSSL +EAVY+KEK  VSWPKQLNA LE VDPEIADIIEL
Sbjct  11    SSTVDKPVKRLYNIGGSLYYMSSLPNEAVYDKEKSGVSWPKQLNAPLEVVDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  71    EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTD KK
Sbjct  131   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDMKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  251   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQA TPEYRAYQEQVLSNCSKFAQ
Sbjct  311   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAITPEYRAYQEQVLSNCSKFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L+E GYELVSGGTENHLVLVNLKNKGIDGSRVEK+LE+VHIAANKNTVPGDVSAMVPGG
Sbjct  371   ALMENGYELVSGGTENHLVLVNLKNKGIDGSRVEKILEAVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVKL+VK+KA TQGTKLK+FVATLQSS  I++E
Sbjct  431   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKLAVKVKAETQGTKLKDFVATLQSSAPIKSE  490

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  491   IAKLRHDVEEYAKQFPTIGFEKETMKYKN  519



>ref|XP_010027978.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW54636.1| hypothetical protein EUGRSUZ_I00580 [Eucalyptus grandis]
Length=519

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/509 (91%), Positives = 491/509 (96%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSIEKP++ L NGGGS+ YM+SL +EAVYEKEK  V+WPKQLNA LE VDPE+ADIIEL
Sbjct  11    SSSIEKPLRPLINGGGSVCYMASLPNEAVYEKEKNGVTWPKQLNAPLEAVDPEVADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGV+PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAILLADMAHISGLVAAGVVPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNC+KFAQ
Sbjct  311   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCAKFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL EKGYELVSGGTENHLVLVNLKNKGIDGSRVEKV+ESVHIAANKNTVPGDVSAMVPGG
Sbjct  371   TLTEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVMESVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVAE+FDAAV L+VKIKA T+GTKLK+F++T+QSS   Q+ 
Sbjct  431   IRMGTPALTSRGFIEEDFVKVAEFFDAAVGLAVKIKAQTKGTKLKDFLSTMQSSPDFQSG  490

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  491   IAKLRHDVEEYAKQFPTIGFEKATMKYKN  519



>ref|XP_009597686.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=535

 Score =   948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/525 (90%), Positives = 493/525 (94%), Gaps = 16/525 (3%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SS+++KP+K LYN GGSLYYMSSL +EAVY+KEK  VSWPKQLNA LE VDPEIADIIEL
Sbjct  11    SSTVDKPVKRLYNIGGSLYYMSSLPNEAVYDKEKSGVSWPKQLNAPLEVVDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  71    EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTD KK
Sbjct  131   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDMKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  251   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQA TPEYRAYQEQVLSNCSKFAQ
Sbjct  311   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAITPEYRAYQEQVLSNCSKFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNK----------------GIDGSRVEKVLESVHIAA  1430
              L+E GYELVSGGTENHLVLVNLKNK                GIDGSRVEK+LE+VHIAA
Sbjct  371   ALMENGYELVSGGTENHLVLVNLKNKEFAGSSHGNSLLQKCRGIDGSRVEKILEAVHIAA  430

Query  1431  NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKL  1610
             NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE+FDAAVKL+VK+KA TQGTKL
Sbjct  431   NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEFFDAAVKLAVKVKAETQGTKL  490

Query  1611  KEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             K+FVATLQSS  I++EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  491   KDFVATLQSSAPIKSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  535



>ref|XP_009604710.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=518

 Score =   946 bits (2446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/509 (92%), Positives = 485/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPIK     GGSLYYMSSL +EAVYEKEK  V+WPKQLNA LEEVDPEIADIIEL
Sbjct  11    SSSVDKPIK-RLYNGGSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEEVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  250   KQKAIMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQA TPEYRAYQEQ LSNCSKFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAMTPEYRAYQEQCLSNCSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALAGMGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVAE+FDAAVK++VKIK   QGTKLK+FV TLQSS +IQ+E
Sbjct  430   IRMGTPALTSRGFIEEDFVKVAEFFDAAVKIAVKIKTEAQGTKLKDFVTTLQSSASIQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH VEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHGVEEYAKQFPTIGFEKETMKYKN  518



>ref|XP_009800891.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Nicotiana 
sylvestris]
Length=518

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/509 (92%), Positives = 485/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPIK     GGSLYYMSSL +EAVYEKEK  V+WPKQLNA LEEVDPEIADIIEL
Sbjct  11    SSSVDKPIK-RLYNGGSLYYMSSLPNEAVYEKEKNGVTWPKQLNAPLEEVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  250   KQKAIMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQEQ LSNCSKFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAMTPEYKAYQEQCLSNCSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALAGMGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVAE+FDAAVK++VKIK   QGTKLK+FV TLQSS +IQ+E
Sbjct  430   IRMGTPALTSRGFIEEDFVKVAEFFDAAVKIAVKIKGEAQGTKLKDFVTTLQSSASIQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH VEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHGVEEYAKQFPTIGFEKETMKYKN  518



>ref|NP_001237509.1| serine hydroxymethyltransferase 5 [Glycine max]
 ref|XP_006601749.1| PREDICTED: serine hydroxymethyltransferase 5 isoform X1 [Glycine 
max]
 gb|ACM45955.1| serine hydroxymethyltransferase 5 [Glycine max]
Length=518

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/509 (90%), Positives = 484/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N G   Y  S    EAVY+KE+  V+WPKQLNASLE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPLFNAGSLYYKSSLPD-EAVYDKERPGVTWPKQLNASLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+R+RKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERVRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKE+LYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN  KFAQ
Sbjct  310   GKELLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSFKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALSERGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVKL+VKIK  ++GTKLK+F+AT+QSS   Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKLAVKIKGQSKGTKLKDFLATIQSSSTFQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVE+YAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHDVEDYAKQFPTIGFEKATMKYKN  518



>ref|XP_003612954.1| Serine hydroxymethyltransferase [Medicago truncatula]
 gb|ABY48142.1| serine-hydroxymethyltransferase [Medicago truncatula]
 gb|AES95912.1| serine hydroxymethyltransferase [Medicago truncatula]
Length=518

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/481 (92%), Positives = 468/481 (97%), Gaps = 0/481 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KE  +VSWPKQLN+SLEE+DPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYDKENSRVSWPKQLNSSLEEIDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS+MTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGSPSNF
Sbjct  96    GSIMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
              VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  156   HVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV YDYEDKINQAVFPGLQGGPHN
Sbjct  276   DYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVFYDYEDKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNC+KFAQ L EKGYELVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTPEYKAYQEQVLSNCAKFAQALSEKGYELVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD
Sbjct  396   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             A+V L++KIKA ++GTKLK+FV TLQSS  +Q+EI+KLRHDVEE+AKQFPTIGFEK +MK
Sbjct  456   ASVNLALKIKAESKGTKLKDFVETLQSSSYVQSEISKLRHDVEEFAKQFPTIGFEKSSMK  515

Query  1737  Y  1739
             Y
Sbjct  516   Y  516



>ref|XP_011073635.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Sesamum 
indicum]
Length=515

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/509 (92%), Positives = 487/509 (96%), Gaps = 4/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP+K  ++ GGSLYYMSSL +EAVYEKEK  V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SSSIDKPVK-RFSNGGSLYYMSSLPNEAVYEKEKTGVTWPKQLNAPLEVVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYSRIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL EKGYELVSGGT+NHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLAEKGYELVSGGTDNHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVKL+VKIKA T+GTKLK+F+ T+ S    Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKLAVKIKADTKGTKLKDFLTTMPS---FQSE  486

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  487   ITKLRHDVEEYAKQFPTIGFEKETMKYKN  515



>ref|NP_001275486.1| serine hydroxymethyltransferase, mitochondrial [Solanum tuberosum]
 sp|P50433.1|GLYM_SOLTU RecName: Full=Serine hydroxymethyltransferase, mitochondrial; 
Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; 
AltName: Full=Serine methylase; Flags: Precursor [Solanum tuberosum]
 emb|CAA81082.1| glycine hydroxymethyltransferase [Solanum tuberosum]
Length=518

 Score =   942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/509 (90%), Positives = 488/509 (96%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             S++++KP+K+LYNGG   Y  S  + EAVY+KEK  V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SATVDKPVKSLYNGGSLYYMSSLPN-EAVYDKEKSGVAWPKQLNAPLEVVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVC+
Sbjct  190   ISAVSIFFETMPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCN  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN SKFAQ
Sbjct  310   GKEVFYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L EKGYELVSGGT+NHLVLVN+KNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALGEKGYELVSGGTDNHLVLVNMKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVA++FDAAVK++VK+KA TQGTKLK+FVATL+SS  I++E
Sbjct  430   IRMGTPALTSRGFLEEDFVKVADFFDAAVKIAVKVKAETQGTKLKDFVATLESSAPIKSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHDVEEYAKQFPTIGFEKETMKYKN  518



>ref|XP_002262872.2| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 ref|XP_010646400.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 ref|XP_010646401.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 ref|XP_010646402.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 emb|CBI25704.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/509 (90%), Positives = 486/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KP+++++NGG   Y  S  + EAVYEKEK +V+WPKQLNA L  VDPEIADIIEL
Sbjct  11    SSSVDKPVRSVFNGGSIYYMASLPN-EAVYEKEKSRVTWPKQLNAPLGVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGS+MTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSIMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLK H+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKAHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNCSKFA+
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTSEYKAYQEQVLSNCSKFAE  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL++KGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLIKKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAEYFDAAV ++VKIKA T GTKLK+F+AT+QSS  +Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEYFDAAVTVAVKIKAETTGTKLKDFLATMQSSPHLQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHEVEEYAKQFPTIGFEKETMKYKN  518



>gb|KDP32169.1| hypothetical protein JCGZ_12630 [Jatropha curcas]
Length=515

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/509 (90%), Positives = 481/509 (94%), Gaps = 4/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KPI+ L+N     Y  S  + EAVYEKEK  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSFDKPIRPLFNATSVYYKSSLPN-EAVYEKEKSGVTWPKQLNAPLEAVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYSRIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G++VLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFA+
Sbjct  310   GQQVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAE  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TLVEKGY+LVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLVEKGYDLVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAE+FDAAVKL+VKIKAAT+GTKLK+F+A L +    Q E
Sbjct  430   IRMGTPALTSRGFVEEDFAKVAEFFDAAVKLAVKIKAATKGTKLKDFLAALPN---FQPE  486

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVE YAKQFPTIGFEK TMKYKN
Sbjct  487   IAKLRHDVEGYAKQFPTIGFEKETMKYKN  515



>ref|XP_004231981.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Solanum 
lycopersicum]
 ref|XP_010316057.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Solanum 
lycopersicum]
Length=518

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/509 (90%), Positives = 486/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             S++I+KP+K+LYNGG   Y  S  + EAVY+KEK  V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SATIDKPVKSLYNGGSIYYMSSLPN-EAVYDKEKSGVAWPKQLNAPLEVVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVC+
Sbjct  190   ISAVSIFFETMPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCN  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN +KFAQ
Sbjct  310   GKEVFYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSAKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L EKGYELVSGGT+NHLVLVN+KNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALEEKGYELVSGGTDNHLVLVNMKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVA++FDAAVK++VK+KA TQGTKLK+FV+TL+SS  I++E
Sbjct  430   IRMGTPALTSRGFLEEDFVKVADFFDAAVKIAVKVKAETQGTKLKDFVSTLESSAPIKSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLR DVEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRQDVEEYAKQFPTIGFEKETMKYKN  518



>gb|KHN46622.1| Serine hydroxymethyltransferase, mitochondrial [Glycine soja]
Length=534

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/506 (90%), Positives = 481/506 (95%), Gaps = 1/506 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N G   Y  S    EAVY+KE+  V+WPKQLNASLE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPLFNAGSLYYKSSLPD-EAVYDKERPGVTWPKQLNASLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+R+RKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERVRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKE+LYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN  KFAQ
Sbjct  310   GKELLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSFKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALSERGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVKL+VKIK  ++GTKLK+F+AT+QSS   Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKLAVKIKGQSKGTKLKDFLATIQSSSTFQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             IAKLRHDVE+YAKQFPTIGFEK TMK
Sbjct  490   IAKLRHDVEDYAKQFPTIGFEKATMK  515



>ref|XP_004512553.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004512554.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=519

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 466/481 (97%), Gaps = 0/481 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA+Y+KE  +V+WPKQLN+ LE VDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  37    EAIYDKENSRVTWPKQLNSPLEVVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS+MTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGSPSNF
Sbjct  97    GSIMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  217   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKG+KEVNK+G EV YDYEDKINQAVFPGLQGGPHN
Sbjct  277   DYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKKGNEVFYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSN SKFAQTL EKGYELVSGGTENHLVLVNLKNK
Sbjct  337   HTITGLAVALKQATTPEYKAYQEQVLSNSSKFAQTLSEKGYELVSGGTENHLVLVNLKNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD
Sbjct  397   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             A+V L++K+KA ++GTKLK+FV  LQSS ++Q+EIAKLRHDVEE+AKQFPTIGFEK TMK
Sbjct  457   ASVNLALKVKAESKGTKLKDFVEALQSSSSVQSEIAKLRHDVEEFAKQFPTIGFEKATMK  516

Query  1737  Y  1739
             Y
Sbjct  517   Y  517



>gb|KHN03621.1| Serine hydroxymethyltransferase, mitochondrial [Glycine soja]
Length=518

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/509 (89%), Positives = 482/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N G   Y  S    EAVY+KE+  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPLFNAGSLYYKSSLPD-EAVYDKERPGVTWPKQLNAPLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+R+RKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERVRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN  KFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSFKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+ YELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALSERSYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVK++VKIK  ++GTKLK+F+AT++SS   Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKIAVKIKGESKGTKLKDFLATIESSSTFQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGF+K TMK+KN
Sbjct  490   IAKLRHDVEEYAKQFPTIGFDKATMKHKN  518



>ref|XP_006426223.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
 ref|XP_006426225.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
 gb|ESR39463.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
 gb|ESR39465.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
Length=517

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/483 (93%), Positives = 466/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  V+WPKQLNA LE VDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAV
Sbjct  36    EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  156   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+KQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YDYE+KINQAVFPGLQGGPHN
Sbjct  276   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQTL+E GYELVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQTLLEMGYELVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
              IDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA +FD
Sbjct  396   RIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL+VKIK+ TQGTKLK+FVAT QS++  Q+EIAKLRHDVEEYAKQFPTIGFEK TMK
Sbjct  456   AAVKLAVKIKSETQGTKLKDFVATTQSAN-FQSEIAKLRHDVEEYAKQFPTIGFEKETMK  514

Query  1737  YKN  1745
             YKN
Sbjct  515   YKN  517



>gb|ABO61382.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides]
Length=520

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/509 (90%), Positives = 483/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KP++       SLYYMSSL +EAVYEKEK  VSWPKQLNA LE VDP++ADIIEL
Sbjct  13    SSSFDKPLRPALFKATSLYYMSSLPNEAVYEKEKPGVSWPKQLNAPLEAVDPQVADIIEL  72

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  73    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  132

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPA+WGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  133   ALEAFRLDPAQWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  192

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  193   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  252

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAA VIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  253   KQKAILLADMAHISGLVAADVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  312

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNC+KFAQ
Sbjct  313   GKEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTVEYKAYQEQVLSNCAKFAQ  372

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  373   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  432

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++FDAAVK++VKIKA T+GTKLK+F+AT QS+   Q+E
Sbjct  433   IRMGTPALTSRGFVEEDFAKVADFFDAAVKVAVKIKAETKGTKLKDFLAT-QSAPHFQSE  491

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+KLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  492   ISKLRHDVEEYAKQFPTIGFEKETMKYKN  520



>ref|XP_011046572.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial-like 
[Populus euphratica]
 ref|XP_011046573.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial-like 
[Populus euphratica]
Length=520

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/509 (90%), Positives = 482/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KP++       SLYYMSSL +EAVYEKEK  VSWPKQLNA LE VDP++ADIIEL
Sbjct  13    SSSFDKPLRPALFKATSLYYMSSLPNEAVYEKEKPGVSWPKQLNAPLEAVDPQVADIIEL  72

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  73    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  132

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  133   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  192

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  193   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  252

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAA VIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  253   KQKAILLADMAHISGLVAADVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  312

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNC+KFAQ
Sbjct  313   GKEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTVEYKAYQEQVLSNCAKFAQ  372

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  373   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  432

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++FDAAVKL+VKIKA T+GTKLK+F+AT QS+   Q+E
Sbjct  433   IRMGTPALTSRGFVEEDFAKVADFFDAAVKLAVKIKAETKGTKLKDFLAT-QSAPHFQSE  491

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+KLR DVEEYAKQFPTIGFEK TMKYKN
Sbjct  492   ISKLRRDVEEYAKQFPTIGFEKETMKYKN  520



>ref|XP_006466352.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Citrus sinensis]
Length=515

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/483 (93%), Positives = 466/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  V+WPKQLNA LE VDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAV
Sbjct  34    EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNK SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  94    GSVMTNKNSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+KQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YDYE+KINQAVFPGLQGGPHN
Sbjct  274   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQTL+E GYELVSGGTENHLVLVNLKNK
Sbjct  334   HTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQTLLEMGYELVSGGTENHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA +FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL+VKIK+ TQGTKLK+FVAT QS++  Q+EIAKLRHDVEEYAKQFPTIGFEK TMK
Sbjct  454   AAVKLTVKIKSETQGTKLKDFVATTQSAN-FQSEIAKLRHDVEEYAKQFPTIGFEKETMK  512

Query  1737  YKN  1745
             YKN
Sbjct  513   YKN  515



>ref|XP_010244692.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Nelumbo nucifera]
Length=522

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/483 (91%), Positives = 469/483 (97%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KEK +V+WPKQLNA LEEVDPEIA+IIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  40    EAVYDKEKSRVAWPKQLNAPLEEVDPEIANIIELEKARQWKGLELIPSENFTSVSVMQAV  99

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS+MTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQ LSGSP+NF
Sbjct  100   GSIMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQSLSGSPANF  159

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  160   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  219

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  220   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  279

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN
Sbjct  280   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  339

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQAT PEY+AYQEQVL NCSKFA+ LVEKGYELVSGGTENHLVLVNLKNK
Sbjct  340   HTISGLAVALKQATYPEYKAYQEQVLRNCSKFAERLVEKGYELVSGGTENHLVLVNLKNK  399

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  400   GIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  459

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
              AVKL++KIKA T+GTKLK+F+ T+Q+S +IQ+EI+KLRH+VEEYAKQFPTIGF+K TMK
Sbjct  460   TAVKLALKIKAETKGTKLKDFLGTIQASASIQSEISKLRHEVEEYAKQFPTIGFKKETMK  519

Query  1737  YKN  1745
             YK+
Sbjct  520   YKD  522



>ref|XP_002527226.1| serine hydroxymethyltransferase, putative [Ricinus communis]
 gb|EEF35152.1| serine hydroxymethyltransferase, putative [Ricinus communis]
Length=515

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/509 (89%), Positives = 477/509 (94%), Gaps = 4/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L+N     Y  S  + EAVYEKEK   +WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPIRPLFNATSHCYMSSLPN-EAVYEKEKSGATWPKQLNAPLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY+RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYERIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQ+VFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSNC+KFAQ
Sbjct  310   GKEVLYDYEDKINQSVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNCAKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL +KGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLAQKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAE+FDAAVKL+VKIK  T+GTKLK+F+AT+      Q++
Sbjct  430   IRMGTPALTSRGFIEEDFAKVAEFFDAAVKLAVKIKGETKGTKLKDFLATIPQ---FQSD  486

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRH VEEYAKQFPTIGFEK TMKYKN
Sbjct  487   ITKLRHAVEEYAKQFPTIGFEKGTMKYKN  515



>ref|XP_006584499.1| PREDICTED: serine hydroxymethyltransferase 3 isoform X1 [Glycine 
max]
Length=518

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/509 (89%), Positives = 481/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N G   Y  S    EAVY+KE+  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPLFNAGSLYYKSSLPD-EAVYDKERPGVTWPKQLNAPLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+R+RKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERVRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN  KFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSFKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+ YELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALSERSYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVK++VKIK  ++GTKLK+F+AT++SS   Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKIAVKIKGESKGTKLKDFLATIESSSTFQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLR DVEEYAKQFPTIGF+K TMK+KN
Sbjct  490   IAKLRLDVEEYAKQFPTIGFDKATMKHKN  518



>ref|XP_002310916.2| Serine hydroxymethyltransferase family protein [Populus trichocarpa]
 gb|ABO61377.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides]
 gb|EEE88283.2| Serine hydroxymethyltransferase family protein [Populus trichocarpa]
Length=520

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/508 (90%), Positives = 481/508 (95%), Gaps = 1/508 (0%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNCSKFAQ+
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTLEYKAYQEQVLSNCSKFAQS  373

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  374   LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  433

Query  1482  RMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEI  1661
             RMGTPALTSRGFVEEDF KVA++FDA+VKL+VK+KA T+GTKLK+F+ T+QS+   Q+EI
Sbjct  434   RMGTPALTSRGFVEEDFAKVADFFDASVKLAVKMKAETKGTKLKDFLVTMQSAH-FQSEI  492

Query  1662  AKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +KLRH+VEEYAKQFPTIGF K TMKYKN
Sbjct  493   SKLRHEVEEYAKQFPTIGFNKETMKYKN  520



>ref|XP_002315363.2| Serine hydroxymethyltransferase family protein [Populus trichocarpa]
 gb|EEF01534.2| Serine hydroxymethyltransferase family protein [Populus trichocarpa]
Length=520

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/509 (90%), Positives = 482/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KP++       SLYYMSSL +EAVYEKEK  VSWPKQLNA LE VDP++ADIIEL
Sbjct  13    SSSFDKPLRPGLFKATSLYYMSSLPNEAVYEKEKPGVSWPKQLNAPLEAVDPQVADIIEL  72

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  73    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  132

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  133   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  192

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  193   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  252

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAA VIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  253   KQKAILLADMAHISGLVAADVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  312

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNC+KFAQ
Sbjct  313   GKEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTVEYKAYQEQVLSNCAKFAQ  372

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  373   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  432

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++FDAAVKL+V+IKA T+GTKLK+F+AT QS+   Q+E
Sbjct  433   IRMGTPALTSRGFVEEDFAKVADFFDAAVKLAVEIKAETKGTKLKDFLAT-QSAPHFQSE  491

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+KLR DVEEYAKQFPTIGFEK TMKYKN
Sbjct  492   ISKLRRDVEEYAKQFPTIGFEKETMKYKN  520



>sp|P34899.1|GLYM_PEA RecName: Full=Serine hydroxymethyltransferase, mitochondrial; 
Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; 
AltName: Full=Serine methylase; Flags: Precursor [Pisum sativum]
 gb|AAA33687.1| serine hydroxymethyltransferase [Pisum sativum]
Length=518

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/481 (91%), Positives = 464/481 (96%), Gaps = 0/481 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KE  +V+WPKQLN+ LE +DPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYDKENPRVTWPKQLNSPLEVIDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGSPSNF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  156   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV YDYEDKINQAVFPGLQGGPHN
Sbjct  276   DYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVFYDYEDKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEYRAYQEQVLSN SKFA+ L EKGY+LVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTPEYRAYQEQVLSNSSKFAKALSEKGYDLVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD
Sbjct  396   GIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L++K+KA ++GTKLK+FV  LQ+S  +Q+EI+KL+HDVEE+AKQFPTIGFEK TMK
Sbjct  456   AAVSLALKVKAESKGTKLKDFVEALQTSSYVQSEISKLKHDVEEFAKQFPTIGFEKATMK  515

Query  1737  Y  1739
             Y
Sbjct  516   Y  516



>gb|ABK96241.1| unknown [Populus trichocarpa x Populus deltoides]
Length=520

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/509 (90%), Positives = 481/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KP++       SLYYMSSL +EAVYEKEK  VSWPKQLNA LE VDP++ADIIEL
Sbjct  13    SSSFDKPLRPGLFKATSLYYMSSLPNEAVYEKEKPGVSWPKQLNAPLEAVDPQVADIIEL  72

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  73    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  132

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  133   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  192

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  193   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  252

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA LLADMAHISGLVAA VIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  253   KQKATLLADMAHISGLVAADVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  312

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNC+KFAQ
Sbjct  313   GKEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTVEYKAYQEQVLSNCAKFAQ  372

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  373   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  432

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++FDAAVKL+VKIKA T+GTKLK+F+AT QS+   Q+E
Sbjct  433   IRMGTPALTSRGFVEEDFAKVADFFDAAVKLAVKIKAETKGTKLKDFLAT-QSAPHFQSE  491

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+KLR DVEEYAKQFPTIGFEK TMKYKN
Sbjct  492   ISKLRRDVEEYAKQFPTIGFEKETMKYKN  520



>ref|XP_010254621.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Nelumbo 
nucifera]
Length=518

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/509 (89%), Positives = 486/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+ KPI    + GGSLYYMSSL +EAVY+KEK  V+WPKQLNA LEEVDP+IA+IIEL
Sbjct  11    SSSVRKPI-LPLSNGGSLYYMSSLPNEAVYDKEKSGVTWPKQLNAPLEEVDPDIANIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGS+MTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSIMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFGLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAA VIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAASVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G+EV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQA TPEY+AYQEQVLSNCSKFAQ
Sbjct  310   GQEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQAMTPEYKAYQEQVLSNCSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  370   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVA++FD AVKL+VKIKA T+GTKLK+F+AT+Q+S  +Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFVKVADFFDTAVKLAVKIKAETKGTKLKDFLATIQTSANVQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+KLRH+VEEYAKQFPTIGF+K TMKYK+
Sbjct  490   ISKLRHEVEEYAKQFPTIGFDKETMKYKD  518



>ref|XP_007047709.1| Serine transhydroxymethyltransferase 1 isoform 1 [Theobroma cacao]
 gb|EOX91866.1| Serine transhydroxymethyltransferase 1 isoform 1 [Theobroma cacao]
Length=517

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/483 (92%), Positives = 464/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  ++WPKQLN  LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  36    EAVYEKEKPGITWPKQLNVPLEAVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQPLSGSP+NF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQPLSGSPANF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
              VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  156   HVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             +EKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAA VIPSPF
Sbjct  216   MEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAADVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQGKE+ YDYEDKINQAVFPGLQGGPHN
Sbjct  276   EYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEIFYDYEDKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQTL EKGY+LVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQTLAEKGYKLVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD
Sbjct  396   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L+VKIKA T+GTKLK+F+ TL + +  Q+EIAKLRH+VEEYAKQFPTIGFEK TMK
Sbjct  456   AAVNLAVKIKAETKGTKLKDFMVTLAAPN-FQSEIAKLRHNVEEYAKQFPTIGFEKGTMK  514

Query  1737  YKN  1745
             YKN
Sbjct  515   YKN  517



>gb|ABK96362.1| unknown [Populus trichocarpa x Populus deltoides]
Length=520

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/508 (89%), Positives = 480/508 (94%), Gaps = 1/508 (0%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNCSKFAQ+
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTLEYKAYQEQVLSNCSKFAQS  373

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             LVEKGYELVSGGTENHLVLVNLK KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  374   LVEKGYELVSGGTENHLVLVNLKTKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  433

Query  1482  RMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEI  1661
             RMGTPALTSRGFVEEDF KVA++FDA+VKL+VK+KA T+GTKLK+F+ T+QS+   Q+EI
Sbjct  434   RMGTPALTSRGFVEEDFAKVADFFDASVKLAVKMKAETKGTKLKDFLVTMQSAH-FQSEI  492

Query  1662  AKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +KLRH+VEEYAKQFPTIGF K TMKYKN
Sbjct  493   SKLRHEVEEYAKQFPTIGFNKETMKYKN  520



>gb|AFK45159.1| unknown [Lotus japonicus]
Length=516

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/508 (89%), Positives = 475/508 (94%), Gaps = 3/508 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N     Y  S    EAVYEK    V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SSSIDKPLRPLFNASSVYYKSSLPD-EAVYEK--TTVTWPKQLNAPLEVVDPEIADIIEH  67

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAE+LCQKR
Sbjct  68    EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAETLCQKR  127

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSPSNF VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  128   ALEAFRLDPAKWGVNVQPLSGSPSNFHVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  187

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLE SA LFRPKLIVAGASAYARLYDYDRIRKVCD
Sbjct  188   ISAVSIFFETMPYRLDESTGYIDYDQLEASAKLFRPKLIVAGASAYARLYDYDRIRKVCD  247

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA+LLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  248   KQKAVLLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  307

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQ
Sbjct  308   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQ  367

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  368   ALSERGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  427

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFV+EDFVKVAE+FDAAV L++K KA ++GTKLK+F+AT+Q S   Q E
Sbjct  428   IRMGTPALTSRGFVKEDFVKVAEFFDAAVNLALKAKAESKGTKLKDFLATIQESSYFQTE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             IAKLRHDVEEYAKQFPTIGFEK TM+YK
Sbjct  488   IAKLRHDVEEYAKQFPTIGFEKATMEYK  515



>ref|XP_011033087.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Populus 
euphratica]
 ref|XP_011033088.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Populus 
euphratica]
 ref|XP_011033089.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Populus 
euphratica]
 ref|XP_011033090.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Populus 
euphratica]
Length=520

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/508 (89%), Positives = 480/508 (94%), Gaps = 1/508 (0%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNCSKFAQ+
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTLEYKAYQEQVLSNCSKFAQS  373

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             LVEKGYELVSGGTENHLVLVNLK KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  374   LVEKGYELVSGGTENHLVLVNLKTKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  433

Query  1482  RMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEI  1661
             RMGTPALTSRGFVEEDF KVA++FDA+VKL+VK+KA T+GTKLK+F+ T+QS+   Q+EI
Sbjct  434   RMGTPALTSRGFVEEDFAKVADFFDASVKLAVKMKAETKGTKLKDFLVTMQSAH-FQSEI  492

Query  1662  AKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +KLRH+VEEYAKQFPTIGF K TMKYKN
Sbjct  493   SKLRHEVEEYAKQFPTIGFNKETMKYKN  520



>ref|XP_006651801.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Oryza brachyantha]
Length=511

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/478 (92%), Positives = 460/478 (96%), Gaps = 0/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  34    EERSGVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  93

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA
Sbjct  94    NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  153

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQLEKSA
Sbjct  154   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQLEKSA  213

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDY R+RK+CDKQKAILLADMAHISGLVAAGVIPSPFDYADV
Sbjct  214   VLFRPKLIVAGASAYARLYDYTRMRKICDKQKAILLADMAHISGLVAAGVIPSPFDYADV  273

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVKE+NKQGKEV+YD EDKIN AVFPGLQGGPHNHTITG
Sbjct  274   VTTTTHKSLRGPRGAMIFYRKGVKEINKQGKEVMYDLEDKINAAVFPGLQGGPHNHTITG  333

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLKNKGIDGS
Sbjct  334   LAVALKQATTPEYRAYQEQVISNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKNKGIDGS  393

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDA+VKL
Sbjct  394   RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDASVKL  453

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  454   ALKVKAAAGGTKLKDFVATLQSDGNIQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  511



>ref|XP_007205053.1| hypothetical protein PRUPE_ppa004306mg [Prunus persica]
 gb|EMJ06252.1| hypothetical protein PRUPE_ppa004306mg [Prunus persica]
Length=517

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/509 (89%), Positives = 477/509 (94%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KPI+ L+N     Y  S  + EAVY+KEK  V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SSSGDKPIRPLFNATSHYYMSSLPN-EAVYDKEKPGVTWPKQLNAPLEAVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EK RQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKR
Sbjct  70    EKTRQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY  IRKVC+
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYAHIRKVCN  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
              QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  250   NQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCS+FAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSRFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   SLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++FDAAVKL+VKIK   QGTKLK+FVA L +    Q+E
Sbjct  430   IRMGTPALTSRGFVEEDFAKVADFFDAAVKLAVKIKGEAQGTKLKDFVAALPAPH-FQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK T+KYKN
Sbjct  489   IAKLRHDVEEYAKQFPTIGFEKETLKYKN  517



>emb|CDX69344.1| BnaC01g01090D [Brassica napus]
Length=517

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/509 (86%), Positives = 477/509 (94%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI+ L               EAV +KE+ +V+WPKQLNASLEEVDPEIADIIE 
Sbjct  11    SSSVDKPIRPLIRSSSCYMSSLPS--EAVDDKERSRVTWPKQLNASLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTG+IDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGFIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVMYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS AIQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSAIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHDVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_007156447.1| hypothetical protein PHAVU_003G286600g [Phaseolus vulgaris]
 gb|ESW28441.1| hypothetical protein PHAVU_003G286600g [Phaseolus vulgaris]
Length=518

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/509 (89%), Positives = 484/509 (95%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS +KP+++L+N G   +  S    EAVY+KE+  ++WPKQLNA LE VDPEIA+IIEL
Sbjct  11    SSSTDKPLRSLFNAGSIYFKSSLPD-EAVYDKERPGITWPKQLNAPLEAVDPEIANIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSPSNF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQPLSGSPSNFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEK+A LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLDESTGYIDYDQLEKTAILFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN SKFAQ
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+GYELVSGGT+NHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   ALGERGYELVSGGTDNHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF EEDFVKVAE+FDAAVKL++K+KA +QGTKLK+F+AT+QSS +IQ+E
Sbjct  430   IRMGTPALTSRGFAEEDFVKVAEFFDAAVKLALKVKAESQGTKLKDFLATIQSSSSIQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHDVEEYAKQFPTIGFEKATMKYKN  518



>emb|CDX75685.1| BnaA01g00170D [Brassica napus]
Length=517

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/509 (86%), Positives = 477/509 (94%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI+ L               EAV +KE+ +V+WPKQLNASLEEVDPEIADIIE 
Sbjct  11    SSSVDKPIRPLIRSSSCYMSSLPS--EAVDDKERSRVTWPKQLNASLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTG+IDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGFIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS AIQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSAIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHDVEEFAKQFPTIGFEKETMKYKN  517



>gb|EYU44561.1| hypothetical protein MIMGU_mgv1a004699mg [Erythranthe guttata]
Length=514

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/509 (89%), Positives = 484/509 (95%), Gaps = 5/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KP K     GGS+YYMSSL +EAVYEK+K  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSVDKPAK----RGGSIYYMSSLPNEAVYEKDKNGVTWPKQLNAPLEVVDPEIADIIEL  66

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  67    EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  126

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  127   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  186

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSA L+RPKLIVAGASAY+RLYDY RIRKVCD
Sbjct  187   ISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLYRPKLIVAGASAYSRLYDYARIRKVCD  246

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+ KQ
Sbjct  247   KQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEITKQ  306

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQ
Sbjct  307   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQ  366

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TLV+ GYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  367   TLVKHGYELVSGGTDNHLVLVNLKTKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  426

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVA++F+AAV +++KIKA T GTKLK+FV T++SS + Q+E
Sbjct  427   IRMGTPALTSRGFVEEDFAKVADFFNAAVNIALKIKAKTSGTKLKDFVTTMESS-SFQSE  485

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  486   IEKLRHDVEEYAKQFPTIGFEKETMKYKN  514



>ref|XP_006283400.1| hypothetical protein CARUB_v10004441mg, partial [Capsella rubella]
 gb|EOA16298.1| hypothetical protein CARUB_v10004441mg, partial [Capsella rubella]
Length=583

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/509 (87%), Positives = 474/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L               EAV EKE+ +V+WPKQLNASLEEVDPEIADIIE 
Sbjct  77    SSSIDKPIRPLVRSTSCFMSSLPS--EAVDEKERSRVTWPKQLNASLEEVDPEIADIIEH  134

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  135   EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  194

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  195   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  254

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  255   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  314

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE NKQ
Sbjct  315   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKETNKQ  374

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  375   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  434

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  435   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  494

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV +++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  495   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTIALKVKSEAQGTKLKDFVSAMESSSTIQSE  554

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  555   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  583



>ref|XP_010531344.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Tarenaya 
hassleriana]
Length=516

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/509 (89%), Positives = 479/509 (94%), Gaps = 3/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L N   S+ YMSSL SEAV EKE+ +V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPIRPLLNASSSVCYMSSLPSEAVDEKERSRVTWPKQLNAPLEVVDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKGVKEVNKQ
Sbjct  251   KQKAVMLADMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVKEVNKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN ++FAQ
Sbjct  311   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSARFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL EKGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  371   TLEEKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV L+VKIK + QG KLK+FV+ +QS    Q+E
Sbjct  431   IRMGTPALTSRGFVEEDFAKVAEYFDKAVNLAVKIKTSAQGNKLKDFVSKMQS---FQSE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRH+VE YAKQFPT+GFEK TMKYKN
Sbjct  488   ITKLRHEVEGYAKQFPTVGFEKETMKYKN  516



>ref|XP_006411834.1| hypothetical protein EUTSA_v10024934mg [Eutrema salsugineum]
 dbj|BAJ33788.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53287.1| hypothetical protein EUTSA_v10024934mg [Eutrema salsugineum]
Length=518

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/509 (87%), Positives = 479/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L     S Y  S  S EAV +KEK +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPIRPLIRSTTSCYMSSLPS-EAVDDKEKSRVTWPKQLNAPLEEVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  190   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  250   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  310   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK+KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  370   TLMEKGYELVSGGTDNHLVLVNLKSKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV L++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  430   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTLALKVKSEAQGTKLKDFVSAMESSSTIQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  518



>ref|XP_010555423.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Tarenaya 
hassleriana]
Length=514

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/509 (88%), Positives = 473/509 (93%), Gaps = 5/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ + N             EAV EKEK +V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPIRPILNASVCCMSSLPS--EAVDEKEKSRVTWPKQLNAPLEVVDPEIADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSPSNF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPSNFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAA VIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAIMLADMAHISGLVAADVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNC+KFAQ
Sbjct  309   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL +KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  369   TLEKKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAE+FD AV L++KIKA TQG KLK+FV+ +QS    ++E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEFFDKAVSLALKIKAETQGNKLKDFVSKMQS---FESE  485

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLR +VEEYAKQFPTIGFEK TMKYKN
Sbjct  486   IKKLRDEVEEYAKQFPTIGFEKETMKYKN  514



>ref|XP_009132042.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial-like 
[Brassica rapa]
Length=517

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/509 (86%), Positives = 477/509 (94%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI+ L               EAV +KE+ +V+WPKQLNASLEEV+PEIADIIE 
Sbjct  11    SSSVDKPIRPLIRSSSCYMSSLPS--EAVDDKERSRVTWPKQLNASLEEVEPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTG+IDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGFIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS AIQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSAIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHDVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_008440509.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Cucumis 
melo]
Length=519

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/483 (90%), Positives = 463/483 (96%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KE+ +V WPKQLN  LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  37    EAVYDKERPRVPWPKQLNDPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  97    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE+SATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  217   LERSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAAGVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  277   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGREVLYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVL NCS FAQ+LVEKGYELVSGGTENHLVLVNLKNK
Sbjct  337   HTITGLAVALKQATTPEYKAYQEQVLRNCSNFAQSLVEKGYELVSGGTENHLVLVNLKNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAE+FD
Sbjct  397   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEFFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV ++VKIKA T+GTKLK+F+ T++S+   Q+EI  L+HDVEEYAK+FPTIGFEK TMK
Sbjct  457   AAVNIAVKIKAETKGTKLKDFLTTMESTPYFQSEIKNLKHDVEEYAKKFPTIGFEKETMK  516

Query  1737  YKN  1745
             YK+
Sbjct  517   YKS  519



>ref|XP_010432013.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial-like 
[Camelina sativa]
Length=517

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/509 (86%), Positives = 474/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L               EAV EKEK +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPVRPLIRSTSCYMSSLPS--EAVDEKEKSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKETNKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN ++FAQ
Sbjct  309   GKEVMYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSTRFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>emb|CDY49684.1| BnaC03g61150D [Brassica napus]
Length=517

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/509 (86%), Positives = 475/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI+ L               EAV +KE+ +V+WPK+LNASLEEVDPEIADIIE 
Sbjct  11    SSSVDKPIRPLIRSTTCYMSSLPS--EAVDDKERSRVTWPKKLNASLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV L++K+K+  QGTKLK+FV+ +++S  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTLALKVKSEAQGTKLKDFVSAMEASSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>sp|P49357.1|GLYM1_FLAPR RecName: Full=Serine hydroxymethyltransferase 1, mitochondrial; 
Short=SHMT1; AltName: Full=Glycine hydroxymethyltransferase 
1; AltName: Full=Serine methylase 1; Flags: Precursor [Flaveria 
pringlei]
 emb|CAA81078.1| glycine hydroxymethyltransferase [Flaveria pringlei]
Length=517

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/483 (91%), Positives = 462/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKE+  V+WPKQLNA LE VDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYEKERPGVTWPKQLNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGSP+NF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSPANF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
              VYTALLK HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  156   HVYTALLKAHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV YDYEDKINQAVFPGLQGGPHN
Sbjct  276   DYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVFYDYEDKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATT EY+AYQEQV+SN +KFA+TLV+ GYELVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTAEYKAYQEQVMSNSAKFAETLVKSGYELVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGS+VEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA +FD
Sbjct  396   GIDGSKVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
              AVKL+VKIK   +GTKLK+FV  ++SS AIQ+EI+KLRHDVEEYAKQFPTIGFEK TMK
Sbjct  456   LAVKLAVKIKGEAKGTKLKDFVTAMESS-AIQSEISKLRHDVEEYAKQFPTIGFEKETMK  514

Query  1737  YKN  1745
             YKN
Sbjct  515   YKN  517



>ref|XP_006466351.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Citrus sinensis]
Length=515

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/483 (92%), Positives = 463/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  V+WPKQLNA LE VDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAV
Sbjct  34    EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNK SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  94    GSVMTNKNSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+KQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YDYE+KINQAVFPGLQGGPHN
Sbjct  274   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTP Y+AYQEQVLSNCSKFAQTL+E GYELVSGGTENHLVLVNLKNK
Sbjct  334   HTITGLAVALKQATTPGYKAYQEQVLSNCSKFAQTLLEMGYELVSGGTENHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA +FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL+VKIK+ TQGTKLK+FVAT QS++  Q+EIAK  HDVEEYAKQFPTIGFEK TMK
Sbjct  454   AAVKLTVKIKSETQGTKLKDFVATTQSAN-FQSEIAKRCHDVEEYAKQFPTIGFEKETMK  512

Query  1737  YKN  1745
             YK+
Sbjct  513   YKS  515



>ref|XP_010437163.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Camelina 
sativa]
Length=517

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/509 (86%), Positives = 474/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPVRPLIRSTSCYMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKETNKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN ++FAQ
Sbjct  309   GKEVMYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSTRFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_009109405.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Brassica 
rapa]
Length=517

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/509 (86%), Positives = 475/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI+ L               EAV EKE+ +V+WPKQLNASLEEVDPEIADIIE 
Sbjct  11    SSSVDKPIRPLIRSTTCYMSSLPS--EAVDEKERSRVTWPKQLNASLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKV+++VHIA+N+NTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVMQAVHIASNENTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV L++K+K+  QGTKLK+FV+ +++S  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTLALKVKSEAQGTKLKDFVSAMEASSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>gb|KCW54635.1| hypothetical protein EUGRSUZ_I00580 [Eucalyptus grandis]
Length=508

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/509 (89%), Positives = 480/509 (94%), Gaps = 11/509 (2%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSIEKP++ L NGGGS+ YM+SL +EAVYEKEK  V+WPKQLNA LE VDPE+ADIIEL
Sbjct  11    SSSIEKPLRPLINGGGSVCYMASLPNEAVYEKEKNGVTWPKQLNAPLEAVDPEVADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGV+PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAILLADMAHISGLVAAGVVPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKE           AVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNC+KFAQ
Sbjct  311   GKE-----------AVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCAKFAQ  359

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL EKGYELVSGGTENHLVLVNLKNKGIDGSRVEKV+ESVHIAANKNTVPGDVSAMVPGG
Sbjct  360   TLTEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVMESVHIAANKNTVPGDVSAMVPGG  419

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDFVKVAE+FDAAV L+VKIKA T+GTKLK+F++T+QSS   Q+ 
Sbjct  420   IRMGTPALTSRGFIEEDFVKVAEFFDAAVGLAVKIKAQTKGTKLKDFLSTMQSSPDFQSG  479

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  480   IAKLRHDVEEYAKQFPTIGFEKATMKYKN  508



>ref|XP_009364793.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Pyrus 
x bretschneideri]
 ref|XP_009371347.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Pyrus 
x bretschneideri]
Length=515

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/483 (91%), Positives = 460/483 (95%), Gaps = 3/483 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEK    V+WPKQLNA LE VDPEIADIIE EK RQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYEK--SGVTWPKQLNAPLEAVDPEIADIIEHEKTRQWKGLELIPSENFTSLSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDYDRIRKVC+KQKAILLADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKE NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  274   DYADVVTTTTHKSLRGPRGAMIFFRKGVKETNKQGQEVLYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNCS+FAQ+L EKGYELVSGGTENHLVLVNLKNK
Sbjct  334   HTITGLAVALKQATTPEYKAYQEQVLSNCSRFAQSLAEKGYELVSGGTENHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L++KIK   +GTKLK+FV  L S+   Q+E AKLRHDVEEYAKQFPTIGFEK T+K
Sbjct  454   AAVNLALKIKGEAKGTKLKDFVTAL-SAPHFQSETAKLRHDVEEYAKQFPTIGFEKETLK  512

Query  1737  YKN  1745
             YKN
Sbjct  513   YKN  515



>sp|P49358.1|GLYM2_FLAPR RecName: Full=Serine hydroxymethyltransferase 2, mitochondrial; 
Short=SHMT2; AltName: Full=Glycine hydroxymethyltransferase 
2; AltName: Full=Serine methylase 2; Flags: Precursor [Flaveria 
pringlei]
 emb|CAA81079.1| glycine hydroxymethyltransferase [Flaveria pringlei]
Length=517

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/483 (92%), Positives = 460/483 (95%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKE+  V+WPKQLNA LE  DPEIADIIELEKARQWKGLELI SENFTSLSVMQAV
Sbjct  36    EAVYEKERPGVTWPKQLNAPLEVGDPEIADIIELEKARQWKGLELILSENFTSLSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLD AKWGVNVQPLSGSP+NF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDAAKWGVNVQPLSGSPANF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
              VYTALLK HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  156   HVYTALLKAHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN
Sbjct  276   DYADVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  335

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATT EY+AYQEQV+SNC+KFA+TLV+ GYELVSGGTENHLVLVNLKNK
Sbjct  336   HTITGLAVALKQATTAEYKAYQEQVMSNCAKFAETLVKSGYELVSGGTENHLVLVNLKNK  395

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA  FD
Sbjct  396   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYLFD  455

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
              AVKL+VKIK   QGTKLK+FVA +QSS A Q+EI+KLRHDVEEYAKQFPTIGFEK TMK
Sbjct  456   LAVKLAVKIKGEAQGTKLKDFVAAMQSS-AFQSEISKLRHDVEEYAKQFPTIGFEKETMK  514

Query  1737  YKN  1745
             YKN
Sbjct  515   YKN  517



>ref|XP_010446608.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial-like 
[Camelina sativa]
Length=517

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/509 (86%), Positives = 473/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPVRPLLRSTSCYMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKETNKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN ++FAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSTRFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AVKL++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVKLALKVKSEAQGTKLKDFVSAMESSSIIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IEKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_002866922.1| hypothetical protein ARALYDRAFT_490821 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43181.1| hypothetical protein ARALYDRAFT_490821 [Arabidopsis lyrata subsp. 
lyrata]
Length=517

 Score =   919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/509 (86%), Positives = 473/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPIRPLIRSTSCYMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAA VIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAANVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV L++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTLALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|NP_001051211.1| Os03g0738400 [Oryza sativa Japonica Group]
 gb|ABF98772.1| Serine hydroxymethyltransferase, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13125.1| Os03g0738400 [Oryza sativa Japonica Group]
 gb|EEC76150.1| hypothetical protein OsI_13440 [Oryza sativa Indica Group]
 gb|AFI71281.1| serine hydroxymethyltransferase [Oryza sativa Japonica Group]
Length=513

 Score =   919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/478 (91%), Positives = 459/478 (96%), Gaps = 0/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  36    EERSGVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  95

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTA
Sbjct  96    NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTA  155

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA
Sbjct  156   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSA  215

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  216   VLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDYADV  275

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  276   VTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  335

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLK+KGIDGS
Sbjct  336   LAVALKQATTPEYRAYQEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKSKGIDGS  395

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L
Sbjct  396   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNL  455

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  456   ALKVKAAAGGTKLKDFVATLQSDSNIQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  513



>gb|AAP44712.1| putative glycine hydroxymethyltransferase [Oryza sativa Japonica 
Group]
Length=557

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/478 (91%), Positives = 459/478 (96%), Gaps = 0/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  80    EERSGVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  139

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTA
Sbjct  140   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTA  199

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA
Sbjct  200   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSA  259

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  260   VLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDYADV  319

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  320   VTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  379

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLK+KGIDGS
Sbjct  380   LAVALKQATTPEYRAYQEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKSKGIDGS  439

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L
Sbjct  440   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNL  499

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  500   ALKVKAAAGGTKLKDFVATLQSDSNIQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  557



>ref|XP_010646403.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 emb|CBI25699.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/509 (87%), Positives = 478/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+ KP+++++NGG   Y  S  + EAVYE+EK +V+WPKQLNA L  VDPEIADIIEL
Sbjct  11    SSSVNKPVRSVFNGGSIYYMASLPN-EAVYEEEKSRVTWPKQLNAPLGVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWK LEL+PSENFTS+SVMQAVGS+MTN  SEGYPGARYYGGNEY+DMAESLCQKR
Sbjct  70    EKARQWKALELVPSENFTSVSVMQAVGSIMTNNVSEGYPGARYYGGNEYMDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY  IRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYAHIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YAD+VTTTT+KSLRGPRGAMIF++KGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFEYADIVTTTTYKSLRGPRGAMIFFKKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQ  PHNHTI GLAVALKQATTPEY+AYQEQVLSNCSKFA+
Sbjct  310   GKEVLYDYEDKINQAVFPGLQSAPHNHTIAGLAVALKQATTPEYKAYQEQVLSNCSKFAE  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL++KGYELVS GTENHLVLVNLKNKGIDGSRVEKVLESVHI ANKNTVPGDVSAMVP G
Sbjct  370   TLMKKGYELVSSGTENHLVLVNLKNKGIDGSRVEKVLESVHIVANKNTVPGDVSAMVPSG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVE+DFVKVAEYFDAAV ++VKIKA T GTKLKEF+AT+QSS  +Q+E
Sbjct  430   IRMGTPALTSRGFVEKDFVKVAEYFDAAVTVAVKIKAETTGTKLKEFLATMQSSPHLQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEEYAKQFPTIGFEK TMKYKN
Sbjct  490   IAKLRHEVEEYAKQFPTIGFEKETMKYKN  518



>ref|NP_195506.1| serine transhydroxymethyltransferase 1 [Arabidopsis thaliana]
 sp|Q9SZJ5.1|GLYM1_ARATH RecName: Full=Serine hydroxymethyltransferase 1, mitochondrial; 
Short=AtSHMT1; AltName: Full=Glycine hydroxymethyltransferase 
1; AltName: Full=Serine Transhydroxymethyltransferase; 
Short=STM; AltName: Full=Serine methylase 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL16156.1|AF428388_1 AT4g37930/F20D10_50 [Arabidopsis thaliana]
 emb|CAB37533.1| glycine hydroxymethyltransferase like protein [Arabidopsis thaliana]
 emb|CAB71289.1| serine hydroxymethyl transferase [Arabidopsis thaliana]
 emb|CAB80458.1| glycine hydroxymethyltransferase like protein [Arabidopsis thaliana]
 gb|AAL15276.1| AT4g37930/F20D10_50 [Arabidopsis thaliana]
 gb|AAL50068.1| AT4g37930/F20D10_50 [Arabidopsis thaliana]
 gb|AAP21161.1| At4g37930/F20D10_50 [Arabidopsis thaliana]
 gb|AEE86855.1| serine transhydroxymethyltransferase 1 [Arabidopsis thaliana]
Length=517

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/509 (86%), Positives = 473/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPIRPLIRSTSCYMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAA VIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAANVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+E+GYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMERGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV +++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTIALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_004981838.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Setaria italica]
Length=513

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/479 (91%), Positives = 461/479 (96%), Gaps = 2/479 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+W KQLNA LEEVDPE+ADIIELEKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  36    EERSGVTWTKQLNAPLEEVDPEVADIIELEKARQWKGLELIPSENFTSVSVMQAVGSVMT  95

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTA
Sbjct  96    NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTA  155

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISA SIFFETMPYRL+ESTG+IDYDQLEKSA
Sbjct  156   LLKPHERIMALDLPHGGHLSHGYQTDTKKISATSIFFETMPYRLDESTGFIDYDQLEKSA  215

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLI+AGASAYARLYDYDR+RK+C+KQKAILLADMAHISGLVAAGVIPSPFDYADV
Sbjct  216   VLFRPKLIIAGASAYARLYDYDRMRKICNKQKAILLADMAHISGLVAAGVIPSPFDYADV  275

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVKE+NKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  276   VTTTTHKSLRGPRGAMIFYRKGVKEINKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  335

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SN +KFAQ+LV KGYELVSGGT+NHLVLVNLKNKGIDGS
Sbjct  336   LAVALKQATTPEYRAYQEQVISNSAKFAQSLVAKGYELVSGGTDNHLVLVNLKNKGIDGS  395

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L
Sbjct  396   RVEKVLECVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNL  455

Query  1572  SVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +VKIKAAT  GTKLK+FV TLQ SD+IQAEIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  456   AVKIKAATTGGTKLKDFVTTLQ-SDSIQAEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  513



>ref|XP_008236601.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Prunus 
mume]
Length=518

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/484 (91%), Positives = 461/484 (95%), Gaps = 2/484 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KEK  V+WPKQLNA LE VDPEIADIIE EK RQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYDKEKPGVTWPKQLNAPLEAVDPEIADIIEHEKTRQWKGLELIPSENFTSLSVMQAV  95

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF
Sbjct  96    GSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANF  155

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  156   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  215

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY  IRKVC+ QKAILLADMAHISGLVAAGVIPSPF
Sbjct  216   LEKSAKLFRPKLIVAGASAYARLYDYAHIRKVCNNQKAILLADMAHISGLVAAGVIPSPF  275

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGK-EVLYDYEDKINQAVFPGLQGGPH  1193
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGK  VLYDYEDKINQAVFPGLQGGPH
Sbjct  276   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKITVLYDYEDKINQAVFPGLQGGPH  335

Query  1194  NHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKN  1373
             NHTITGLAVALKQATTPEY+AYQEQVLSNCS+FAQ+LVEKGYELVSGGTENHLVLVNLKN
Sbjct  336   NHTITGLAVALKQATTPEYKAYQEQVLSNCSRFAQSLVEKGYELVSGGTENHLVLVNLKN  395

Query  1374  KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYF  1553
             KGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++F
Sbjct  396   KGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFF  455

Query  1554  DAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
             DA VKL+VKIK   QGTKLK+FVA L ++   Q+EIAKLRHDVEEYAKQFPTIGFEK T+
Sbjct  456   DATVKLAVKIKGEAQGTKLKDFVAAL-AAPHFQSEIAKLRHDVEEYAKQFPTIGFEKETL  514

Query  1734  KYKN  1745
             KYKN
Sbjct  515   KYKN  518



>gb|AAL06913.1| AT4g37930/F20D10_50 [Arabidopsis thaliana]
Length=517

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/509 (86%), Positives = 473/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPIRPLIRSTSCYMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMAL+LPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALNLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAA VIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAANVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+E+GYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMERGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV +++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVTIALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   IAKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_006379386.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
 gb|ERP57183.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
Length=547

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/535 (85%), Positives = 481/535 (90%), Gaps = 28/535 (5%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQEQVLSNCSKFAQ+
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTLEYKAYQEQVLSNCSKFAQS  373

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  374   LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  433

Query  1482  RM---------------------------GTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             RM                           GTPALTSRGFVEEDF KVA++FDA+VKL+VK
Sbjct  434   RMGKGLYLTRQCSLILFTANFLDKCNCTSGTPALTSRGFVEEDFAKVADFFDASVKLAVK  493

Query  1581  IKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +KA T+GTKLK+F+ T+QS+   Q+EI+KLRH+VEEYAKQFPTIGF K TMKYKN
Sbjct  494   MKAETKGTKLKDFLVTMQSAH-FQSEISKLRHEVEEYAKQFPTIGFNKETMKYKN  547



>ref|XP_010683048.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=515

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/510 (87%), Positives = 476/510 (93%), Gaps = 6/510 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEK-CQVSWPKQLNASLEEVDPEIADIIE  395
             S+S+ KPI++ +NG    Y  +    EAV+EKEK   V+WPKQLNA LEEVDPEIADIIE
Sbjct  11    SNSVNKPIRSAFNGAPLYYMST----EAVFEKEKQISVTWPKQLNAPLEEVDPEIADIIE  66

Query  396   LEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQK  575
              EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQK
Sbjct  67    HEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQK  126

Query  576   RALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTK  755
             RALEAFRLDP KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTK
Sbjct  127   RALEAFRLDPEKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTK  186

Query  756   KISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVC  935
             KISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+RIRKVC
Sbjct  187   KISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERIRKVC  246

Query  936   DKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNK  1115
             DKQKAI+LADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKG+KE+NK
Sbjct  247   DKQKAIMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGLKEINK  306

Query  1116  QGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFA  1295
             QGKEV+YD+EDKINQAVFPGLQGGPHNHTIT LAVALKQA TPEYRAYQEQVLSN  KFA
Sbjct  307   QGKEVMYDFEDKINQAVFPGLQGGPHNHTITALAVALKQAVTPEYRAYQEQVLSNSFKFA  366

Query  1296  QTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPG  1475
             + L   GYELVSGGTENHLVLVNLKNKGIDGSRVEK+LE+VHIAANKNTVPGDVSAMVPG
Sbjct  367   EALNGMGYELVSGGTENHLVLVNLKNKGIDGSRVEKILEAVHIAANKNTVPGDVSAMVPG  426

Query  1476  GIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQA  1655
             GIRMGTPALTSRGF+EEDFVKVAEYFDAAVKLS+KIKA T+GTKLK+FVATLQS  A  +
Sbjct  427   GIRMGTPALTSRGFIEEDFVKVAEYFDAAVKLSLKIKAETKGTKLKDFVATLQSG-AFDS  485

Query  1656  EIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             EIAKLR +VEEYAKQFPTIGFEK +MKYKN
Sbjct  486   EIAKLRLEVEEYAKQFPTIGFEKESMKYKN  515



>ref|XP_008368015.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Malus 
domestica]
Length=515

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/483 (91%), Positives = 458/483 (95%), Gaps = 3/483 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEK    V+WPKQLNA LE VDPEIA+IIE EK RQWKGLELIPSENFTSLSVMQAV
Sbjct  36    EAVYEK--SGVTWPKQLNAPLEAVDPEIANIIEHEKTRQWKGLELIPSENFTSLSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDYDRIRKVC+KQKAILLADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF RKGVKE NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  274   DYADVVTTTTHKSLRGPRGAMIFXRKGVKETNKQGQEVLYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVLSNCS+FAQ+L EKGYELVSGGTENHLVLVNLKNK
Sbjct  334   HTITGLAVALKQATTPEYKAYQEQVLSNCSRFAQSLAEKGYELVSGGTENHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L++KIK   +GTKLK+FV  L S+   Q+E A LRHDVEEYAKQFPTIGFEK T+K
Sbjct  454   AAVNLALKIKGEAKGTKLKDFVXAL-SAPHFQSETAXLRHDVEEYAKQFPTIGFEKETLK  512

Query  1737  YKN  1745
             YKN
Sbjct  513   YKN  515



>emb|CBI19306.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/483 (90%), Positives = 462/483 (96%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             E V EKEK +++W KQLNA LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  32    EVVCEKEKSRITWTKQLNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  91

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDPAKWGVNVQ LSGSP+NF
Sbjct  92    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPAKWGVNVQSLSGSPANF  151

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E TGYIDYDQ
Sbjct  152   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDEKTGYIDYDQ  211

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVI SPF
Sbjct  212   LEKSAALFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIQSPF  271

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHN
Sbjct  272   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHN  331

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQA TPEY+AYQEQVL+NCS FAQ+L+EKGYELVSGGT+NHLVLVNLKNK
Sbjct  332   HTISGLAVALKQAMTPEYKAYQEQVLTNCSTFAQSLLEKGYELVSGGTDNHLVLVNLKNK  391

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE FD
Sbjct  392   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAELFD  451

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++KIKA ++GTKLK+FVAT+QS    Q+EIAKLRH+VEEYAKQFPTIGFEK TMK
Sbjct  452   AAVKLALKIKANSKGTKLKDFVATMQSDAETQSEIAKLRHEVEEYAKQFPTIGFEKETMK  511

Query  1737  YKN  1745
             YK+
Sbjct  512   YKD  514



>ref|XP_003559966.1| PREDICTED: serine hydroxymethyltransferase 1, mitochondrial [Brachypodium 
distachyon]
Length=514

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/479 (90%), Positives = 458/479 (96%), Gaps = 1/479 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT
Sbjct  36    EERSGVTWPKQLNAPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  95

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF LDP KWGVNVQPLSGSP+NF VYTA
Sbjct  96    NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFNLDPEKWGVNVQPLSGSPANFHVYTA  155

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA
Sbjct  156   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSA  215

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV
Sbjct  216   VLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  275

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKGVK  NKQGKE++YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  276   VTTTTHKSLRGPRGAMIFFRKGVKGTNKQGKEIMYDFEDKINAAVFPGLQGGPHNHTITG  335

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATT EYRAYQEQV+SNC++FAQ+L  KGY++VSGGT+NHLVLVNLKNKGIDGS
Sbjct  336   LAVALKQATTQEYRAYQEQVMSNCARFAQSLTSKGYDIVSGGTDNHLVLVNLKNKGIDGS  395

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD+AV L
Sbjct  396   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDSAVNL  455

Query  1572  SVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAAT  GTKLK+FVATLQS  +IQAEIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  456   ALKVKAATTGGTKLKDFVATLQSDSSIQAEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  514



>ref|XP_009345858.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Pyrus 
x bretschneideri]
Length=515

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/483 (91%), Positives = 460/483 (95%), Gaps = 3/483 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEK    VSWPKQLNA LE VDPEIADIIE EK RQWKGLELIPSENFTS+SVMQAV
Sbjct  36    EAVYEKPG--VSWPKQLNAPLEAVDPEIADIIEHEKTRQWKGLELIPSENFTSVSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDY Q
Sbjct  154   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYAQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATL+RPKLIVAGASAYARLYDYDRIRKVC+KQKAILLADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLYRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKE NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  274   DYADVVTTTTHKSLRGPRGAMIFFRKGVKETNKQGQEVLYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVL+NCS+FAQ+L +KGYELVSGGTENHLVLVNLKNK
Sbjct  334   HTITGLAVALKQATTPEYKAYQEQVLTNCSRFAQSLAQKGYELVSGGTENHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L++KIK   +GTKLK+FVA L S+   Q+E AKLRHDVEEYAKQFPTIGFEK T+K
Sbjct  454   AAVNLALKIKGEAKGTKLKDFVAAL-SAPHFQSETAKLRHDVEEYAKQFPTIGFEKETLK  512

Query  1737  YKN  1745
             YKN
Sbjct  513   YKN  515



>ref|XP_008665373.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Zea 
mays]
 gb|ACG33140.1| serine hydroxymethyltransferase [Zea mays]
 gb|ACN34444.1| unknown [Zea mays]
 tpg|DAA51241.1| TPA: serine hydroxymethyltransferase isoform 1 [Zea mays]
 tpg|DAA51242.1| TPA: serine hydroxymethyltransferase isoform 2 [Zea mays]
Length=513

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/479 (90%), Positives = 461/479 (96%), Gaps = 2/479 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  ++W KQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  36    EERSGITWTKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  95

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTA
Sbjct  96    NKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTA  155

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISA SIFFETMPYRL+ESTG IDYDQLEKSA
Sbjct  156   LLKPHERIMALDLPHGGHLSHGYQTDTKKISATSIFFETMPYRLDESTGLIDYDQLEKSA  215

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLI+AGASAYARLYDYDR+RK+C+KQKAILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  216   VLFRPKLIIAGASAYARLYDYDRMRKICNKQKAILLADMAHISGLVAAGVVPSPFDYADV  275

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVKE+NKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  276   VTTTTHKSLRGPRGAMIFYRKGVKEINKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  335

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L+ KGYELVSGGT+NHLVLVNLKNKGIDGS
Sbjct  336   LAVALKQATTPEYRAYQEQVISNCAKFAQSLISKGYELVSGGTDNHLVLVNLKNKGIDGS  395

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L
Sbjct  396   RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNL  455

Query  1572  SVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++KIKAAT  GTKLK+FVATLQ SD+IQ EIAKLRHDVEE+AKQFPTIGFEK TMKYKN
Sbjct  456   ALKIKAATTGGTKLKDFVATLQ-SDSIQVEIAKLRHDVEEFAKQFPTIGFEKETMKYKN  513



>ref|XP_002285605.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
 ref|XP_010664446.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Vitis 
vinifera]
Length=516

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/483 (90%), Positives = 462/483 (96%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             E V EKEK +++W KQLNA LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  34    EVVCEKEKSRITWTKQLNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDPAKWGVNVQ LSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPAKWGVNVQSLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E TGYIDYDQ
Sbjct  154   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDEKTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVI SPF
Sbjct  214   LEKSAALFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIQSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHN
Sbjct  274   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQA TPEY+AYQEQVL+NCS FAQ+L+EKGYELVSGGT+NHLVLVNLKNK
Sbjct  334   HTISGLAVALKQAMTPEYKAYQEQVLTNCSTFAQSLLEKGYELVSGGTDNHLVLVNLKNK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE FD
Sbjct  394   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAELFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++KIKA ++GTKLK+FVAT+QS    Q+EIAKLRH+VEEYAKQFPTIGFEK TMK
Sbjct  454   AAVKLALKIKANSKGTKLKDFVATMQSDAETQSEIAKLRHEVEEYAKQFPTIGFEKETMK  513

Query  1737  YKN  1745
             YK+
Sbjct  514   YKD  516



>gb|ABO61378.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides]
Length=516

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/509 (87%), Positives = 478/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   NGG   Y MSSL  +A+ +++  + +W KQLNA LEE+DPEIADIIEL
Sbjct  9     SSSLRNPIKPYLNGGSLYYNMSSLPHKALSDEDTARANWIKQLNAPLEEIDPEIADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFGLDPQKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGY+DYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLNESTGYVDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA+LLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYEDKINQAVFPGLQGGPHNHTI+GLAVALKQA TPEY+AYQEQVLSNCSKFAQ
Sbjct  309   GKEVMYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQARTPEYKAYQEQVLSNCSKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+EKGYELVSGGTENHLVLVNL+NKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  369   SLIEKGYELVSGGTENHLVLVNLRNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+E DFVKVAE+FDAAVKL++KIKA  QGTKLK+FVA ++ SD  Q+E
Sbjct  429   IRMGTPALTSRGFIERDFVKVAEFFDAAVKLALKIKADAQGTKLKDFVAAMK-SDGYQSE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IA+LRHDVEEYAKQFPT+GFEK TMKYK+
Sbjct  488   IARLRHDVEEYAKQFPTVGFEKETMKYKD  516



>ref|XP_010520825.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Tarenaya 
hassleriana]
Length=523

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/509 (86%), Positives = 479/509 (94%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++ PI    + GGSL +MSS  + A+ + EK + +W KQLNA LEE+DPEIADIIEL
Sbjct  15    SSSVKNPISFAASNGGSLRFMSSFPNSAIADSEKSRATWIKQLNAPLEEIDPEIADIIEL  74

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  75    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  134

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALL+PH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  135   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLRPHERIMALDLPHGGHLSHGYQTDTKK  194

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  195   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAALFRPKLIVAGASAYARLYDYARIRKVCD  254

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  255   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  314

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  TPEY+AYQEQVL NCSKFAQ
Sbjct  315   GKEVMYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQVKTPEYKAYQEQVLRNCSKFAQ  374

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGY+LVSGGTENHLVLVNL+NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  375   TLLEKGYDLVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  434

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF +VA++FDA+VKL++KIK+  QGTKLK+FVAT++S++  Q+E
Sbjct  435   IRMGTPALTSRGFVEEDFARVADFFDASVKLALKIKSEAQGTKLKDFVATMESNERFQSE  494

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLR +VEEYAKQFPT GFEK TMKYK+
Sbjct  495   IAKLRKEVEEYAKQFPTAGFEKETMKYKD  523



>gb|KFK30424.1| hypothetical protein AALP_AA7G259200 [Arabis alpina]
Length=517

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/509 (86%), Positives = 472/509 (93%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KPI+ L               EAV EKE+ +V+WPKQLNA LEEVDPEIADIIE 
Sbjct  11    SSSIDKPIRPLIRPTSCHMSSLPS--EAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEH  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFRLDPEKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAA VIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAADVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQ
Sbjct  309   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTAEYKAYQEQVLSNSAKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGG
Sbjct  369   TLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAEYFD AV +++K+K+  QGTKLK+FV+ ++SS  IQ+E
Sbjct  429   IRMGTPALTSRGFVEEDFAKVAEYFDKAVVIALKVKSEAQGTKLKDFVSAMESSSTIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I KLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  489   ITKLRHEVEEFAKQFPTIGFEKETMKYKN  517



>ref|XP_009411315.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=516

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/484 (90%), Positives = 462/484 (95%), Gaps = 2/484 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKE  +VSWPKQLNA LE VDPEIADIIELEKARQ KGLELIPSENFTS+SVMQAV
Sbjct  34    EAVYEKE-VRVSWPKQLNAPLEVVDPEIADIIELEKARQCKGLELIPSENFTSVSVMQAV  92

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS+MTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF LDPAKWGVNVQ LSGSP+NF
Sbjct  93    GSIMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFHLDPAKWGVNVQSLSGSPANF  152

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  153   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  212

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVA GVIPSPF
Sbjct  213   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAGGVIPSPF  272

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV+YD+E+KIN AVFPGLQGGPHN
Sbjct  273   DYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVMYDFEEKINAAVFPGLQGGPHN  332

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI GLAVALKQATTPEY+AYQEQVLSNC++FAQ L+EKGYELVSGGTENHLVLVNLKNK
Sbjct  333   HTIAGLAVALKQATTPEYKAYQEQVLSNCARFAQCLIEKGYELVSGGTENHLVLVNLKNK  392

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  393   GIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  452

Query  1557  AAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
              AVKLS+K KA T+ G+KLK+F+AT+Q+   IQ+EIAKLRH+VEE+AKQFPTIGFEK TM
Sbjct  453   TAVKLSLKTKAETKGGSKLKDFLATIQTDANIQSEIAKLRHEVEEFAKQFPTIGFEKETM  512

Query  1734  KYKN  1745
             KYKN
Sbjct  513   KYKN  516



>ref|XP_002302357.1| hypothetical protein POPTR_0002s10990g [Populus trichocarpa]
 ref|XP_006386454.1| hypothetical protein POPTR_0002s10990g [Populus trichocarpa]
 gb|EEE81630.1| hypothetical protein POPTR_0002s10990g [Populus trichocarpa]
 gb|ERP64251.1| hypothetical protein POPTR_0002s10990g [Populus trichocarpa]
Length=516

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/509 (87%), Positives = 478/509 (94%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   NGG   Y MSSL  +A+ +++K + +W KQLNA LEE+DPEIADIIEL
Sbjct  9     SSSLRNPIKPYLNGGSLYYNMSSLPHKALPDEDKARANWIKQLNAPLEEIDPEIADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFGLDPQKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGY+DYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLNESTGYVDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA+LLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYEDKINQAVFPGLQGGPHNHTI+GLAVALKQA TPEY+AYQEQVLSNCSKFAQ
Sbjct  309   GKEVMYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQARTPEYKAYQEQVLSNCSKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+EKGYELVSGGTENHLVLVNL+NKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  369   SLIEKGYELVSGGTENHLVLVNLRNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+E DFVKVAE+FDAAVKL++KIKA  QG KLK+FVA ++ SD  Q+E
Sbjct  429   IRMGTPALTSRGFIERDFVKVAEFFDAAVKLALKIKADAQGMKLKDFVAAMK-SDGHQSE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IA+LRHDVEEYAKQFPT+GFEK TMKYK+
Sbjct  488   IARLRHDVEEYAKQFPTVGFEKETMKYKD  516



>ref|XP_008219190.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Prunus 
mume]
Length=520

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/509 (87%), Positives = 481/509 (94%), Gaps = 2/509 (0%)
 Frame = +3

Query  219   SSSIEKPIK--TlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADII  392
             SSSI KP++       GGS+Y+MSSLSS+A  +KEK + +W KQLN  LE VDPEIA+II
Sbjct  10    SSSINKPLQPFVNGVNGGSIYHMSSLSSQAAQDKEKARATWIKQLNEPLEVVDPEIANII  69

Query  393   ELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQ  572
             ELEK+RQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQ
Sbjct  70    ELEKSRQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQ  129

Query  573   KRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDT  752
             KRALEAF+LDPAKWGVNVQ LSGSP+NFQ YTALLKPH+RIMALDLPHGGHLSHGYQTDT
Sbjct  130   KRALEAFQLDPAKWGVNVQSLSGSPANFQAYTALLKPHERIMALDLPHGGHLSHGYQTDT  189

Query  753   KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKV  932
             KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKV
Sbjct  190   KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKV  249

Query  933   CDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVN  1112
             CDKQKAILLADMAHISGLVAAGVIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKGVK +N
Sbjct  250   CDKQKAILLADMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVKNIN  309

Query  1113  KQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKF  1292
             KQG+EVLYDYEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSNCSKF
Sbjct  310   KQGQEVLYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLSNCSKF  369

Query  1293  AQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVP  1472
             A++L+EKGY+LVSGGTENHLVLVNL++KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVP
Sbjct  370   AESLLEKGYDLVSGGTENHLVLVNLRDKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVP  429

Query  1473  GGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQ  1652
             GGIRMGTPALTSRGF+EEDF KVAEYFDAAVKL++KIKAA +GTKLK+FVA L+S   IQ
Sbjct  430   GGIRMGTPALTSRGFLEEDFAKVAEYFDAAVKLALKIKAAAKGTKLKDFVAILESDGEIQ  489

Query  1653  AEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +EIAKLRH+VE+YAKQFPTIGFEK TMKY
Sbjct  490   SEIAKLRHEVEQYAKQFPTIGFEKETMKY  518



>gb|KDP41520.1| hypothetical protein JCGZ_15927 [Jatropha curcas]
Length=516

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/479 (89%), Positives = 463/479 (97%), Gaps = 0/479 (0%)
 Frame = +3

Query  309   EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             EKEK + SW KQLNA LEE+DPEIADIIELEKARQWKGLELIPSENFTS+SV+QAVGSVM
Sbjct  38    EKEKARASWIKQLNAPLEEIDPEIADIIELEKARQWKGLELIPSENFTSVSVLQAVGSVM  97

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF+LDP KWGVNVQ LSGSP+NFQVYT
Sbjct  98    TNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFQLDPEKWGVNVQSLSGSPANFQVYT  157

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDY+QLEKS
Sbjct  158   ALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYEQLEKS  217

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             ATLFRPKLIVAGASAYARLYDY RIRKVC+KQKA+LLADMAHISGLVAAGVIPSPF+YAD
Sbjct  218   ATLFRPKLIVAGASAYARLYDYARIRKVCEKQKAVLLADMAHISGLVAAGVIPSPFEYAD  277

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTIT  1208
             VVTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EV YDYEDKINQAVFPGLQGGPHNHTI+
Sbjct  278   VVTTTTHKSLRGPRGAMIFFRKGVKEINKQGQEVKYDYEDKINQAVFPGLQGGPHNHTIS  337

Query  1209  GLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDG  1388
             GLAVALKQ  TPEY+AYQEQVLSNCSKFAQ+L++KGYELVSGGT+NHLVLVNL+NKGIDG
Sbjct  338   GLAVALKQVKTPEYKAYQEQVLSNCSKFAQSLLDKGYELVSGGTDNHLVLVNLRNKGIDG  397

Query  1389  SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVK  1568
             SRVEK LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE+FDAAVK
Sbjct  398   SRVEKFLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEFFDAAVK  457

Query  1569  LSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             L++K+KA T+GTKLK+FV T++S+  +Q+EIAKLRHDVEEYAKQFPT+GFEK TMKYK+
Sbjct  458   LALKVKADTKGTKLKDFVTTMKSNAHVQSEIAKLRHDVEEYAKQFPTVGFEKETMKYKD  516



>ref|XP_004143436.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN48681.1| Serine hydroxymethyltransferase [Cucumis sativus]
Length=519

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 460/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KE+ +V WPKQLN  LE +DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  37    EAVYDKERPRVPWPKQLNDPLEVIDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  97    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE+SATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAA VIPSPF
Sbjct  217   LERSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAADVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  277   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGREVLYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVL NCS FAQ+L EKGYELVSGGT+NHLVLVNLKNK
Sbjct  337   HTITGLAVALKQATTPEYKAYQEQVLRNCSNFAQSLAEKGYELVSGGTDNHLVLVNLKNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAE+FD
Sbjct  397   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEFFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV ++VKIKA T+GTKLK+F+ T++S+   Q+EI  L+ DVEEYAK+FPTIGFEK TMK
Sbjct  457   AAVNIAVKIKAETKGTKLKDFLTTMESTPYFQSEIKNLKQDVEEYAKKFPTIGFEKETMK  516

Query  1737  YKN  1745
             YK+
Sbjct  517   YKS  519



>ref|XP_002872234.1| hypothetical protein ARALYDRAFT_489509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48493.1| hypothetical protein ARALYDRAFT_489509 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/514 (86%), Positives = 483/514 (94%), Gaps = 6/514 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI  L + G SL +MSSLS+ A+ E EK + SW KQLNASLEE+DPE+ADIIEL
Sbjct  9     SSSVKKPISLLSSNGDSLRFMSSLSTSAMAESEKSRSSWIKQLNASLEEIDPEVADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+INQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQ+QVL NCSKFA+
Sbjct  309   GKEVIYDYEDRINQAVFPGLQGGPHNHTITGLAVALKQARTPEYKAYQDQVLRNCSKFAE  368

Query  1299  ------TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVS  1460
                   +L+ KGY+LVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVS
Sbjct  369   LGIRPTSLLAKGYDLVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVS  428

Query  1461  AMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSS  1640
             AMVPGGIRMGTPALTSRGF+EEDFVKVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS+
Sbjct  429   AMVPGGIRMGTPALTSRGFIEEDFVKVAEYFDLAVKIALKIKAESQGTKLKDFVATMQSN  488

Query  1641  DAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             + +Q+E+AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  489   EKLQSEMAKLREMVEEYAKQFPTIGFEKETMRYK  522



>ref|XP_010320237.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Solanum lycopersicum]
Length=517

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/483 (89%), Positives = 461/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +AV ++E  +V+W KQLNA LEE+DPEIADIIE EKARQWKGLELIPSENFTSLSVMQAV
Sbjct  35    QAVRDREDPRVTWIKQLNAPLEEIDPEIADIIEHEKARQWKGLELIPSENFTSLSVMQAV  94

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE LCQKRALE F LDPAKWGVNVQ LSGSPSNF
Sbjct  95    GSVMTNKYSEGYPGARYYGGNEYIDMAERLCQKRALEVFNLDPAKWGVNVQSLSGSPSNF  154

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDY+Q
Sbjct  155   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYEQ  214

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  215   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  274

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  275   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKKGEEVMYDYEDKINQAVFPGLQGGPHN  334

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+  GY+LVSGGTENHLVLVNL+NK
Sbjct  335   HTISGLAVALKQVMTPEYKAYQEQVLSNCSKFAESLLAAGYDLVSGGTENHLVLVNLRNK  394

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD
Sbjct  395   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  454

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++K+KA T+GTKLK+FVATL S   IQ+E+AKLR DVE+YAKQFPT+GFEK TMK
Sbjct  455   AAVKLALKVKAETKGTKLKDFVATLSSDSNIQSEVAKLRQDVEDYAKQFPTVGFEKETMK  514

Query  1737  YKN  1745
             YKN
Sbjct  515   YKN  517



>ref|XP_006390781.1| hypothetical protein EUTSA_v10018408mg [Eutrema salsugineum]
 gb|ESQ28067.1| hypothetical protein EUTSA_v10018408mg [Eutrema salsugineum]
Length=518

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/508 (86%), Positives = 479/508 (94%), Gaps = 0/508 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI  + + GGSL +MSSLS+ A+ + E+ + SW KQLNA LEE+DPEIADIIEL
Sbjct  10    SSSVKKPISLVSSNGGSLRFMSSLSTSAMADSERSRSSWIKQLNAPLEEIDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTS SVM+AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKGFELIPSENFTSASVMEAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  250   KQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+IN AVFPGLQGGPHNHTITGLAVALKQ  TPEY+AYQ+QVL NCSKFA+
Sbjct  310   GKEVMYDYEDRINSAVFPGLQGGPHNHTITGLAVALKQVKTPEYKAYQDQVLRNCSKFAE  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLLAKGYDLVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  430   IRMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  489

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  490   MAKLREMVEEYAKQFPTIGFEKETMRYK  517



>ref|XP_010421535.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Camelina 
sativa]
Length=517

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/508 (85%), Positives = 482/508 (95%), Gaps = 0/508 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             S+S++KPI  L + G SL +MSS+S+ A+ + EK + SW KQLNASL+E+DPE+ADIIEL
Sbjct  9     STSVKKPISRLSSNGDSLRFMSSVSASAMADSEKSRSSWIKQLNASLDEIDPEVADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQ+R
Sbjct  69    EKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQRR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+INQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQ+QVL NCS+FA+
Sbjct  309   GKEVMYDYEDRINQAVFPGLQGGPHNHTITGLAVALKQARTPEYKAYQDQVLRNCSRFAE  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  369   TLLAKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF +VA+YFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  429   IRMGTPALTSRGFIEEDFARVADYFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  489   MAKLREMVEEYAKQFPTIGFEKETMRYK  516



>ref|XP_007225719.1| hypothetical protein PRUPE_ppa004304mg [Prunus persica]
 gb|EMJ26918.1| hypothetical protein PRUPE_ppa004304mg [Prunus persica]
Length=517

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/507 (88%), Positives = 481/507 (95%), Gaps = 1/507 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI KP +  +  GGS+Y+MSSLSS+A  +KEK + +W KQLN  LE VDPEI++IIEL
Sbjct  10    SSSINKP-RQPFVNGGSIYHMSSLSSQAAQDKEKARATWIKQLNEPLEVVDPEISNIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EK+RQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  69    EKSRQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDPAKWGVNVQ LSGSP+NFQ YTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPAKWGVNVQSLSGSPANFQAYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YAD+VTTTTHKSLRGPRGAMIF+RKGVK +NKQ
Sbjct  249   KQKAILLADMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVKNINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G+EVLYDYEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFA+
Sbjct  309   GQEVLYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLSNCSKFAE  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+EKGY+LVSGGTENHLVLVNL++KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  369   SLLEKGYDLVSGGTENHLVLVNLRDKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAEYFDAAVKL++KIKAA +GTKLK+FVA L+S   IQ+E
Sbjct  429   IRMGTPALTSRGFLEEDFAKVAEYFDAAVKLALKIKAAAKGTKLKDFVAILESDGEIQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             IAKLRH+VE+YAKQFPTIGFEK TMKY
Sbjct  489   IAKLRHEVEQYAKQFPTIGFEKETMKY  515



>ref|XP_004160122.1| PREDICTED: LOW QUALITY PROTEIN: serine hydroxymethyltransferase, 
mitochondrial-like [Cucumis sativus]
Length=519

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/483 (89%), Positives = 459/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVY+KE+ +V WPKQLN  LE +DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  37    EAVYDKERPRVPWPKQLNDPLEVIDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  97    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE+SATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAA VIPSPF
Sbjct  217   LERSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAADVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  277   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGREVLYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQATTPEY+AYQEQVL NCS FAQ+L EKGYELVSGGT+NHLVLVNLKNK
Sbjct  337   HTITGLAVALKQATTPEYKAYQEQVLRNCSNFAQSLAEKGYELVSGGTDNHLVLVNLKNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAAN NTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAE+FD
Sbjct  397   GIDGSRVEKVLESVHIAANXNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEFFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV ++VKIKA T+GTKLK+F+ T++S+   Q+EI  L+ DVEEYAK+FPTIGFEK TMK
Sbjct  457   AAVNIAVKIKAETKGTKLKDFLTTMESTPYFQSEIKNLKQDVEEYAKKFPTIGFEKETMK  516

Query  1737  YKN  1745
             YK+
Sbjct  517   YKS  519



>ref|NP_851080.1| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
 sp|Q94C74.2|GLYM2_ARATH RecName: Full=Serine hydroxymethyltransferase 2, mitochondrial; 
Short=AtSHMT2; AltName: Full=Glycine hydroxymethyltransferase 
2; AltName: Full=Serine methylase 2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAH56787.1| AT5G26780 [Arabidopsis thaliana]
 gb|AED93602.1| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
Length=517

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/508 (86%), Positives = 482/508 (95%), Gaps = 0/508 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI  L + GGSL +MSSLS+ A+ E EK + SW KQLNASL+E+DPE+ADIIEL
Sbjct  9     SSSVKKPISLLSSNGGSLRFMSSLSTAAMAESEKSRSSWIKQLNASLDEIDPEVADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+INQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQ+QVL NCSKFA+
Sbjct  309   GKEVMYDYEDRINQAVFPGLQGGPHNHTITGLAVALKQARTPEYKAYQDQVLRNCSKFAE  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  369   TLLAKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  429   IRMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             ++KLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  489   MSKLREMVEEYAKQFPTIGFEKETMRYK  516



>ref|XP_011016976.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Populus 
euphratica]
 ref|XP_011016977.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Populus 
euphratica]
Length=516

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/509 (87%), Positives = 475/509 (93%), Gaps = 1/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   NGG     MSSL  +A+ ++   + +W KQLNA LEE+DPEIADIIEL
Sbjct  9     SSSLRNPIKPYLNGGSLYCNMSSLPHKALPDEGTARANWIKQLNAPLEEIDPEIADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFGLDPQKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGY+DYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  189   ISAVSIFFETMPYRLNESTGYVDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA+LLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  249   KQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFAQ
Sbjct  309   GKEVMYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQVRTPEYKAYQEQVLSNCSKFAQ  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+EKGYELVSGGTENHLVLVNL+NKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  369   SLIEKGYELVSGGTENHLVLVNLRNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+E DFVKVAE+FDAAVKL++KIKA  QGTKLK+FVA ++ SD  Q+E
Sbjct  429   IRMGTPALTSRGFIERDFVKVAEFFDAAVKLALKIKADAQGTKLKDFVAAMK-SDGHQSE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IA+LRHDVEEYAKQFPT+GFEK TMKYK+
Sbjct  488   IARLRHDVEEYAKQFPTVGFEKETMKYKD  516



>ref|XP_008810278.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Phoenix 
dactylifera]
Length=518

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 460/483 (95%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             E VY+KE+ +V+WPKQLNA LE VDP++ +IIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  35    EDVYDKERSRVTWPKQLNAPLEAVDPDVFNIIELEKARQWKGLELIPSENFTSVSVMQAV  94

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALE F LDPAKWGVNVQ LSGSPSNF
Sbjct  95    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEVFGLDPAKWGVNVQSLSGSPSNF  154

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  155   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  214

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRK+C+KQKAILLADMAHISGLVA GVIPSPF
Sbjct  215   LEKSAALFRPKLIVAGASAYARLYDYARIRKICNKQKAILLADMAHISGLVAGGVIPSPF  274

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EVLYD+EDKIN AVFPGLQGGPHN
Sbjct  275   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGQEVLYDFEDKINAAVFPGLQGGPHN  334

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQA TPEYRAYQEQVLSNCSKFAQ LVEKGYELVSGGTENHLVLVNLKNK
Sbjct  335   HTITGLAVALKQAMTPEYRAYQEQVLSNCSKFAQCLVEKGYELVSGGTENHLVLVNLKNK  394

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  395   GIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  454

Query  1557  AAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
              AVK+++KIKA T+ G+KLK+F+AT+Q+   +Q+EIAKLRH+VEEYAKQFPTIGFEK TM
Sbjct  455   TAVKIALKIKAETKGGSKLKDFLATIQTDANVQSEIAKLRHEVEEYAKQFPTIGFEKETM  514

Query  1734  KYK  1742
             KYK
Sbjct  515   KYK  517



>ref|XP_006364981.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Solanum tuberosum]
Length=519

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/483 (88%), Positives = 460/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +AV  +E  +V+W KQLNA LEE+DPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  37    QAVRNREDPRVTWIKQLNAPLEEIDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE LCQKRALE F LDPAKWGVNVQ LSGSPSNF
Sbjct  97    GSVMTNKYSEGYPGARYYGGNEYIDMAERLCQKRALEVFNLDPAKWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDY+Q
Sbjct  157   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYEQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  217   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  277   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKKGEEVMYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+  GY+LVSGGTENHLVLVNL+NK
Sbjct  337   HTISGLAVALKQVMTPEYKAYQEQVLSNCSKFAESLLAAGYDLVSGGTENHLVLVNLRNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVAE+FD
Sbjct  397   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFVKVAEFFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             +AVKL++K+KA  +GTKLK+FVATL S   IQ+E+AKLR DVE+YAKQFPT+GFEK TMK
Sbjct  457   SAVKLALKVKAEAKGTKLKDFVATLSSDSNIQSEVAKLRQDVEDYAKQFPTVGFEKETMK  516

Query  1737  YKN  1745
             YKN
Sbjct  517   YKN  519



>ref|XP_009765987.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Nicotiana sylvestris]
Length=519

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/483 (88%), Positives = 459/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A+ E+E  +V+W KQLNA LE++DPEIADIIE EKARQWKGLELIPSENFTSLSVMQAV
Sbjct  37    QAIREREDPRVTWIKQLNAPLEDIDPEIADIIEHEKARQWKGLELIPSENFTSLSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE LCQKRALE F LDP +WGVNVQ LSGSPSNF
Sbjct  97    GSVMTNKYSEGYPGARYYGGNEYIDMAERLCQKRALEVFNLDPTRWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  217   LEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQGKEV+YDYEDKINQAVFPGLQGGPHN
Sbjct  277   EYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDKINQAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+  GY+LVSGGTENHLVLVNL+NK
Sbjct  337   HTISGLAVALKQVMTPEYKAYQEQVLSNCSKFAESLLANGYDLVSGGTENHLVLVNLRNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVAE+FD
Sbjct  397   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFVKVAEFFD  456

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++K+KA TQGTKLK+FVATL S   IQ+EIA+LR DVE+YAKQFPTIGFEK TMK
Sbjct  457   AAVKLALKVKAETQGTKLKDFVATLSSDSKIQSEIARLRQDVEDYAKQFPTIGFEKETMK  516

Query  1737  YKN  1745
             YK+
Sbjct  517   YKD  519



>ref|XP_006856608.1| hypothetical protein AMTR_s00046p00219150 [Amborella trichopoda]
 gb|ERN18075.1| hypothetical protein AMTR_s00046p00219150 [Amborella trichopoda]
Length=517

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/481 (90%), Positives = 463/481 (96%), Gaps = 2/481 (0%)
 Frame = +3

Query  306   YEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSV  485
             Y+KE+  V WPKQLNA LEEVDPEIA+IIELEKARQWKGLELIPSENFTS+SVMQAVGSV
Sbjct  38    YDKERSNVPWPKQLNAPLEEVDPEIANIIELEKARQWKGLELIPSENFTSVSVMQAVGSV  97

Query  486   MTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVY  665
             M NKYSEGYPGARYYGGNEYIDMAESLCQKRALEA+RLDP KWGVNVQPLSGSP+NF VY
Sbjct  98    MCNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAYRLDPEKWGVNVQPLSGSPANFHVY  157

Query  666   TALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEK  845
             TALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQLEK
Sbjct  158   TALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEK  217

Query  846   SATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYA  1025
             SATLFRPKLIVAGASAYARLYDY RIRKVC+KQKA+LLADMAHISGLVAAGVIPSPF+YA
Sbjct  218   SATLFRPKLIVAGASAYARLYDYARIRKVCNKQKAVLLADMAHISGLVAAGVIPSPFEYA  277

Query  1026  DVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTI  1205
             DVVTTTTHKSLRGPRGAMIF+RKGVKEVNKQG++V+YDYE+KIN AVFPGLQGGPHNHTI
Sbjct  278   DVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQGQQVMYDYEEKINAAVFPGLQGGPHNHTI  337

Query  1206  TGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGID  1385
             TGLAVALKQATTPEY+AYQEQVLSNCSKFAQ L+E GYELVSGGT+NHLVLVNLKNKGID
Sbjct  338   TGLAVALKQATTPEYKAYQEQVLSNCSKFAQRLMENGYELVSGGTDNHLVLVNLKNKGID  397

Query  1386  GSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAV  1565
             GSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVA++FDAAV
Sbjct  398   GSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFVKVADFFDAAV  457

Query  1566  KLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             KL+VK+K  T+ GTKLK+FVATLQ+ D IQ+EIAKLRH+VEEYAKQFPTIGFEK TMKYK
Sbjct  458   KLAVKVKNETKGGTKLKDFVATLQTPD-IQSEIAKLRHEVEEYAKQFPTIGFEKATMKYK  516

Query  1743  N  1745
             +
Sbjct  517   D  517



>gb|EPS63381.1| serine hydroxymethyltransferase, partial [Genlisea aurea]
Length=468

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/470 (92%), Positives = 455/470 (97%), Gaps = 3/470 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             WPKQLNA LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGY
Sbjct  1     WPKQLNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGY  60

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGN+YIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NFQVYTALLKPHDR
Sbjct  61    PGARYYGGNKYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFQVYTALLKPHDR  120

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA LFRPKL
Sbjct  121   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAVLFRPKL  180

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYARLYDY RI+KVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD+VTTTTHK
Sbjct  181   IVAGASAYARLYDYARIKKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADIVTTTTHK  240

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIF+RKGVKE+NKQG+EVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQ
Sbjct  241   SLRGPRGAMIFFRKGVKEINKQGQEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQ  300

Query  1233  ATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE  1412
             ATTPEY+AYQEQVLSNCSKFAQ LVEKGYELVSGGTENHLVLVNLK KGIDGSRVEKVLE
Sbjct  301   ATTPEYKAYQEQVLSNCSKFAQALVEKGYELVSGGTENHLVLVNLKKKGIDGSRVEKVLE  360

Query  1413  SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAA  1592
             SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVAE+FDAAV L++KIKA 
Sbjct  361   SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEEDFVKVAEFFDAAVNLALKIKAE  420

Query  1593  TQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             T+GTKLK+FV+T+    A Q+EI+KLR +VEEYAKQFPTIGFEK +MKY+
Sbjct  421   TKGTKLKDFVSTI---PAFQSEISKLRGEVEEYAKQFPTIGFEKQSMKYR  467



>ref|XP_010918336.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Elaeis 
guineensis]
Length=550

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/485 (89%), Positives = 465/485 (96%), Gaps = 2/485 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA+Y+KEK +V+WPKQLNA LE VDPEI +IIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  66    EAIYDKEKSRVTWPKQLNAPLESVDPEIFNIIELEKARQWKGLELIPSENFTSISVMQAV  125

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALE FRLDPAKWGVNVQ LSGSP+NF
Sbjct  126   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEVFRLDPAKWGVNVQSLSGSPANF  185

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  186   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  245

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAA VIPSPF
Sbjct  246   LEKSAALFRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAADVIPSPF  305

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NK+G+EVLYD+EDKIN AVFPGLQGGPHN
Sbjct  306   EYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKKGQEVLYDFEDKINAAVFPGLQGGPHN  365

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTITGLAVALKQA TPEY+AYQEQVLSNCSKFAQ LVEKGY+LVSGGTENHLVLVNLKNK
Sbjct  366   HTITGLAVALKQAMTPEYKAYQEQVLSNCSKFAQCLVEKGYDLVSGGTENHLVLVNLKNK  425

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKV+E VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  426   GIDGSRVEKVMELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  485

Query  1557  AAVKLSVKIKAATQ-GTKLKEFVATLQSS-DAIQAEIAKLRHDVEEYAKQFPTIGFEKHT  1730
              AV+L++KIKA T+ G+KLK+F+AT+Q+  + IQ+EIAKLRH+VE+YAKQFPTIGFEK T
Sbjct  486   TAVQLALKIKAETKGGSKLKDFLATIQTDGNNIQSEIAKLRHEVEDYAKQFPTIGFEKET  545

Query  1731  MKYKN  1745
             MKYK+
Sbjct  546   MKYKD  550



>gb|AAK59622.1| putative glycine hydroxymethyltransferase [Arabidopsis thaliana]
Length=517

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/508 (86%), Positives = 481/508 (95%), Gaps = 0/508 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI  L + GGSL +MSSLS+ A+ E EK + SW KQLNASL+E+DPE+ADIIEL
Sbjct  9     SSSVKKPISLLSSNGGSLRFMSSLSTAAMAESEKSRSSWIKQLNASLDEIDPEVADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+INQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQ+QVL NCSKFA+
Sbjct  309   GKEVMYDYEDRINQAVFPGLQGGPHNHTITGLAVALKQARTPEYKAYQDQVLRNCSKFAE  368

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGG
Sbjct  369   TLLAKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGG  428

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             I MGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  429   IHMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  488

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             ++KLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  489   MSKLREMVEEYAKQFPTIGFEKETMRYK  516



>ref|XP_010064700.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial-like 
[Eucalyptus grandis]
Length=643

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/483 (88%), Positives = 461/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAV +KE  + +W KQLN  LE +DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  161   EAVQDKESARATWIKQLNEPLETIDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAV  220

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDPAKWGVNVQ LSGSP+NF
Sbjct  221   GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFGLDPAKWGVNVQSLSGSPANF  280

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNE+TGYIDYDQ
Sbjct  281   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNETTGYIDYDQ  340

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA L+RPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  341   LEKSAILYRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  400

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  401   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQGGPHN  460

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTIT LAVALKQA TPEY+AYQEQVLSNCS+F+Q+L+EKGYELVSGGTENHLVLVNL+N+
Sbjct  461   HTITALAVALKQAMTPEYKAYQEQVLSNCSRFSQSLLEKGYELVSGGTENHLVLVNLRNQ  520

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDF +VA++FD
Sbjct  521   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFGEEDFARVADFFD  580

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++K+KA ++GTKLK+FVAT+QS   IQ+EI KLR DVEEYAKQFPTIGFEK TM+
Sbjct  581   AAVKLALKVKANSKGTKLKDFVATMQSDANIQSEITKLREDVEEYAKQFPTIGFEKETMR  640

Query  1737  YKN  1745
             YKN
Sbjct  641   YKN  643



>ref|XP_008378620.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Malus 
domestica]
Length=516

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/482 (88%), Positives = 458/482 (95%), Gaps = 0/482 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A  +KEK + +W KQLN  LE VDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  34    QAAQDKEKARATWIKQLNEPLEVVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDPAKWGVNVQPLSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPAKWGVNVQPLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             +EKSATLFRPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAA VIPSPF
Sbjct  214   MEKSATLFRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAAAVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVK +NKQG+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  274   EYADIVTTTTHKSLRGPRGAMIFFRKGVKHINKQGQEVMYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+EKGY+LVSGGTENHLVLVNL++K
Sbjct  334   HTIAGLAVALKQVKTPEYKAYQEQVLSNCSKFAESLLEKGYDLVSGGTENHLVLVNLRDK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+E+DF KVAEYFD
Sbjct  394   GIDGSRVEKVLEXVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEDDFXKVAEYFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++KIKA  +GTKLK+FVA LQS   +Q+EI KLRH+VE+YAKQFPT+GFEK TM+
Sbjct  454   AAVKLALKIKANAKGTKLKDFVAALQSDSQVQSEITKLRHEVEQYAKQFPTVGFEKETMR  513

Query  1737  YK  1742
             Y+
Sbjct  514   YR  515



>ref|XP_009628185.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=521

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/483 (88%), Positives = 458/483 (95%), Gaps = 0/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A+ E+E  +V+W KQLNA LE++DPEIADIIE EKARQWKGLELIPSENFTSLSVMQAV
Sbjct  39    QAIREREDPRVTWIKQLNAPLEDIDPEIADIIEHEKARQWKGLELIPSENFTSLSVMQAV  98

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE LCQKRALE F LDPAKWGVNVQ LSGSPSNF
Sbjct  99    GSVMTNKYSEGYPGARYYGGNEYIDMAERLCQKRALEVFNLDPAKWGVNVQSLSGSPSNF  158

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  159   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  218

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  219   LEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  278

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQGKEV+YDYEDKINQAVFPGLQGGPHN
Sbjct  279   EYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDKINQAVFPGLQGGPHN  338

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+  GY+LVSGGTENHLVLVNL+NK
Sbjct  339   HTISGLAVALKQVMTPEYKAYQEQVLSNCSKFAESLLANGYDLVSGGTENHLVLVNLRNK  398

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVAE+FD
Sbjct  399   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFVKVAEFFD  458

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++K+K  TQGTKLK+FV TL S   IQ+EIA+LR DVE+YAKQFPTIGFEK TMK
Sbjct  459   AAVKLALKVKVETQGTKLKDFVETLSSDSKIQSEIARLRQDVEDYAKQFPTIGFEKETMK  518

Query  1737  YKN  1745
             YK+
Sbjct  519   YKD  521



>ref|XP_008338989.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Malus domestica]
Length=516

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/482 (88%), Positives = 458/482 (95%), Gaps = 0/482 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A  +K K + +W KQLN  LE VD EIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  34    QAAQDKXKARTTWIKQLNEPLEAVDSEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDPAKWGVNVQPLSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPAKWGVNVQPLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  154   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             +EKSATLFRPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAA VIPSPF
Sbjct  214   MEKSATLFRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAADVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVK +NKQG+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  274   EYADIVTTTTHKSLRGPRGAMIFFRKGVKHINKQGQEVMYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI GLAVALKQ  TPEY+AYQEQVLSNCSKFA++L+EKGY+LVSGGTENHLVLVNL++K
Sbjct  334   HTIAGLAVALKQVKTPEYKAYQEQVLSNCSKFAESLLEKGYDLVSGGTENHLVLVNLRDK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLES HIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVAEYFD
Sbjct  394   GIDGSRVEKVLESAHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEEDFVKVAEYFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++KIKAA +GTKLK+FVA L+S   +Q+EI KLRH+VE+YAKQFPTIGFEK TM+
Sbjct  454   AAVKLALKIKAAAKGTKLKDFVAVLESDGEVQSEITKLRHEVEQYAKQFPTIGFEKETMR  513

Query  1737  YK  1742
             Y+
Sbjct  514   YR  515



>ref|XP_004148411.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004168619.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Cucumis sativus]
Length=516

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/482 (88%), Positives = 459/482 (95%), Gaps = 0/482 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             A  E+EK + +W +QLNA LE +DPEIADIIELEKARQWKG ELIPSENFTS SVM+AVG
Sbjct  35    AAEEREKARATWIQQLNAPLEVIDPEIADIIELEKARQWKGFELIPSENFTSSSVMEAVG  94

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQ LSGSP+NFQ
Sbjct  95    SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQSLSGSPANFQ  154

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
              YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQL
Sbjct  155   AYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQL  214

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             E+SA+LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+
Sbjct  215   ERSASLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFE  274

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  275   YADIVTTTTHKSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNH  334

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI GLAVALKQATTPEY+AYQEQVLSNCSKFAQ+L+EKGYELVSGGT+NHLVLVNLKNKG
Sbjct  335   TIAGLAVALKQATTPEYKAYQEQVLSNCSKFAQSLIEKGYELVSGGTDNHLVLVNLKNKG  394

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+E DFVKVAE FD 
Sbjct  395   IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEADFVKVAELFDE  454

Query  1560  AVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              VKL++KIKA ++GTKLK+FVAT+QS+   Q+EI+KLRH VEEYAKQFPTIGFEK TM+Y
Sbjct  455   TVKLALKIKAGSEGTKLKDFVATMQSNKDFQSEISKLRHQVEEYAKQFPTIGFEKETMRY  514

Query  1740  KN  1745
             ++
Sbjct  515   RD  516



>ref|XP_002527346.1| serine hydroxymethyltransferase, putative [Ricinus communis]
 gb|EEF35018.1| serine hydroxymethyltransferase, putative [Ricinus communis]
Length=513

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/482 (88%), Positives = 463/482 (96%), Gaps = 1/482 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             AV +KEK   +W KQLN+ LEE DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAVG
Sbjct  33    AVADKEKAPAAWIKQLNSPLEETDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAVG  92

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF+LDP KWGVNVQ LSGSP+NFQ
Sbjct  93    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFQLDPEKWGVNVQSLSGSPANFQ  152

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDY+QL
Sbjct  153   VYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYEQL  212

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+
Sbjct  213   EKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFE  272

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EV YD+EDKINQAVFPGLQGGPHNH
Sbjct  273   YADIVTTTTHKSLRGPRGAMIFFRKGVKEINKKGEEVKYDFEDKINQAVFPGLQGGPHNH  332

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI+GLAVALKQ  TPEY+AYQEQVL NCSKF+Q+L+EKGYELVSGGTENHLVLVNL+NKG
Sbjct  333   TISGLAVALKQVMTPEYKAYQEQVLKNCSKFSQSLLEKGYELVSGGTENHLVLVNLRNKG  392

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAE+FDA
Sbjct  393   IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEFFDA  452

Query  1560  AVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             AVKL++KIKA T+GTKLK+FVAT++SSD IQ+ IA+LRHDVEEYAKQFPT+GFEK TMKY
Sbjct  453   AVKLALKIKADTKGTKLKDFVATMKSSD-IQSGIAQLRHDVEEYAKQFPTVGFEKETMKY  511

Query  1740  KN  1745
             K+
Sbjct  512   KD  513



>ref|XP_011074288.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial-like 
[Sesamum indicum]
Length=511

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/483 (88%), Positives = 462/483 (96%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +AV +K+  +++W +QLNA LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVM+AV
Sbjct  30    QAVSQKDSSRITWTRQLNAPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMEAV  89

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALE F+LDP KWGVNVQ LSGSP+NF
Sbjct  90    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALETFKLDPEKWGVNVQSLSGSPANF  149

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  150   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  209

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  210   LEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  269

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             ++ADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV+YDYEDKINQAVFPGLQGGPHN
Sbjct  270   EHADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVMYDYEDKINQAVFPGLQGGPHN  329

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTIT LAVALKQA TPEY+AYQEQVLSNCSKFA+TL+EKGY+LVSGGTENHLVLVNL++K
Sbjct  330   HTITALAVALKQAMTPEYKAYQEQVLSNCSKFAETLLEKGYDLVSGGTENHLVLVNLRDK  389

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE+FD
Sbjct  390   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEFFD  449

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL+++IKA T GTKLK+FV  ++ SDA Q+ +++LR +VEEYAKQFPTIGFEK TMK
Sbjct  450   AAVKLALRIKADTNGTKLKDFVTAMK-SDAHQSAMSRLRIEVEEYAKQFPTIGFEKETMK  508

Query  1737  YKN  1745
             YK+
Sbjct  509   YKD  511



>ref|XP_007018307.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007018309.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007018310.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007018311.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007018312.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 gb|EOY15532.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 gb|EOY15534.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 gb|EOY15535.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 gb|EOY15536.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
 gb|EOY15537.1| Serine hydroxymethyltransferase 2 isoform 1 [Theobroma cacao]
Length=514

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/472 (90%), Positives = 454/472 (96%), Gaps = 0/472 (0%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             +W  QLNA LEE+DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEG
Sbjct  43    NWIHQLNAPLEEIDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEG  102

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNEYIDMAESLCQKRALEAF LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+
Sbjct  103   YPGARYYGGNEYIDMAESLCQKRALEAFGLDPAKWGVNVQSLSGSPANFQVYTALLKPHE  162

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTG+IDYDQLEKSA LFRPK
Sbjct  163   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGFIDYDQLEKSAVLFRPK  222

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             LIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTH
Sbjct  223   LIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTH  282

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKGVKE+NK+G+EV+YD+EDKINQAVFPGLQGGPHNHTITGLAVALK
Sbjct  283   KSLRGPRGAMIFFRKGVKEINKKGQEVMYDFEDKINQAVFPGLQGGPHNHTITGLAVALK  342

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             Q  TPEY+AYQEQVLSNCSKFAQ L+EKGYELVSGGTENHLVLVNL+NKGIDGSRVEKV+
Sbjct  343   QVRTPEYKAYQEQVLSNCSKFAQRLLEKGYELVSGGTENHLVLVNLRNKGIDGSRVEKVM  402

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVA++FDAAVKL++KIKA
Sbjct  403   ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFEKVADFFDAAVKLALKIKA  462

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              T+GTKLK+FV TLQS   IQ+EIAKLR +VEEYAKQFPTIGFEK TMKYK+
Sbjct  463   ETKGTKLKDFVETLQSDVNIQSEIAKLRREVEEYAKQFPTIGFEKETMKYKD  514



>ref|XP_006379385.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
 gb|ERP57182.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
Length=510

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/508 (88%), Positives = 471/508 (93%), Gaps = 11/508 (2%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQATT EY+AYQE          Q+
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQATTLEYKAYQE----------QS  363

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  364   LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  423

Query  1482  RMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEI  1661
             RMGTPALTSRGFVEEDF KVA++FDA+VKL+VK+KA T+GTKLK+F+ T+QS+   Q+EI
Sbjct  424   RMGTPALTSRGFVEEDFAKVADFFDASVKLAVKMKAETKGTKLKDFLVTMQSAH-FQSEI  482

Query  1662  AKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +KLRH+VEEYAKQFPTIGF K TMKYKN
Sbjct  483   SKLRHEVEEYAKQFPTIGFNKETMKYKN  510



>emb|CDX68316.1| BnaA07g23560D [Brassica napus]
Length=1170

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/476 (88%), Positives = 454/476 (95%), Gaps = 0/476 (0%)
 Frame = +3

Query  315   EKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             E+ + +W +QLNA LEE+DPEIADIIELEKARQWKG ELIPSENFTS SVM+AVGSVMTN
Sbjct  694   ERSRSTWIRQLNAPLEEIDPEIADIIELEKARQWKGFELIPSENFTSASVMEAVGSVMTN  753

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNEYIDMAESLCQKRALEAF LDP+KWGVNVQ LSGSP+NFQVYTAL
Sbjct  754   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFHLDPSKWGVNVQSLSGSPANFQVYTAL  813

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             LKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQLEKSA 
Sbjct  814   LKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYDQLEKSAV  873

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
             LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+YADVV
Sbjct  874   LFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFEYADVV  933

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGL  1214
             TTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV+YDYED+IN AVFPGLQGGPHNHTITGL
Sbjct  934   TTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVMYDYEDRINAAVFPGLQGGPHNHTITGL  993

Query  1215  AVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSR  1394
             AVALKQ  TPEY+AYQ+QVL NCSKFA+TL+ KGY+LVSGGTENHLVLVNLKNKGIDGSR
Sbjct  994   AVALKQVKTPEYKAYQDQVLRNCSKFAETLLSKGYDLVSGGTENHLVLVNLKNKGIDGSR  1053

Query  1395  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS  1574
             VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVAEYFD AVK++
Sbjct  1054  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFAKVAEYFDLAVKIA  1113

Query  1575  VKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +KIKA +QGTKLK+FVAT+QS++ +Q+E+AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  1114  LKIKAESQGTKLKDFVATMQSNEKLQSEMAKLREMVEEYAKQFPTIGFEKETMRYK  1169



>ref|NP_851081.1| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
 ref|NP_568488.2| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
 gb|AAN61005.1| putative glycine hydroxymethyltransferase [Arabidopsis thaliana]
 gb|AAN64177.1| putative glycine hydroxymethyltransferase [Arabidopsis thaliana]
 gb|AED93603.1| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
 gb|AED93604.1| serine hydroxymethyltransferase 2 [Arabidopsis thaliana]
Length=533

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/524 (83%), Positives = 482/524 (92%), Gaps = 16/524 (3%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI  L + GGSL +MSSLS+ A+ E EK + SW KQLNASL+E+DPE+ADIIEL
Sbjct  9     SSSVKKPISLLSSNGGSLRFMSSLSTAAMAESEKSRSSWIKQLNASLDEIDPEVADIIEL  68

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  69    EKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  128

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  129   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  188

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVC+
Sbjct  189   ISAVSIFFETMPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCN  248

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  249   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  308

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFA-  1295
             GKEV+YDYED+INQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQ+QVL NCSKFA 
Sbjct  309   GKEVMYDYEDRINQAVFPGLQGGPHNHTITGLAVALKQARTPEYKAYQDQVLRNCSKFAE  368

Query  1296  ---------------QTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAA  1430
                            QTL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE VHIAA
Sbjct  369   LDIRPTVIISYGLSMQTLLAKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLELVHIAA  428

Query  1431  NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKL  1610
             NKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKL
Sbjct  429   NKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKL  488

Query  1611  KEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             K+FVAT+QS++ +Q+E++KLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  489   KDFVATMQSNEKLQSEMSKLREMVEEYAKQFPTIGFEKETMRYK  532



>ref|XP_003519208.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial [Glycine 
max]
Length=514

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/477 (88%), Positives = 453/477 (95%), Gaps = 0/477 (0%)
 Frame = +3

Query  309   EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             EK+K +  W KQLN  LE +DPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVGSVM
Sbjct  36    EKDKSRADWIKQLNDPLETIDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVGSVM  95

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQ LSGSPSNFQVYT
Sbjct  96    TNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQSLSGSPSNFQVYT  155

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS
Sbjct  156   ALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  215

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             A LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFDYAD
Sbjct  216   AVLFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFDYAD  275

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTIT  1208
             VVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYED+INQAVFPGLQGGPHNHTI+
Sbjct  276   VVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDRINQAVFPGLQGGPHNHTIS  335

Query  1209  GLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDG  1388
             GLAVALKQA TPE++ YQ+QVLSNCS FAQ+L+EKGYELVSGGT+NHLVLVNL+NKGIDG
Sbjct  336   GLAVALKQAMTPEFKNYQKQVLSNCSAFAQSLLEKGYELVSGGTDNHLVLVNLRNKGIDG  395

Query  1389  SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVK  1568
             SRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAEYFDAAVK
Sbjct  396   SRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFEKVAEYFDAAVK  455

Query  1569  LSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             L+++IK  T GTKLK+FVA +QS + +Q++IA LRH+VE+YAKQFPTIGF+  TMKY
Sbjct  456   LALQIKENTNGTKLKDFVAAMQSDEQVQSKIANLRHEVEDYAKQFPTIGFDIETMKY  512



>emb|CDP19594.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/483 (87%), Positives = 460/483 (95%), Gaps = 1/483 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +AV EKE  +++W KQLNA LEE+DPEIADIIELEKARQWKGLELIPSENFTS SVMQAV
Sbjct  39    QAVGEKENSRITWIKQLNAPLEEIDPEIADIIELEKARQWKGLELIPSENFTSTSVMQAV  98

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS+MTNKYSEGYPGARYYGGNEYIDMAE LCQ RALEAF LDP KWGVNVQ LSGSP+NF
Sbjct  99    GSIMTNKYSEGYPGARYYGGNEYIDMAERLCQTRALEAFNLDPTKWGVNVQSLSGSPANF  158

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  159   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  218

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF
Sbjct  219   LEKSATLFRPKLIVAGASAYARLYDYQRIRKVCDKQKAVMLADMAHISGLVAAGVIPSPF  278

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             ++ADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQG+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  279   EFADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGQEVMYDYEDKINQAVFPGLQGGPHN  338

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+ LAVALKQA TPEY+AYQEQVLSNCSKFA+TL+  GYELVSGGT+NHLVLVNL+NK
Sbjct  339   HTISALAVALKQAMTPEYKAYQEQVLSNCSKFAETLLASGYELVSGGTDNHLVLVNLRNK  398

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDFV+VA++FD
Sbjct  399   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFAEEDFVEVAKFFD  458

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAVKL++KIKA T+GTKLK+FVA ++ ++ +Q+EI KLRH+VEEYAKQFPTIGFEK TMK
Sbjct  459   AAVKLALKIKAETKGTKLKDFVAAMKDAN-LQSEITKLRHEVEEYAKQFPTIGFEKETMK  517

Query  1737  YKN  1745
             +K+
Sbjct  518   HKD  520



>ref|XP_008444959.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Cucumis 
melo]
Length=516

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/472 (89%), Positives = 454/472 (96%), Gaps = 0/472 (0%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             +W +QLNA LE +DPEIADIIELEKARQWKGLELIPSENFTS SVM+AVGSVMTNKYSEG
Sbjct  45    TWIQQLNAPLEVIDPEIADIIELEKARQWKGLELIPSENFTSSSVMEAVGSVMTNKYSEG  104

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQ LSGSP+NFQ YTALLKPH+
Sbjct  105   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQSLSGSPANFQAYTALLKPHE  164

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQLE+SA+LFRPK
Sbjct  165   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLERSASLFRPK  224

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             LIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+YAD+VTTTTH
Sbjct  225   LIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFEYADIVTTTTH  284

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTI GLAVALK
Sbjct  285   KSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNHTIAGLAVALK  344

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QATTPEY+AYQEQVLSNCSKFAQ+L+EKGYELVSGGT+NHLVLVNLKNKGIDGSRVEKVL
Sbjct  345   QATTPEYKAYQEQVLSNCSKFAQSLIEKGYELVSGGTDNHLVLVNLKNKGIDGSRVEKVL  404

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+E DFVKVAE+FD  VKL++KIK 
Sbjct  405   ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEADFVKVAEFFDETVKLALKIKG  464

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              ++GTKLK+FVAT+QS+   QAEI+KLRH VEEYAKQFPTIGFEK TM+Y++
Sbjct  465   GSEGTKLKDFVATMQSNKDFQAEISKLRHQVEEYAKQFPTIGFEKETMRYRD  516



>ref|XP_007141299.1| hypothetical protein PHAVU_008G184200g [Phaseolus vulgaris]
 gb|ESW13293.1| hypothetical protein PHAVU_008G184200g [Phaseolus vulgaris]
Length=511

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/480 (88%), Positives = 452/480 (94%), Gaps = 0/480 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             + +EK+K +  W KQLN  LE VDPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVG
Sbjct  30    SAHEKDKSRADWTKQLNDPLEAVDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVG  89

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQ LSGSPSNFQ
Sbjct  90    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQSLSGSPSNFQ  149

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLK H+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL
Sbjct  150   VYTALLKSHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  209

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFD
Sbjct  210   EKSAALFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFD  269

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  270   YADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHNH  329

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI GLAVALKQA TPE++ YQEQVLSNCS FAQ+L+EKGY+LVSGGT+NHLVLVNL+NKG
Sbjct  330   TIAGLAVALKQAMTPEFKNYQEQVLSNCSAFAQSLLEKGYDLVSGGTDNHLVLVNLRNKG  389

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             IDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFV+EDF KVAEYFDA
Sbjct  390   IDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVDEDFKKVAEYFDA  449

Query  1560  AVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             AVKL+++IK  T GTKLK+FVA + S + IQ++IA LRH+VE+YAKQFPTIGFE  TMKY
Sbjct  450   AVKLALQIKENTNGTKLKDFVAAMHSDEQIQSKIANLRHEVEDYAKQFPTIGFEIETMKY  509



>ref|XP_009105803.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Brassica 
rapa]
Length=513

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/508 (84%), Positives = 471/508 (93%), Gaps = 5/508 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI        +   MSSL + A+ + E+ + SW KQLNA LEE+DPEIADIIEL
Sbjct  10    SSSLKKPI-----FFSNGRSMSSLPTSAMADSERSRSSWIKQLNAPLEEIDPEIADIIEL  64

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTS SVM+AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  65    EKARQWKGFELIPSENFTSASVMEAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  124

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  125   ALEAFHLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  184

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  185   ISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  244

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  245   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  304

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+IN +VFPGLQGGPHNHTITGLAVALKQ  +PEY+AYQ+QVL NCSKFA+
Sbjct  305   GKEVMYDYEDRINASVFPGLQGGPHNHTITGLAVALKQVKSPEYKAYQDQVLRNCSKFAE  364

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  365   TLLSKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  424

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  425   IRMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  484

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  485   MAKLREMVEEYAKQFPTIGFEKETMRYK  512



>ref|XP_006433761.1| hypothetical protein CICLE_v10000875mg [Citrus clementina]
 ref|XP_006433762.1| hypothetical protein CICLE_v10000875mg [Citrus clementina]
 gb|ESR47001.1| hypothetical protein CICLE_v10000875mg [Citrus clementina]
 gb|ESR47002.1| hypothetical protein CICLE_v10000875mg [Citrus clementina]
Length=519

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/509 (85%), Positives = 467/509 (92%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   N G   Y   S   +     EK   SW  QLNA LEE+DPEIADIIEL
Sbjct  11    SSSVTNPIKRHLNHGSHYYVYMSSLPDQALNNEKAPASWINQLNAPLEEIDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             AL+AF+LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALDAFQLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDY+QLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLDESTGYIDYEQLEKSAALFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G+EV+Y YEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSN SKFA+
Sbjct  311   GQEVMYAYEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLSNSSKFAR  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+E+GY+LVSGGTENHLVLVNL+NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  371   SLLERGYDLVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAE+FDAAVKL++KIK  T+GTKLK+FVATL S ++IQ+E
Sbjct  431   IRMGTPALTSRGFVEEDFEKVAEFFDAAVKLALKIKGDTKGTKLKDFVATLMSDESIQSE  490

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+ LR  VEEYAK+FPT+GFEK TMKYKN
Sbjct  491   ISNLRDKVEEYAKRFPTVGFEKETMKYKN  519



>ref|XP_007018308.1| Serine hydroxymethyltransferase 2 isoform 2 [Theobroma cacao]
 gb|EOY15533.1| Serine hydroxymethyltransferase 2 isoform 2 [Theobroma cacao]
Length=515

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/473 (90%), Positives = 454/473 (96%), Gaps = 1/473 (0%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             +W  QLNA LEE+DPEIADIIELEKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEG
Sbjct  43    NWIHQLNAPLEEIDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEG  102

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNEYIDMAESLCQKRALEAF LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+
Sbjct  103   YPGARYYGGNEYIDMAESLCQKRALEAFGLDPAKWGVNVQSLSGSPANFQVYTALLKPHE  162

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTG+IDYDQLEKSA LFRPK
Sbjct  163   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGFIDYDQLEKSAVLFRPK  222

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             LIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTH
Sbjct  223   LIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTH  282

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKGVKE+NK+G+EV+YD+EDKINQAVFPGLQGGPHNHTITGLAVALK
Sbjct  283   KSLRGPRGAMIFFRKGVKEINKKGQEVMYDFEDKINQAVFPGLQGGPHNHTITGLAVALK  342

Query  1230  QATTPEYRAYQEQVLSNCSKFAQT-LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKV  1406
             Q  TPEY+AYQEQVLSNCSKFAQ  L+EKGYELVSGGTENHLVLVNL+NKGIDGSRVEKV
Sbjct  343   QVRTPEYKAYQEQVLSNCSKFAQQRLLEKGYELVSGGTENHLVLVNLRNKGIDGSRVEKV  402

Query  1407  LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIK  1586
             +ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVA++FDAAVKL++KIK
Sbjct  403   MESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFEKVADFFDAAVKLALKIK  462

Query  1587  AATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             A T+GTKLK+FV TLQS   IQ+EIAKLR +VEEYAKQFPTIGFEK TMKYK+
Sbjct  463   AETKGTKLKDFVETLQSDVNIQSEIAKLRREVEEYAKQFPTIGFEKETMKYKD  515



>ref|XP_009104919.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial-like 
[Brassica rapa]
Length=509

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/476 (88%), Positives = 454/476 (95%), Gaps = 0/476 (0%)
 Frame = +3

Query  315   EKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             E+ + +W +QLNA LEE+DPEIADIIELEKARQWKG ELIPSENFTS SVM+AVGSVMTN
Sbjct  33    ERSRSTWIRQLNAPLEEIDPEIADIIELEKARQWKGFELIPSENFTSASVMEAVGSVMTN  92

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNEYIDMAESLCQKRALEAF LDP+KWGVNVQ LSGSP+NFQVYTAL
Sbjct  93    KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFHLDPSKWGVNVQSLSGSPANFQVYTAL  152

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             LKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQLEKSA 
Sbjct  153   LKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYDQLEKSAV  212

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
             LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+YADVV
Sbjct  213   LFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFEYADVV  272

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGL  1214
             TTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV+YDYED+IN AVFPGLQGGPHNHTITGL
Sbjct  273   TTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVMYDYEDRINAAVFPGLQGGPHNHTITGL  332

Query  1215  AVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSR  1394
             AVALKQ  TPEY+AYQ+QVL NCSKFA+TL+ KGY+LVSGGTENHLVLVNLKNKGIDGSR
Sbjct  333   AVALKQVKTPEYKAYQDQVLRNCSKFAETLLSKGYDLVSGGTENHLVLVNLKNKGIDGSR  392

Query  1395  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS  1574
             VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVAEYFD AVK++
Sbjct  393   VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFAKVAEYFDLAVKIA  452

Query  1575  VKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +KIKA +QGTKLK+FVAT+QS++ +Q+E+AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  453   LKIKAESQGTKLKDFVATMQSNEKLQSEMAKLREMVEEYAKQFPTIGFEKETMRYK  508



>emb|CDX96315.1| BnaA07g29260D [Brassica napus]
Length=514

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/508 (84%), Positives = 468/508 (92%), Gaps = 3/508 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             S+S++KPI +      S+  + +    A+ + E+ + SW KQLNA LEE+DPEIADIIEL
Sbjct  9     STSLKKPIFSNGVSLRSMSSLPT---SAMADSERSRSSWIKQLNAPLEEIDPEIADIIEL  65

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTS SVM+AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  66    EKARQWKGFELIPSENFTSASVMEAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  125

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP+ WGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  126   ALEAFHLDPSTWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  185

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  186   ISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  245

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  246   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  305

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+IN AVFPGLQGGPHNHTITGLAVALKQ  TPEY+AYQ+QVL NCSKFA+
Sbjct  306   GKEVMYDYEDRINAAVFPGLQGGPHNHTITGLAVALKQVKTPEYKAYQDQVLRNCSKFAE  365

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  366   TLLSKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  425

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  426   IRMGTPALTSRGFIEEDFAKVAEYFDFAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  485

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             + KLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  486   MTKLREMVEEYAKQFPTIGFEKETMRYK  513



>gb|KDO81280.1| hypothetical protein CISIN_1g010058mg [Citrus sinensis]
Length=519

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/509 (84%), Positives = 466/509 (92%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   N G   Y   S   +     EK    W  QLNA LEE+DPEIADIIEL
Sbjct  11    SSSVTNPIKRHLNHGSHYYVYMSSLPDQALNNEKAPAPWINQLNAPLEEIDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             AL+AF+LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALDAFQLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDY+QLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLDESTGYIDYEQLEKSAALFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G+EV+Y YEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSN SKFA+
Sbjct  311   GQEVMYAYEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLSNSSKFAR  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+E+GY+LVSGGTENHLVLVNL+NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  371   SLLERGYDLVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAE+FDAAVKL++KIK  T+GTKLK+FVATL S ++IQ+E
Sbjct  431   IRMGTPALTSRGFVEEDFEKVAEFFDAAVKLALKIKGDTKGTKLKDFVATLMSDESIQSE  490

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+ LR  VEEYAK+FPT+GFEK TMKYKN
Sbjct  491   ISNLRDKVEEYAKRFPTVGFEKETMKYKN  519



>ref|XP_006289490.1| hypothetical protein CARUB_v10003023mg [Capsella rubella]
 gb|EOA22388.1| hypothetical protein CARUB_v10003023mg [Capsella rubella]
Length=519

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/476 (88%), Positives = 458/476 (96%), Gaps = 0/476 (0%)
 Frame = +3

Query  315   EKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             EK +  W KQLNASL+E+DPE+ADIIELEKARQWKG ELIPSENFTSLSVMQAVGSVMTN
Sbjct  43    EKPRSIWIKQLNASLDEIDPEVADIIELEKARQWKGFELIPSENFTSLSVMQAVGSVMTN  102

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDP+KWGVNVQ LSGSP+NFQVYTAL
Sbjct  103   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPSKWGVNVQSLSGSPANFQVYTAL  162

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             LKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQLEKSA 
Sbjct  163   LKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYDQLEKSAV  222

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
             LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+YADVV
Sbjct  223   LFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFEYADVV  282

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGL  1214
             TTTTHKSLRGPRGAMIF+RKG+KE+NKQGKEV+YDYED+INQAVFPGLQGGPHNHTITGL
Sbjct  283   TTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDRINQAVFPGLQGGPHNHTITGL  342

Query  1215  AVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSR  1394
             AVALKQA TPEY+AYQ+QVL NCSKFA+TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSR
Sbjct  343   AVALKQARTPEYKAYQDQVLRNCSKFAETLLAKGYDLVSGGTDNHLVLVNLKNKGIDGSR  402

Query  1395  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS  1574
             VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF +VA+YFD AVK++
Sbjct  403   VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFARVADYFDLAVKIA  462

Query  1575  VKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +KIKA +QGTKLK+FVAT+QS++ +++E+AKLR  VEEYAKQFPTIGFEK +M+YK
Sbjct  463   LKIKAESQGTKLKDFVATMQSNEKLKSEMAKLREMVEEYAKQFPTIGFEKESMRYK  518



>emb|CDY49212.1| BnaCnng17010D [Brassica napus]
Length=509

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/476 (88%), Positives = 453/476 (95%), Gaps = 0/476 (0%)
 Frame = +3

Query  315   EKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             E+ + +W  QLNA LEE+DPEIADIIELEKARQWKG ELIPSENFTS SVM+AVGSVMTN
Sbjct  33    ERSRSTWISQLNAPLEEIDPEIADIIELEKARQWKGFELIPSENFTSASVMEAVGSVMTN  92

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDP KWGVNVQ LSGSP+NFQVYTAL
Sbjct  93    KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPYKWGVNVQSLSGSPANFQVYTAL  152

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             LKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQLEKSA 
Sbjct  153   LKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYDQLEKSAV  212

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
             LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF+YADVV
Sbjct  213   LFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFEYADVV  272

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGL  1214
             TTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV+YDYED+IN AVFPGLQGGPHNHTITGL
Sbjct  273   TTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVMYDYEDRINAAVFPGLQGGPHNHTITGL  332

Query  1215  AVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSR  1394
             AVALKQ  TPEY+AYQ+QVL NCSKFA+TL+ KGY+LVSGGTENHLVLVNLKNKGIDGSR
Sbjct  333   AVALKQVKTPEYKAYQDQVLRNCSKFAETLLSKGYDLVSGGTENHLVLVNLKNKGIDGSR  392

Query  1395  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS  1574
             VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVAEYFD AVK++
Sbjct  393   VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFAKVAEYFDLAVKIA  452

Query  1575  VKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +KIKA +QGTKLK+FVAT+QS++ +Q+E+AKLR  VEEYAKQFPTIGFEK TM+YK
Sbjct  453   LKIKAESQGTKLKDFVATMQSNEKLQSEMAKLREMVEEYAKQFPTIGFEKDTMRYK  508



>ref|XP_003544839.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial isoform 
X1 [Glycine max]
Length=507

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/480 (88%), Positives = 452/480 (94%), Gaps = 0/480 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             + +EK K +  W KQLN  LE +DPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVG
Sbjct  26    SAHEKHKSRADWIKQLNDPLEAIDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVG  85

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF+LDPAKWGVNVQ LSGSPSNFQ
Sbjct  86    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFQLDPAKWGVNVQSLSGSPSNFQ  145

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL
Sbjct  146   VYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  205

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFD
Sbjct  206   EKSAALFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFD  265

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  266   YADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHNH  325

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI+GLAVALKQA TPE++ YQ+QVLSNCS FAQ+L+EKGYELVSGGT+NHLVLVNL+NKG
Sbjct  326   TISGLAVALKQAMTPEFKNYQKQVLSNCSAFAQSLLEKGYELVSGGTDNHLVLVNLRNKG  385

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             IDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAEYFDA
Sbjct  386   IDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFEKVAEYFDA  445

Query  1560  AVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             AVKL+++IK  T GTKLK+FVA +QS + IQ++IA L H+VE+YAK+FPTIGF   TMKY
Sbjct  446   AVKLALQIKENTNGTKLKDFVAAMQSDEQIQSKIANLCHEVEDYAKKFPTIGFNIETMKY  505



>dbj|BAJ89749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/478 (89%), Positives = 455/478 (95%), Gaps = 0/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT
Sbjct  33    EERSAVTWPKQLNAPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  92

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDP KWGVNVQPLSGSP+NF VYTA
Sbjct  93    NKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFNLDPEKWGVNVQPLSGSPANFHVYTA  152

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQLEKSA
Sbjct  153   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQLEKSA  212

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDY+R+RK+CDKQKA+LLADMAHISGLVAAGVIPSPF+YADV
Sbjct  213   VLFRPKLIVAGASAYARLYDYNRMRKICDKQKAVLLADMAHISGLVAAGVIPSPFEYADV  272

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  273   VTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVKYDFEDKINAAVFPGLQGGPHNHTITG  332

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATT EYRAYQEQV+SN ++FA++L  KGY++VSGGT+NHLVLVNLK KGIDGS
Sbjct  333   LAVALKQATTQEYRAYQEQVMSNSARFAESLTSKGYDIVSGGTDNHLVLVNLKKKGIDGS  392

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAE+FD+AV L
Sbjct  393   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEFFDSAVNL  452

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQAEIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  453   ALKVKAAAAGTKLKDFVATLQSDSNIQAEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  510



>ref|XP_010519153.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial-like 
[Tarenaya hassleriana]
Length=520

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/508 (85%), Positives = 472/508 (93%), Gaps = 1/508 (0%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS++ PI    + GGSL +MSSL + AV   EK + +W KQLNA LEE+DPEIADIIELE
Sbjct  14    SSVKNPISFAASNGGSLRFMSSLPNSAVAGTEKSRATWIKQLNAPLEEIDPEIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAF+LDP+KWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFQLDPSKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRL+E+TGYIDYDQ+EKSA LFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLDENTGYIDYDQMEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKA +LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVK +NKQ 
Sbjct  254   QKAFMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKGINKQE  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQT  1301
             +E +YD+EDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVL NCSKFAQT
Sbjct  314   REEMYDFEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLVNCSKFAQT  373

Query  1302  LVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  1481
             L+EKGY+LVSGGT NHLVLVNL+NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI
Sbjct  374   LLEKGYDLVSGGTANHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGI  433

Query  1482  RMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEI  1661
             RMGTPALTSRGFVEEDF +VA++FDAAVKL++KIK+ TQG KLK+FVAT+Q ++  Q+EI
Sbjct  434   RMGTPALTSRGFVEEDFARVADFFDAAVKLALKIKSETQGIKLKDFVATMQ-NERFQSEI  492

Query  1662  AKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              KLR +VEEYAKQFPT+GFEK TMKYK+
Sbjct  493   RKLREEVEEYAKQFPTVGFEKETMKYKD  520



>ref|XP_006472402.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006472403.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=519

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/509 (84%), Positives = 465/509 (91%), Gaps = 0/509 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+  PIK   N G   Y   S   +     EK    W  QLNA LEE+DPEIADIIEL
Sbjct  11    SSSVTNPIKRHLNHGSHYYVYMSSLPDQALNNEKAPAPWINQLNAPLEEIDPEIADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             AL+AF+LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALDAFQLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDY+QLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLDESTGYIDYEQLEKSAALFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             G+EV+Y YEDKINQAVFPGLQGGPHNHTI+GLAVALKQ  TPEY+AYQEQVLSN SKFAQ
Sbjct  311   GQEVMYAYEDKINQAVFPGLQGGPHNHTISGLAVALKQVKTPEYKAYQEQVLSNSSKFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+E+GY+LVSGGTENHLVLVNL+NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  371   SLLERGYDLVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF KVAE+F+AAVKL++KIK  T+GTKLK+FVATL S ++IQ+E
Sbjct  431   IRMGTPALTSRGFVEEDFEKVAEFFNAAVKLALKIKGDTKGTKLKDFVATLMSDESIQSE  490

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             I+ LR  VE YAK+FPT+GFEK TMKYKN
Sbjct  491   ISNLRDKVEVYAKRFPTVGFEKETMKYKN  519



>gb|ABJ15727.1| serine hydroxymethyltransferase [Triticum monococcum]
Length=510

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/478 (89%), Positives = 455/478 (95%), Gaps = 0/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT
Sbjct  33    EERSAVTWPKQLNAPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  92

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDP KWGVNVQPLSGSP+NF VYTA
Sbjct  93    NKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFNLDPEKWGVNVQPLSGSPANFHVYTA  152

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQLEKSA
Sbjct  153   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQLEKSA  212

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDY+R+RK+CDKQKA+LLADMAHISGLVAAGVIPSPF+YADV
Sbjct  213   VLFRPKLIVAGASAYARLYDYNRMRKICDKQKAVLLADMAHISGLVAAGVIPSPFEYADV  272

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  273   VTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVKYDFEDKINAAVFPGLQGGPHNHTITG  332

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATT EYRAYQEQV+SN ++FA++L  KGY++VSGGT+NHLVLVNLK KGIDGS
Sbjct  333   LAVALKQATTQEYRAYQEQVMSNSARFAESLTSKGYDIVSGGTDNHLVLVNLKKKGIDGS  392

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD+AV L
Sbjct  393   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDSAVNL  452

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQAEIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  453   ALKVKAAAAGTKLKDFVATLQSDSNIQAEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  510



>ref|XP_009405786.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=520

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/484 (87%), Positives = 457/484 (94%), Gaps = 1/484 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA Y KE+  V+W KQLNA LE VDPEIA+IIELEKARQWKGLELIPSENFTS+SVMQAV
Sbjct  37    EAAYGKERSCVTWTKQLNAPLEVVDPEIAEIIELEKARQWKGLELIPSENFTSVSVMQAV  96

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVM NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF LDP+KWGVNVQ LSGSPSNF
Sbjct  97    GSVMINKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFGLDPSKWGVNVQSLSGSPSNF  156

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  157   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  216

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  217   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  276

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
              YAD+VTTTTHKSLRGPRGAMIF+RKG+KE+NK+G+EV+YD+EDKIN AVFPGLQGGPHN
Sbjct  277   KYADIVTTTTHKSLRGPRGAMIFFRKGLKEINKKGQEVMYDFEDKINAAVFPGLQGGPHN  336

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI+GLAVALKQATTPE++AYQEQVL NC+KFA+ LVEKGYELVSGGT+NHLVLVNLKNK
Sbjct  337   HTISGLAVALKQATTPEFKAYQEQVLKNCAKFAECLVEKGYELVSGGTDNHLVLVNLKNK  396

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE  HIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD
Sbjct  397   GIDGSRVEKVLELAHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFD  456

Query  1557  AAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
              AVKL++KIKA T+ G+KLK+FVAT+Q+   IQ EI+KL H+VE+YAKQFPTIGFEK TM
Sbjct  457   IAVKLALKIKAETKGGSKLKDFVATIQTDANIQYEISKLCHEVEDYAKQFPTIGFEKETM  516

Query  1734  KYKN  1745
             KY +
Sbjct  517   KYSD  520



>emb|CDX72795.1| BnaC06g32430D [Brassica napus]
Length=530

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/524 (81%), Positives = 470/524 (90%), Gaps = 19/524 (4%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KPI +      S+  + +    A+ + E+ + SW KQLNA LEE+DPEIADIIEL
Sbjct  9     SSSLKKPIFSNGVSLRSMSSLPT---SAMADSERSRSSWIKQLNAPLEEIDPEIADIIEL  65

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTS SVM+AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  66    EKARQWKGFELIPSENFTSASVMEAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  125

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  126   ALEAFHLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  185

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRL+ESTGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  186   ISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  245

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQ
Sbjct  246   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQ  305

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+IN AVFPGLQGGPHNHTITGLAVALKQ  +PEY+AYQ+QVL NCSKFA+
Sbjct  306   GKEVMYDYEDRINAAVFPGLQGGPHNHTITGLAVALKQVKSPEYKAYQDQVLRNCSKFAE  365

Query  1299  ----------------TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAA  1430
                             TL+ KGY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLESVHIAA
Sbjct  366   VRCLSKLVDIPQVSCHTLLSKGYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLESVHIAA  425

Query  1431  NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKL  1610
             NKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDF KVAEYFD AVK+++KIKA +QGTKL
Sbjct  426   NKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGTKL  485

Query  1611  KEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             K+FVAT+QS++ +Q+E+AKLR  +EEYAKQFPTIGFEK TM+YK
Sbjct  486   KDFVATMQSNEKLQSEMAKLREMIEEYAKQFPTIGFEKETMRYK  529



>gb|KFK26442.1| hypothetical protein AALP_AA8G249100 [Arabis alpina]
Length=514

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/508 (83%), Positives = 468/508 (92%), Gaps = 3/508 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+ KPI    + G  +  + +    A+ E EK + SW +QLNA LEE+DPEIADIIEL
Sbjct  9     SSSVRKPISLFPSNGRFMSSLPT---SAMAESEKSRASWIRQLNAPLEEIDPEIADIIEL  65

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKG ELIPSENFTS SVM+AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  66    EKARQWKGFELIPSENFTSASVMEAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  125

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAF+LDP+KWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  126   ALEAFQLDPSKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  185

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFET+PYRL+E+TGYIDYDQLEKSA LFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  186   ISAVSIFFETVPYRLDENTGYIDYDQLEKSAVLFRPKLIVAGASAYARLYDYARIRKVCD  245

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKA++LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQ
Sbjct  246   KQKAVMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQ  305

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV+YDYED+INQAVFPGLQGGPHNHTI GLAVALKQ  TPEY+AYQ+QVL NCS FA+
Sbjct  306   GKEVMYDYEDRINQAVFPGLQGGPHNHTIAGLAVALKQVKTPEYKAYQDQVLRNCSTFAE  365

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             +L+ KGY+LVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG
Sbjct  366   SLLAKGYDLVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  425

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDF +VA+ FD AVK+++KIKA +QGTKLK+FVAT+QS++ +Q+E
Sbjct  426   IRMGTPALTSRGFVEEDFARVADCFDLAVKIALKIKAESQGTKLKDFVATMQSNEKLQSE  485

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
             +AKLR  V+EYAKQFPTIGF+K TM+YK
Sbjct  486   MAKLREMVQEYAKQFPTIGFKKDTMRYK  513



>gb|EMT02084.1| Serine hydroxymethyltransferase, mitochondrial [Aegilops tauschii]
Length=529

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/484 (88%), Positives = 455/484 (94%), Gaps = 6/484 (1%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT
Sbjct  46    EERSAVTWPKQLNAPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  105

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDP KWGVNVQPLSGSP+NF VYTA
Sbjct  106   NKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFNLDPEKWGVNVQPLSGSPANFHVYTA  165

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQLEKSA
Sbjct  166   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQLEKSA  225

Query  852   TLFRPKLIVAGASAYARLYDYDRIRK------VCDKQKAILLADMAHISGLVAAGVIPSP  1013
              LFRPKLIVAGASAYARLYDY+R+RK      +CDKQKA+LLADMAHISGLVAAGVIPSP
Sbjct  226   VLFRPKLIVAGASAYARLYDYNRMRKASSFSSICDKQKAVLLADMAHISGLVAAGVIPSP  285

Query  1014  FDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPH  1193
             F+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YD+EDKIN AVFPGLQGGPH
Sbjct  286   FEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVKYDFEDKINAAVFPGLQGGPH  345

Query  1194  NHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKN  1373
             NHTITGLAVALKQATT EYRAYQEQV+SN ++FA++L  KGY++VSGGT+NHLVLVNLK 
Sbjct  346   NHTITGLAVALKQATTQEYRAYQEQVMSNSARFAESLTSKGYDIVSGGTDNHLVLVNLKK  405

Query  1374  KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYF  1553
             KGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++F
Sbjct  406   KGIDGSRVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFF  465

Query  1554  DAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
             D+AV L++K+KAA  GTKLK+FVATLQS   IQAEIAKLRHDVEEYAKQFPTIGFEK TM
Sbjct  466   DSAVNLALKVKAAAAGTKLKDFVATLQSDSNIQAEIAKLRHDVEEYAKQFPTIGFEKETM  525

Query  1734  KYKN  1745
             KYKN
Sbjct  526   KYKN  529



>ref|XP_004287403.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=525

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/491 (85%), Positives = 457/491 (93%), Gaps = 9/491 (2%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A  EKE+ + +W KQLN  LE +DPEI DIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  34    QAAQEKEQARATWIKQLNEPLEVIDPEINDIIELEKARQWKGLELIPSENFTSLSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRA EAF+LDPAKWGVNVQ LSGSPSNF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRAFEAFQLDPAKWGVNVQSLSGSPSNF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYT LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQ
Sbjct  154   QVYTGLLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDETTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVK VNKQG+EV+YDYEDKINQAVFPGLQGGPHN
Sbjct  274   EYADIVTTTTHKSLRGPRGAMIFFRKGVKNVNKQGQEVMYDYEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFA---------QTLVEKGYELVSGGTENH  1349
             HTI+GLAVALKQATTPE++AYQEQVL N SKFA         Q+L+EK Y+LVSGGT+NH
Sbjct  334   HTISGLAVALKQATTPEFKAYQEQVLRNSSKFAEVSLCPLNMQSLLEKSYDLVSGGTDNH  393

Query  1350  LVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEED  1529
             LVLVNL+ KGIDGSRVEKV+E+ HIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+E+D
Sbjct  394   LVLVNLRGKGIDGSRVEKVMEAAHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFMEDD  453

Query  1530  FVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPT  1709
             F KVAEYFD AVK+++KIKAAT+GTKLK+FVATL+S   IQ+EIAKLRH+VE+YAK+FPT
Sbjct  454   FAKVAEYFDVAVKIALKIKAATKGTKLKDFVATLESDSQIQSEIAKLRHEVEQYAKEFPT  513

Query  1710  IGFEKHTMKYK  1742
             IGFEK TM+YK
Sbjct  514   IGFEKETMRYK  524



>ref|XP_010671051.1| PREDICTED: serine hydroxymethyltransferase 2, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/482 (86%), Positives = 453/482 (94%), Gaps = 0/482 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA  +  + +V+W KQLN  LE +DPE+ADIIELEK+RQWKGLELIPSENFTS+SVMQAV
Sbjct  34    EATSQNNRSRVNWIKQLNEPLEVIDPEVADIIELEKSRQWKGLELIPSENFTSVSVMQAV  93

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAF+LDPAKWGVNVQ LSGSP+NF
Sbjct  94    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFQLDPAKWGVNVQSLSGSPANF  153

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  154   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  213

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF
Sbjct  214   LEKSAALFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  273

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKG+KE+NK+G+EV+YD+EDKINQAVFPGLQGGPHN
Sbjct  274   EYADIVTTTTHKSLRGPRGAMIFFRKGLKEINKKGQEVMYDFEDKINQAVFPGLQGGPHN  333

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI GLAVALKQA TPEY+AYQEQVLSNC+ FAQ L +KGY LVSGGT+NHLVLVNL++K
Sbjct  334   HTIAGLAVALKQARTPEYKAYQEQVLSNCAAFAQKLADKGYHLVSGGTDNHLVLVNLRDK  393

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLE+VHIAANKNTVPGDVSAM+PGGIRMGTPALTSRGF+EEDF KV E+FD
Sbjct  394   GIDGSRVEKVLEAVHIAANKNTVPGDVSAMIPGGIRMGTPALTSRGFMEEDFAKVGEFFD  453

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
              AVKL++KIKA T+GTKLK+FV T+QS+D  Q+EI KLR +VEEYAKQFPTIGFEK TMK
Sbjct  454   DAVKLALKIKADTKGTKLKDFVETMQSNDKFQSEITKLRGEVEEYAKQFPTIGFEKDTMK  513

Query  1737  YK  1742
             YK
Sbjct  514   YK  515



>gb|ABK24431.1| unknown [Picea sitchensis]
Length=519

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/486 (85%), Positives = 452/486 (93%), Gaps = 4/486 (1%)
 Frame = +3

Query  297   EAVY---EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVM  467
             EA Y   EKEK  V+WPKQLNA L EVDPEI DI+ELEK RQWKGLELIPSENFTSLSVM
Sbjct  33    EAAYSRTEKEKSHVTWPKQLNAPLHEVDPEITDIVELEKNRQWKGLELIPSENFTSLSVM  92

Query  468   QAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP  647
             QAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDP KWGVNVQPLSGSP
Sbjct  93    QAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPKKWGVNVQPLSGSP  152

Query  648   SNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYID  827
             +NF VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVS +FETMPYRLNESTG ID
Sbjct  153   ANFHVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSAYFETMPYRLNESTGIID  212

Query  828   YDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIP  1007
             YDQLEKSATLFRPKLI+AGASAYAR YDY R+RK+CDKQKA+LLADMAHISGLVA GV+P
Sbjct  213   YDQLEKSATLFRPKLIIAGASAYARHYDYARMRKICDKQKAVLLADMAHISGLVAGGVVP  272

Query  1008  SPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGG  1187
             SPFD+ADVVTTTTHKSLRGPRGAMIFYRKG+KEVNKQG+EV+YDYEDKIN AVFPGLQGG
Sbjct  273   SPFDFADVVTTTTHKSLRGPRGAMIFYRKGLKEVNKQGQEVIYDYEDKINAAVFPGLQGG  332

Query  1188  PHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL  1367
             PHNHTITGLAVALKQA TPE+++YQEQVLSNC+ FA  L+++GYELVSGGT+NHLVLVNL
Sbjct  333   PHNHTITGLAVALKQAATPEFKSYQEQVLSNCAHFAHCLIKRGYELVSGGTDNHLVLVNL  392

Query  1368  KNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAE  1547
             KNKGIDGSRVE+VLE  HIAANKNTVPGDVSAM+PGGIRMGTPALTSRGF+E+DF KVAE
Sbjct  393   KNKGIDGSRVERVLELAHIAANKNTVPGDVSAMIPGGIRMGTPALTSRGFLEDDFAKVAE  452

Query  1548  YFDAAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             +FD AV+LS+KIK+ T+ G+KLK+F AT++SS AIQ EI  LRH+VEEYAKQFPTIGFEK
Sbjct  453   FFDLAVQLSIKIKSETKGGSKLKDFKATIESSPAIQDEIRNLRHEVEEYAKQFPTIGFEK  512

Query  1725  HTMKYK  1742
              +MKYK
Sbjct  513   SSMKYK  518



>emb|CCC55420.1| mitochondrial serine hydroxymethyltransferase [Pinus pinaster]
Length=523

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/480 (86%), Positives = 453/480 (94%), Gaps = 1/480 (0%)
 Frame = +3

Query  309   EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             EK+K  V+WPKQLNA LEEVDPEIA+IIELEK RQWKGLELIPSENFTSLSVMQAVGSVM
Sbjct  44    EKQKSHVTWPKQLNAPLEEVDPEIANIIELEKNRQWKGLELIPSENFTSLSVMQAVGSVM  103

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAF LDP KWGVNVQPLSGSP+NFQVYT
Sbjct  104   TNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFGLDPDKWGVNVQPLSGSPANFQVYT  163

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQLEKS
Sbjct  164   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKS  223

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             A LFRPKLIVAGASAYAR YDY R+RKVCDKQKA+LLADMAHISGLVAAGV+PSPF++AD
Sbjct  224   AVLFRPKLIVAGASAYARHYDYARMRKVCDKQKAVLLADMAHISGLVAAGVVPSPFEFAD  283

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTIT  1208
             VVTTTTHKSLRGPRGAMIFYRKG+KE+NKQG+EV YDYE+KIN AVFPGLQGGPHNHTIT
Sbjct  284   VVTTTTHKSLRGPRGAMIFYRKGIKEINKQGQEVKYDYEEKINAAVFPGLQGGPHNHTIT  343

Query  1209  GLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDG  1388
             GLAVALKQATT EY+AYQEQVLSNC+ FA+ L E+GYELVSGGT+NHLVLVNLKN+GIDG
Sbjct  344   GLAVALKQATTSEYKAYQEQVLSNCAHFAKCLSERGYELVSGGTDNHLVLVNLKNRGIDG  403

Query  1389  SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVK  1568
             SRVE+VLE VHIAANKNTVPGD+SAMVPGGIRMGTPALTSRGFVE+DF KVAE+FD A +
Sbjct  404   SRVERVLELVHIAANKNTVPGDISAMVPGGIRMGTPALTSRGFVEDDFAKVAEFFDLATQ  463

Query  1569  LSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             L+++IK+ T+ G+KLK+F AT++SS   QAEIA LRH+VEEYAKQFPTIGFEK ++KYK+
Sbjct  464   LAIRIKSETKGGSKLKDFKATIESSPHFQAEIASLRHNVEEYAKQFPTIGFEKTSLKYKD  523



>ref|XP_004490468.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Cicer arietinum]
Length=515

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/477 (86%), Positives = 444/477 (93%), Gaps = 0/477 (0%)
 Frame = +3

Query  309   EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             +  K    W KQLN  LE +DPEI DIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM
Sbjct  37    QNHKSNPDWIKQLNDPLEVIDPEIEDIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  96

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQ LSGSPSNFQVYT
Sbjct  97    TNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQSLSGSPSNFQVYT  156

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ+EKS
Sbjct  157   ALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQMEKS  216

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             A LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPFDYAD
Sbjct  217   AALFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFDYAD  276

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTIT  1208
             VVTTTTHKSLRGPRGAMIF+RKG+KE+NK+G+EV YDYEDKINQAVFPGLQGGPHNHTIT
Sbjct  277   VVTTTTHKSLRGPRGAMIFFRKGLKEINKKGQEVFYDYEDKINQAVFPGLQGGPHNHTIT  336

Query  1209  GLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDG  1388
             GLAVALKQA TPE++ YQ+QVLSN S FAQTL+E+GY+LVSGGTENHLVLVNL+NKGIDG
Sbjct  337   GLAVALKQAMTPEFKNYQKQVLSNSSTFAQTLLEQGYDLVSGGTENHLVLVNLRNKGIDG  396

Query  1389  SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVK  1568
             SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVE+DF KVAEYFD AVK
Sbjct  397   SRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEDDFKKVAEYFDVAVK  456

Query  1569  LSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             ++++IK   +GTKLK+FV  +QS   IQ++IA LR +VE+YAKQFPTIGFE  TMKY
Sbjct  457   IALQIKENAKGTKLKDFVEAMQSDSQIQSQIANLRREVEDYAKQFPTIGFEIETMKY  513



>ref|XP_009394286.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=512

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/476 (87%), Positives = 450/476 (95%), Gaps = 0/476 (0%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             K  + WPKQLNA  E VDPEIADI+ELEKARQWKGLELIPS+NFTS+SVMQAVGS+M+ K
Sbjct  37    KICIIWPKQLNAPSEVVDPEIADIVELEKARQWKGLELIPSKNFTSMSVMQAVGSIMSLK  96

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALL  677
              SEG PGARYY GNEY+DMAESLCQKRALEAFRLDPAKWGVNVQ LSGS +NFQVYTALL
Sbjct  97    NSEGCPGARYYRGNEYMDMAESLCQKRALEAFRLDPAKWGVNVQSLSGSLANFQVYTALL  156

Query  678   KPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  857
             KPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL
Sbjct  157   KPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  216

Query  858   FRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVT  1037
             FRPKLIVAGASAYARLYDY RIRKVCDK KAILLADMAH SGLV+AGVIPSPF+YADVVT
Sbjct  217   FRPKLIVAGASAYARLYDYARIRKVCDKHKAILLADMAHTSGLVSAGVIPSPFEYADVVT  276

Query  1038  TTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  1217
             TTTHKSLRGP GAMIF+RKGVKE+NKQGKEV++D+E+KIN AVFPGLQGGPHNH ITGLA
Sbjct  277   TTTHKSLRGPCGAMIFFRKGVKEINKQGKEVMHDFEEKINAAVFPGLQGGPHNHIITGLA  336

Query  1218  VALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRV  1397
             VALKQATTPEY+AYQEQVLSNC+KFAQ LVEKGYELVSGGTENHLVLVNLKNKGIDGSRV
Sbjct  337   VALKQATTPEYKAYQEQVLSNCAKFAQCLVEKGYELVSGGTENHLVLVNLKNKGIDGSRV  396

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             EKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FD AVKL++
Sbjct  397   EKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDTAVKLAL  456

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             KIK+ T+G+KLK+F+AT+Q++  IQ+EIAKLRH+VEEYAKQFPTIGF+K TMK++N
Sbjct  457   KIKSETKGSKLKDFLATIQTNANIQSEIAKLRHEVEEYAKQFPTIGFDKETMKHRN  512



>gb|KHG09155.1| Serine hydroxymethyltransferase 1, mitochondrial [Gossypium arboreum]
 gb|KHG16311.1| Serine hydroxymethyltransferase 1, mitochondrial [Gossypium arboreum]
Length=490

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/509 (85%), Positives = 454/509 (89%), Gaps = 29/509 (6%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++  +N     Y  S  + EAVYEKEK  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPFFNAPSLYYMSSLPN-EAVYEKEKPGVTWPKQLNAPLETVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGS+MTNKYSEGYPGARYYGGNEYIDMAE+LCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSIMTNKYSEGYPGARYYGGNEYIDMAETLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPEKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNE+TGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  190   ISAVSIFFETMPYRLNENTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVK +NKQ
Sbjct  250   KQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKGINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA                           
Sbjct  310   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA---------------------------  342

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL  KGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  343   TLAAKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  402

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAEYFDAAV L+VKIKA T GTKLK+FVATLQS+   Q+E
Sbjct  403   IRMGTPALTSRGFVEEDFVKVAEYFDAAVNLAVKIKAETTGTKLKDFVATLQSAH-FQSE  461

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +AKLRHDVEEYAKQFPTIGF+K TMKYKN
Sbjct  462   VAKLRHDVEEYAKQFPTIGFDKETMKYKN  490



>gb|KHN39975.1| Serine hydroxymethyltransferase, mitochondrial [Glycine soja]
Length=520

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/493 (84%), Positives = 447/493 (91%), Gaps = 13/493 (3%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             + +EK K +  W  +LN  LE +DPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVG
Sbjct  26    SAHEKHKSRADWINKLNDPLEAIDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVG  85

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF+LDPAKWGVNVQ LSGSPSNFQ
Sbjct  86    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFQLDPAKWGVNVQSLSGSPSNFQ  145

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL
Sbjct  146   VYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  205

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFD
Sbjct  206   EKSAALFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFD  265

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  266   YADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHNH  325

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI+GLAVALKQA TPE++ YQ+QVLSNCS FAQ+L+EKGYELVSGGT+NHLVLVNL+NKG
Sbjct  326   TISGLAVALKQAMTPEFKNYQKQVLSNCSAFAQSLLEKGYELVSGGTDNHLVLVNLRNKG  385

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             IDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAEYFDA
Sbjct  386   IDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFEKVAEYFDA  445

Query  1560  AVK-------------LSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQ  1700
             AV              L   +  +T GTKLK+FVA +QS + IQ++IA L H+VE+YAK+
Sbjct  446   AVNFKSIASVLTLRKSLFFLMVTSTSGTKLKDFVAAMQSDEQIQSKIANLCHEVEDYAKK  505

Query  1701  FPTIGFEKHTMKY  1739
             FPTIGF   TMKY
Sbjct  506   FPTIGFNIETMKY  518



>gb|KHN38901.1| Serine hydroxymethyltransferase, mitochondrial [Glycine soja]
Length=515

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/481 (86%), Positives = 449/481 (93%), Gaps = 3/481 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA Y+ EK   S   +LNA LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQA+
Sbjct  36    EAAYDNEK---SCDTELNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAI  92

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS++TN  +EGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGS +NF
Sbjct  93    GSIITNTRNEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSSANF  152

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIM LDLPHGGHLSHGYQTDT K+SAVS+FFETMPYRLNE+TG+IDYDQ
Sbjct  153   QVYTALLKPHDRIMGLDLPHGGHLSHGYQTDTNKVSAVSLFFETMPYRLNENTGHIDYDQ  212

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE +A LFRPKLIVAGA+AYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  213   LESTAKLFRPKLIVAGATAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  272

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKE+N++G+EV+YDYEDKIN+AVFPGLQ GPH 
Sbjct  273   DYADVVTTTTHKSLRGPRGAMIFFRKGVKEINEKGEEVMYDYEDKINRAVFPGLQSGPHF  332

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             H+ITGLAVALKQATTP YRAYQEQVL NCSKFAQ L EKGYELVSGGTENHL+LVNLK+K
Sbjct  333   HSITGLAVALKQATTPNYRAYQEQVLRNCSKFAQALSEKGYELVSGGTENHLLLVNLKSK  392

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRV+KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDFV VAE+FD
Sbjct  393   GIDGSRVQKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFAEEDFVMVAEFFD  452

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L+VKIK+ T+G+KLK+F+AT+QSS   Q+EIAKLRHDVEEYAKQFPTIGF+K TMK
Sbjct  453   AAVNLAVKIKSETKGSKLKDFLATIQSSSYFQSEIAKLRHDVEEYAKQFPTIGFDKETMK  512

Query  1737  Y  1739
             Y
Sbjct  513   Y  513



>gb|KCW54638.1| hypothetical protein EUGRSUZ_I00580 [Eucalyptus grandis]
Length=482

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/460 (93%), Positives = 447/460 (97%), Gaps = 0/460 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSIEKP++ L NGGGS+ YM+SL +EAVYEKEK  V+WPKQLNA LE VDPE+ADIIEL
Sbjct  11    SSSIEKPLRPLINGGGSVCYMASLPNEAVYEKEKNGVTWPKQLNAPLEAVDPEVADIIEL  70

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  71    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  130

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  131   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  190

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCD
Sbjct  191   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCD  250

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGV+PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  251   KQKAILLADMAHISGLVAAGVVPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  310

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNC+KFAQ
Sbjct  311   GKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCAKFAQ  370

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL EKGYELVSGGTENHLVLVNLKNKGIDGSRVEKV+ESVHIAANKNTVPGDVSAMVPGG
Sbjct  371   TLTEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVMESVHIAANKNTVPGDVSAMVPGG  430

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQ  1598
             IRMGTPALTSRGF+EEDFVKVAE+FDAAV L+VKIKA T+
Sbjct  431   IRMGTPALTSRGFIEEDFVKVAEFFDAAVGLAVKIKAQTK  470



>ref|XP_003534254.2| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Glycine max]
Length=517

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/481 (86%), Positives = 449/481 (93%), Gaps = 3/481 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EA Y+ EK   S   +LNA LE VDPEIADIIELEKARQWKGLELIPSENFTS+SVMQA+
Sbjct  38    EAAYDNEK---SCDTELNAPLEVVDPEIADIIELEKARQWKGLELIPSENFTSVSVMQAI  94

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GS++TN  +EGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQPLSGS +NF
Sbjct  95    GSIITNTRNEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLSGSSANF  154

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIM LDLPHGGHLSHGYQTDT K+SAVS+FFETMPYRLNE+TG+IDYDQ
Sbjct  155   QVYTALLKPHDRIMGLDLPHGGHLSHGYQTDTNKVSAVSLFFETMPYRLNENTGHIDYDQ  214

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE +A LFRPKLIVAGA+AYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  215   LESTAKLFRPKLIVAGATAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  274

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             DYADVVTTTTHKSLRGPRGAMIF+RKGVKE+N++G+EV+YDYEDKIN+AVFPGLQ GPH 
Sbjct  275   DYADVVTTTTHKSLRGPRGAMIFFRKGVKEINEKGEEVMYDYEDKINRAVFPGLQSGPHF  334

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             H+ITGLAVALKQATTP YRAYQEQVL NCSKFAQ L EKGYELVSGGTENHL+LVNLK+K
Sbjct  335   HSITGLAVALKQATTPNYRAYQEQVLRNCSKFAQALSEKGYELVSGGTENHLLLVNLKSK  394

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRV+KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDFV VAE+FD
Sbjct  395   GIDGSRVQKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFAEEDFVMVAEFFD  454

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             AAV L+VKIK+ T+G+KLK+F+AT+QSS   Q+EIAKLRHDVEEYAKQFPTIGF+K TMK
Sbjct  455   AAVNLAVKIKSETKGSKLKDFLATIQSSSYFQSEIAKLRHDVEEYAKQFPTIGFDKETMK  514

Query  1737  Y  1739
             Y
Sbjct  515   Y  515



>pir||T01759 glycine hydroxymethyltransferase (EC 2.1.2.1) A_IG002P16.3 - 
Arabidopsis thaliana
Length=532

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/502 (83%), Positives = 454/502 (90%), Gaps = 32/502 (6%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W KQLNASL+E+DPE+ADIIELEKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGY
Sbjct  30    WIKQLNASLDEIDPEVADIIELEKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGY  89

Query  513   PGARYYGGNEY---------IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVY  665
             PGARYYGGNEY         IDMAE+LCQKRALEAF+LDP+KWGVNVQ LSGSP+NFQVY
Sbjct  90    PGARYYGGNEYVVCILLTRYIDMAETLCQKRALEAFQLDPSKWGVNVQSLSGSPANFQVY  149

Query  666   TALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEK  845
             TALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E+TGYIDYDQLEK
Sbjct  150   TALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDENTGYIDYDQLEK  209

Query  846   SATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYA  1025
             SA LFRPKLIVAGASAYARLYDY RIRKVC+KQKA++LADMAHISGLVAAGVIPSPF+YA
Sbjct  210   SAVLFRPKLIVAGASAYARLYDYARIRKVCNKQKAVMLADMAHISGLVAAGVIPSPFEYA  269

Query  1026  DVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTI  1205
             DVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQGKEV+YDYED+INQAVFPGLQGGPHNHTI
Sbjct  270   DVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEVMYDYEDRINQAVFPGLQGGPHNHTI  329

Query  1206  TGLAVALKQATTPEYRAYQEQVLSNCSKFA----------------QTLVEKGYELVSGG  1337
             TGLAVALKQA TPEY+AYQ+QVL NCSKFA                QTL+ KGY+LVSGG
Sbjct  330   TGLAVALKQARTPEYKAYQDQVLRNCSKFAELDIRPTVIISYGLSMQTLLAKGYDLVSGG  389

Query  1338  TENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF  1517
             T+NHLVLVNLKNKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF
Sbjct  390   TDNHLVLVNLKNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF  449

Query  1518  VEEDFVKVAEYFDAAVKLSVKIKAATQ-------GTKLKEFVATLQSSDAIQAEIAKLRH  1676
             +EEDF KVAEYFD AVK+++KIKA +Q       GTKLK+FVAT+QS++ +Q+E++KLR 
Sbjct  450   IEEDFAKVAEYFDLAVKIALKIKAESQGIYKKSFGTKLKDFVATMQSNEKLQSEMSKLRE  509

Query  1677  DVEEYAKQFPTIGFEKHTMKYK  1742
              VEEYAKQFPTIGFEK TM+YK
Sbjct  510   MVEEYAKQFPTIGFEKETMRYK  531



>ref|XP_003615366.1| Serine hydroxymethyltransferase [Medicago truncatula]
 gb|AES98324.1| serine transhydroxymethyltransferase [Medicago truncatula]
Length=507

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/474 (86%), Positives = 442/474 (93%), Gaps = 0/474 (0%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             K    W KQLN  L  VDPEI DIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK
Sbjct  32    KSHPDWIKQLNDPLGVVDPEIEDIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  91

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALL  677
             YSEGYPGARYYGGNEYIDMAE+LCQKRALE F LDP +WGVNVQ LSGSPSNFQVYTALL
Sbjct  92    YSEGYPGARYYGGNEYIDMAETLCQKRALETFGLDPTQWGVNVQSLSGSPSNFQVYTALL  151

Query  678   KPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  857
             KPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ+EKSA L
Sbjct  152   KPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQMEKSAAL  211

Query  858   FRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVT  1037
             FRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPFDYADVVT
Sbjct  212   FRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFDYADVVT  271

Query  1038  TTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  1217
             TTTHKSLRGPRGAMIF+RKG+KE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTITGLA
Sbjct  272   TTTHKSLRGPRGAMIFFRKGLKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  331

Query  1218  VALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRV  1397
             VALKQA TPE++ YQ+QVLSN S FAQ+L+EKGY+LVSGGTENHLVLVNL+NKGIDGSRV
Sbjct  332   VALKQAMTPEFKNYQKQVLSNSSTFAQSLLEKGYDLVSGGTENHLVLVNLRNKGIDGSRV  391

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVE+DF KVAEYFDAAVK+++
Sbjct  392   EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEDDFKKVAEYFDAAVKIAL  451

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +IK  ++GTKLK+FV  ++S   +Q++IA LRHDVE YAKQFPTIGFE  TMKY
Sbjct  452   QIKENSKGTKLKDFVEAMESDSQVQSQIADLRHDVEGYAKQFPTIGFEIETMKY  505



>gb|AFK45020.1| unknown [Medicago truncatula]
Length=507

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/474 (86%), Positives = 439/474 (93%), Gaps = 0/474 (0%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             K    W KQLN  L  VDPEI DIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK
Sbjct  32    KSHPDWIKQLNDPLGVVDPEIEDIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  91

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALL  677
             YSEGY GARYYGGNEYIDMAE+LCQKRALE F LDP +WGVNVQ LSGSPSNFQVYTALL
Sbjct  92    YSEGYLGARYYGGNEYIDMAETLCQKRALETFGLDPTQWGVNVQSLSGSPSNFQVYTALL  151

Query  678   KPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  857
             KPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ+EKSA L
Sbjct  152   KPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQMEKSAAL  211

Query  858   FRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVT  1037
             FRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPFDYADVVT
Sbjct  212   FRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFDYADVVT  271

Query  1038  TTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  1217
             TTTHKSLRGPRGAMIF+RKG+KE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTITGLA
Sbjct  272   TTTHKSLRGPRGAMIFFRKGLKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  331

Query  1218  VALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRV  1397
             VALKQA TPE++ YQ+QVLSN S FAQ+L+EKGY+LVSGGTENHLVLVNL+NKGIDGSRV
Sbjct  332   VALKQAMTPEFKNYQKQVLSNSSTFAQSLLEKGYDLVSGGTENHLVLVNLRNKGIDGSRV  391

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVE+DF KVAEYFDA VK+++
Sbjct  392   EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEDDFKKVAEYFDAVVKIAL  451

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +IK  ++GTKLK+FV  ++S   +Q++IA  RHDVE YAKQFPTIGFE  TMKY
Sbjct  452   QIKENSKGTKLKDFVEAMESDSQVQSQIADFRHDVEGYAKQFPTIGFEIETMKY  505



>gb|EEE59895.1| hypothetical protein OsJ_12499 [Oryza sativa Japonica Group]
Length=489

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/478 (86%), Positives = 435/478 (91%), Gaps = 24/478 (5%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  36    EERSGVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  95

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEY                        VNVQPLSGSP+NF VYTA
Sbjct  96    NKYSEGYPGARYYGGNEY------------------------VNVQPLSGSPANFHVYTA  131

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA
Sbjct  132   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSA  191

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  192   VLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDYADV  251

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  252   VTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  311

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLK+KGIDGS
Sbjct  312   LAVALKQATTPEYRAYQEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKSKGIDGS  371

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L
Sbjct  372   RVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNL  431

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             ++K+KAA  GTKLK+FVATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  432   ALKVKAAAGGTKLKDFVATLQSDSNIQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  489



>ref|XP_006426224.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
 gb|ESR39464.1| hypothetical protein CICLE_v10025372mg [Citrus clementina]
Length=477

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/462 (90%), Positives = 438/462 (95%), Gaps = 1/462 (0%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS++KP + L+NG    Y  S  + EAVYEKEK  V+WPKQLNA LE VDPEIADIIE 
Sbjct  11    SSSLDKPTRPLFNGSSLYYMSSLPN-EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEH  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDP KWGVNVQ LSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPEKWGVNVQSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCN  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAI+LADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQ
Sbjct  250   KQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEV YDYE+KINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQ
Sbjct  310   GKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQ  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL+E GYELVSGGTENHLVLVNLKNK IDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  370   TLLEMGYELVSGGTENHLVLVNLKNKRIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             IRMGTPALTSRGFVEEDF KVA +FDAAVKL+VKIK+ TQG+
Sbjct  430   IRMGTPALTSRGFVEEDFAKVAYFFDAAVKLAVKIKSETQGS  471



>gb|KGN62770.1| hypothetical protein Csa_2G372170 [Cucumis sativus]
Length=515

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/483 (84%), Positives = 444/483 (92%), Gaps = 3/483 (1%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             A  E+EK + +W +QLNA LE +DPEIADIIELEKARQWKG ELIPSENFTS SVM+AVG
Sbjct  35    AAEEREKARATWIQQLNAPLEVIDPEIADIIELEKARQWKGFELIPSENFTSSSVMEAVG  94

Query  480   SVMTNKYSEGYPGARYYGG-NEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
               +  K+S+        G    YIDMAESLCQKRALEAFRLDPAKWGVNVQ LSGSP+NF
Sbjct  95    RWI--KFSKSVTCRDGTGPFCSYIDMAESLCQKRALEAFRLDPAKWGVNVQSLSGSPANF  152

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             Q YTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  153   QAYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  212

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LE+SA+LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPF
Sbjct  213   LERSASLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPF  272

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHN
Sbjct  273   EYADIVTTTTHKSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQGGPHN  332

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             HTI GLAVALKQATTPEY+AYQEQVLSNCSKFAQ+L+EKGYELVSGGT+NHLVLVNLKNK
Sbjct  333   HTIAGLAVALKQATTPEYKAYQEQVLSNCSKFAQSLIEKGYELVSGGTDNHLVLVNLKNK  392

Query  1377  GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFD  1556
             GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+E DFVKVAE FD
Sbjct  393   GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFLEADFVKVAELFD  452

Query  1557  AAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
               VKL++KIKA ++GTKLK+FVAT+QS+   Q+EI+KLRH VEEYAKQFPTIGFEK TM+
Sbjct  453   ETVKLALKIKAGSEGTKLKDFVATMQSNKDFQSEISKLRHQVEEYAKQFPTIGFEKETMR  512

Query  1737  YKN  1745
             Y++
Sbjct  513   YRD  515



>gb|KCW54637.1| hypothetical protein EUGRSUZ_I00580 [Eucalyptus grandis]
Length=427

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/427 (93%), Positives = 417/427 (98%), Gaps = 0/427 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQ LSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQSLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI
Sbjct  61    PANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAILLADMAHISGLVAAGV+
Sbjct  121   DYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAILLADMAHISGLVAAGVV  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYD+EDKINQAVFPGLQG
Sbjct  181   PSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDFEDKINQAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTITGLAVALKQATTPEYRAYQEQVLSNC+KFAQTL EKGYELVSGGTENHLVLVN
Sbjct  241   GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCAKFAQTLTEKGYELVSGGTENHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             LKNKGIDGSRVEKV+ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF+EEDFVKVA
Sbjct  301   LKNKGIDGSRVEKVMESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFIEEDFVKVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             E+FDAAV L+VKIKA T+GTKLK+F++T+QSS   Q+ IAKLRHDVEEYAKQFPTIGFEK
Sbjct  361   EFFDAAVGLAVKIKAQTKGTKLKDFLSTMQSSPDFQSGIAKLRHDVEEYAKQFPTIGFEK  420

Query  1725  HTMKYKN  1745
              TMKYKN
Sbjct  421   ATMKYKN  427



>gb|AAZ67146.1| serine hydroxymethyltransferase [Medicago truncatula]
Length=507

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/476 (84%), Positives = 435/476 (91%), Gaps = 4/476 (1%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             K    W KQLN  L  VDPEI DIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK
Sbjct  32    KSHPDWIKQLNDPLGVVDPEIEDIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  91

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS--PSNFQVYTA  671
             YSEGYPGARYYGGNEYIDMAE+LCQKRALE F LDP +WG     +SG   PSNFQVYTA
Sbjct  92    YSEGYPGARYYGGNEYIDMAETLCQKRALETFGLDPTQWGGFSTSVSGQLKPSNFQVYTA  151

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHG  TDTKKISAVSIFFETMPYRL+ESTGYIDYDQ+EKSA
Sbjct  152   LLKPHERIMALDLPHGGHLSHG--TDTKKISAVSIFFETMPYRLDESTGYIDYDQMEKSA  209

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADMAHISGLVAAGVIPSPFDYADV
Sbjct  210   ALFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADMAHISGLVAAGVIPSPFDYADV  269

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKG+KE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTITG
Sbjct  270   VTTTTHKSLRGPRGAMIFFRKGLKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNHTITG  329

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQA TPE++ YQ+QVLSN S FAQ+L+EKGY+LVSGGTENHLVLVNL+NKGIDGS
Sbjct  330   LAVALKQAMTPEFKNYQKQVLSNSSTFAQSLLEKGYDLVSGGTENHLVLVNLRNKGIDGS  389

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVE+DF KVAEYFDAAVK+
Sbjct  390   RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEDDFKKVAEYFDAAVKI  449

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +++IK  ++GTKLK+FV  ++S   +Q++IA LRHDVE YAKQFPTIGFE  TMKY
Sbjct  450   ALQIKENSKGTKLKDFVEAMESDSQVQSQIADLRHDVEGYAKQFPTIGFEIETMKY  505



>ref|XP_001756110.1| predicted protein [Physcomitrella patens]
 gb|EDQ78976.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/476 (83%), Positives = 432/476 (91%), Gaps = 5/476 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             WPKQLNA + EVDPEI DIIE EK RQ+KGLELIPSENFTSLSVMQAVGSVMTNKYSEGY
Sbjct  4     WPKQLNADISEVDPEIVDIIEHEKNRQYKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  63

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGNEYIDMAE LCQKRAL AFRLDP KWGVNVQ LSGSP+NFQVYTALLKPH+R
Sbjct  64    PGARYYGGNEYIDMAERLCQKRALAAFRLDPEKWGVNVQSLSGSPANFQVYTALLKPHER  123

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKL
Sbjct  124   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKL  183

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYAR YDY R+R+VCDKQKAILLADMAHISGLVA GV+PSPFDYADVVTTTTHK
Sbjct  184   IVAGASAYARHYDYARMRQVCDKQKAILLADMAHISGLVAGGVVPSPFDYADVVTTTTHK  243

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIFYRKG+KE  K+G++V YDYEDKIN +VFPGLQGGPHNHTITGLAVALKQ
Sbjct  244   SLRGPRGAMIFYRKGLKETTKKGEQVFYDYEDKINASVFPGLQGGPHNHTITGLAVALKQ  303

Query  1233  ATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE  1412
             A TPE++AYQEQVL N + FA+ L+ +GYELVSGGTENHLVLVNLK KG+DGSRVE+V+E
Sbjct  304   AATPEFKAYQEQVLRNSAHFAKALMGRGYELVSGGTENHLVLVNLKPKGVDGSRVERVME  363

Query  1413  SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAA  1592
               HIAANKNTVPGDVSA+VPGGIRMGTPALTSRGF EEDF KVAEYFD AV+++VK+K +
Sbjct  364   LAHIAANKNTVPGDVSALVPGGIRMGTPALTSRGFTEEDFEKVAEYFDRAVEIAVKVKKS  423

Query  1593  T-----QGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             T      GTKLK+F   + +   +QAEI KL+H+VEE+AKQFPTIGFEK +MKYKN
Sbjct  424   TALFPVAGTKLKDFRNVVDTDPEVQAEIGKLKHEVEEFAKQFPTIGFEKSSMKYKN  479



>emb|CAN83325.1| hypothetical protein VITISV_000671 [Vitis vinifera]
Length=523

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/495 (83%), Positives = 444/495 (90%), Gaps = 12/495 (2%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSS+ KP+++++NGG   Y  S  + EAVYE+EK +V+WPKQLNA L  VDPEIADIIEL
Sbjct  11    SSSVNKPVRSVFNGGSIYYMASLPN-EAVYEEEKSRVTWPKQLNAPLGVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWK LEL+PSENFTS+SVMQAVGS+MTN  SEGYPGARYYGGNEYIDMAESLCQKR
Sbjct  70    EKARQWKALELVPSENFTSVSVMQAVGSIMTNNVSEGYPGARYYGGNEYIDMAESLCQKR  129

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  130   ALEAFRLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  189

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY  IRKVCD
Sbjct  190   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYAHIRKVCD  249

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPF+YAD+VTTTT+KSLRGP GAMIF++KGVKEVNKQ
Sbjct  250   KQKAILLADMAHISGLVAAGVIPSPFEYADIVTTTTYKSLRGPXGAMIFFKKGVKEVNKQ  309

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQ  PHNHTI GLAVALKQATTPEY+AYQEQVLSNCSKFA+
Sbjct  310   GKEVLYDYEDKINQAVFPGLQSAPHNHTIAGLAVALKQATTPEYKAYQEQVLSNCSKFAE  369

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
             TL++KGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI ANKNTVPGDVSAMVP G
Sbjct  370   TLMKKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIVANKNTVPGDVSAMVPSG  429

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMG            DFVKVAEYFD AV ++VKIKA T GTKLK F+A +QSS  +Q E
Sbjct  430   IRMG-----------RDFVKVAEYFDXAVTVAVKIKAETTGTKLKXFLAXMQSSPHLQXE  478

Query  1659  IAKLRHDVEEYAKQF  1703
             IAKLRH+  E  + F
Sbjct  479   IAKLRHEGVETLQIF  493



>ref|XP_001765821.1| predicted protein [Physcomitrella patens]
 gb|EDQ69412.1| predicted protein [Physcomitrella patens]
Length=473

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/471 (83%), Positives = 431/471 (92%), Gaps = 1/471 (0%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             WPKQLNA + EVDPEI DIIE EK RQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGY
Sbjct  4     WPKQLNADISEVDPEITDIIEHEKNRQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGY  63

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGNE+IDMAE LCQKRAL AFRLDP KWGVNVQ LSGSP+NFQVYTALLKPH+R
Sbjct  64    PGARYYGGNEFIDMAERLCQKRALAAFRLDPEKWGVNVQSLSGSPANFQVYTALLKPHER  123

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTD KKISAVSIFFETMPYRL+ESTGYIDYD +EKSA L+RPKL
Sbjct  124   IMALDLPHGGHLSHGYQTDMKKISAVSIFFETMPYRLDESTGYIDYDTMEKSAVLYRPKL  183

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYAR YDY R+RKVCDKQKAILLADMAHISGLVAAGV+PSPFD+ADVVTTTTHK
Sbjct  184   IVAGASAYARHYDYARMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDFADVVTTTTHK  243

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIFYRKG+KE NK+G+++ YDYEDKIN AVFPGLQGGPHNHTI GLAVALKQ
Sbjct  244   SLRGPRGAMIFYRKGLKETNKKGEQIFYDYEDKINAAVFPGLQGGPHNHTIAGLAVALKQ  303

Query  1233  ATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE  1412
             A TPE++AYQEQVLSN ++FA+ L+ +GYELVSGGTENHLVLVNLK KG+DGSRVE+V+E
Sbjct  304   AATPEFKAYQEQVLSNSARFAKALMSQGYELVSGGTENHLVLVNLKPKGVDGSRVERVME  363

Query  1413  SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAA  1592
               HIAANKNTVPGDVSA+VPGGIRMGTPALTSRGF+EEDF KVAE+FD AV ++VK+K +
Sbjct  364   LAHIAANKNTVPGDVSALVPGGIRMGTPALTSRGFIEEDFEKVAEFFDRAVGIAVKVKKS  423

Query  1593  TQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             T G KLK+F A + +   IQAEI KLR +VEE+AKQFPTIGFEK +MKY+N
Sbjct  424   T-GAKLKDFRAAVDTDPEIQAEIGKLRTEVEEFAKQFPTIGFEKSSMKYQN  473



>ref|XP_002982415.1| hypothetical protein SELMODRAFT_271551 [Selaginella moellendorffii]
 gb|EFJ16660.1| hypothetical protein SELMODRAFT_271551 [Selaginella moellendorffii]
Length=533

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/478 (82%), Positives = 434/478 (91%), Gaps = 1/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             K+K  V+WPKQLNA L +VDPEIADIIELEK RQWKGLELIPSENFTS SVMQAVGS+MT
Sbjct  57    KDKSHVTWPKQLNAPLGDVDPEIADIIELEKNRQWKGLELIPSENFTSTSVMQAVGSIMT  116

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRL+P +WGVNVQ LSGSP+NFQVYTA
Sbjct  117   NKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLNPNEWGVNVQSLSGSPANFQVYTA  176

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG+IDYDQLEKSA
Sbjct  177   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGFIDYDQLEKSA  236

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
             TLFRPKLIVAGASAY+R YDY R+R++C+KQKAILLADMAHISGLVAAGV+PSPFD ADV
Sbjct  237   TLFRPKLIVAGASAYSRHYDYARMRQICNKQKAILLADMAHISGLVAAGVVPSPFDVADV  296

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKGVKE NKQG+EVLYDY +KIN AVFPGLQGGPHNHTI  
Sbjct  297   VTTTTHKSLRGPRGAMIFFRKGVKETNKQGQEVLYDYAEKINAAVFPGLQGGPHNHTIAA  356

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQA+T E++AYQEQVL N + FA+ L+ KGYELVSGGTENHLVLVNLKNKG+DGS
Sbjct  357   LAVALKQASTQEFKAYQEQVLRNSAHFAKHLMAKGYELVSGGTENHLVLVNLKNKGLDGS  416

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVE+VLE  HIAANKNTVPGDVSAMVPGG+RMGTPALTSRGF E DF KVAE+FD AV +
Sbjct  417   RVERVLELAHIAANKNTVPGDVSAMVPGGVRMGTPALTSRGFTEVDFEKVAEFFDRAVGI  476

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +VKIK A+ G+KLK+F A + ++   Q  I  LR +VE+YAK FPTIGFEK TMKY+N
Sbjct  477   AVKIKEAS-GSKLKDFKAAVDTNPEFQGHIKALREEVEDYAKDFPTIGFEKSTMKYRN  533



>ref|XP_002966577.1| hypothetical protein SELMODRAFT_270566 [Selaginella moellendorffii]
 gb|EFJ32604.1| hypothetical protein SELMODRAFT_270566 [Selaginella moellendorffii]
Length=533

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/478 (82%), Positives = 433/478 (91%), Gaps = 1/478 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             K+K  V+WPKQLNA L +VDPEIADIIELEK RQWKGLELIPSENFTS SVMQAVGS+MT
Sbjct  57    KDKSHVTWPKQLNAPLGDVDPEIADIIELEKNRQWKGLELIPSENFTSTSVMQAVGSIMT  116

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRL+P +WGVNVQ LSGSP+NFQVYTA
Sbjct  117   NKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLNPNEWGVNVQSLSGSPANFQVYTA  176

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG+IDYDQLEKSA
Sbjct  177   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGFIDYDQLEKSA  236

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
             TLFRPKLIVAGASAY+R YDY R+R++C+KQKAILLADMAHISGLVAAGV+PSPFD ADV
Sbjct  237   TLFRPKLIVAGASAYSRHYDYARMRQICNKQKAILLADMAHISGLVAAGVVPSPFDVADV  296

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIF+RKGVKE NKQG+EVLYDY +KIN AVFPGLQGGPHNHTI  
Sbjct  297   VTTTTHKSLRGPRGAMIFFRKGVKETNKQGQEVLYDYAEKINAAVFPGLQGGPHNHTIAA  356

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQA+T E++AYQEQVL N + FA+ L+ KGYELVSGGTENHLVLVNLKNKG+DGS
Sbjct  357   LAVALKQASTQEFKAYQEQVLRNSAHFAKHLMAKGYELVSGGTENHLVLVNLKNKGLDGS  416

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVE+VLE  HIAANKNTVPGDVSAMVPGG+RMGTPALTSRGF E DF KVAE+FD AV +
Sbjct  417   RVERVLELAHIAANKNTVPGDVSAMVPGGVRMGTPALTSRGFTEVDFEKVAEFFDRAVGI  476

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +VKIK A+ G KLK+F A + ++   Q  I  LR +VE+YAK FPTIGFEK TMKY+N
Sbjct  477   AVKIKEAS-GAKLKDFKAAVDTNPEFQGHIKALREEVEDYAKDFPTIGFEKSTMKYRN  533



>ref|XP_007047710.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
 gb|EOX91867.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
Length=426

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/427 (92%), Positives = 413/427 (97%), Gaps = 1/427 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQPLSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQPLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NF VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI
Sbjct  61    PANFHVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAA VI
Sbjct  121   DYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAADVI  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KE+NKQGKE+ YDYEDKINQAVFPGLQG
Sbjct  181   PSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEINKQGKEIFYDYEDKINQAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTITGLAVALKQATTPEY+AYQEQVLSNCSKFAQTL EKGY+LVSGGTENHLVLVN
Sbjct  241   GPHNHTITGLAVALKQATTPEYKAYQEQVLSNCSKFAQTLAEKGYKLVSGGTENHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             LKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA
Sbjct  301   LKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             EYFDAAV L+VKIKA T+GTKLK+F+ TL + +  Q+EIAKLRH+VEEYAKQFPTIGFEK
Sbjct  361   EYFDAAVNLAVKIKAETKGTKLKDFMVTLAAPN-FQSEIAKLRHNVEEYAKQFPTIGFEK  419

Query  1725  HTMKYKN  1745
              TMKYKN
Sbjct  420   GTMKYKN  426



>dbj|BAG94588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87535.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99588.1| unnamed protein product [Oryza sativa Japonica Group]
Length=427

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/427 (92%), Positives = 412/427 (96%), Gaps = 0/427 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG I
Sbjct  61    PANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQ+EKSA LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+
Sbjct  121   DYDQMEKSAVLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVV  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQG
Sbjct  181   PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTITGLAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVN
Sbjct  241   GPHNHTITGLAVALKQATTPEYRAYQEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             LK+KGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA
Sbjct  301   LKSKGIDGSRVEKVLENVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             ++FDAAV L++K+KAA  GTKLK+FVATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK
Sbjct  361   DFFDAAVNLALKVKAAAGGTKLKDFVATLQSDSNIQSEIAKLRHDVEEYAKQFPTIGFEK  420

Query  1725  HTMKYKN  1745
              TMKYKN
Sbjct  421   ETMKYKN  427



>ref|NP_001237491.1| serine hydroxymethyltransferase 3 [Glycine max]
 gb|ACM45953.1| serine hydroxymethyltransferase 3 [Glycine max]
Length=516

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/509 (82%), Positives = 450/509 (88%), Gaps = 3/509 (1%)
 Frame = +3

Query  219   SSSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIEL  398
             SSSI+KP++ L+N G   Y  S    EAVY+KE+  V+WPKQLNA LE VDPEIADIIEL
Sbjct  11    SSSIDKPLRPLFNAGSLYYKSSLPD-EAVYDKERPGVTWPKQLNAPLEVVDPEIADIIEL  69

Query  399   EKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKR  578
             EKARQWK   L    N     +       +    + G+ G  Y    +YIDMAE+LCQKR
Sbjct  70    EKARQWKIEFLCFGVNCEGARIDTVREFHLCVCDASGWIG--YDQQIQYIDMAETLCQKR  127

Query  579   ALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKK  758
             ALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKK
Sbjct  128   ALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKK  187

Query  759   ISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCD  938
             ISAVSIFFETMPYRLNESTGYIDYDQ+EKSATLFRPKLIVAGASAYARLYDY+R+RKVCD
Sbjct  188   ISAVSIFFETMPYRLNESTGYIDYDQMEKSATLFRPKLIVAGASAYARLYDYERVRKVCD  247

Query  939   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ  1118
             KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQ
Sbjct  248   KQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQ  307

Query  1119  GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSN  KFAQ
Sbjct  308   GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNSFKFAQ  367

Query  1299  TLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGG  1478
              L E+ YELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGG
Sbjct  368   ALSERSYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGG  427

Query  1479  IRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAE  1658
             IRMGTPALTSRGFVEEDFVKVAE+FDAAVK++VKIK  ++GTKLK+F+AT++SS   Q+E
Sbjct  428   IRMGTPALTSRGFVEEDFVKVAEFFDAAVKIAVKIKGESKGTKLKDFLATIESSSTFQSE  487

Query  1659  IAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             IAKLR DVEEYAKQFPTIGF+K TMK+KN
Sbjct  488   IAKLRLDVEEYAKQFPTIGFDKATMKHKN  516



>ref|XP_006411835.1| hypothetical protein EUTSA_v10024934mg [Eutrema salsugineum]
 gb|ESQ53288.1| hypothetical protein EUTSA_v10024934mg [Eutrema salsugineum]
Length=427

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/427 (90%), Positives = 413/427 (97%), Gaps = 0/427 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWGVNVQPLSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPEKWGVNVQPLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYI
Sbjct  61    PANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVC+KQKA++LADMAHISGLVAAGVI
Sbjct  121   DYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCNKQKAVMLADMAHISGLVAAGVI  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYD+EDKINQAVFPGLQG
Sbjct  181   PSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDFEDKINQAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTITGLAVALKQATT EY+AYQEQVLSN +KFAQTL+EKGYELVSGGT+NHLVLVN
Sbjct  241   GPHNHTITGLAVALKQATTSEYKAYQEQVLSNSAKFAQTLMEKGYELVSGGTDNHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             LK+KGIDGSRVEKVLE+VHIA+NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA
Sbjct  301   LKSKGIDGSRVEKVLEAVHIASNKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             EYFD AV L++K+K+  QGTKLK+FV+ ++SS  IQ+EIAKLRH+VEE+AKQFPTIGFEK
Sbjct  361   EYFDKAVTLALKVKSEAQGTKLKDFVSAMESSSTIQSEIAKLRHEVEEFAKQFPTIGFEK  420

Query  1725  HTMKYKN  1745
              TMKYKN
Sbjct  421   ETMKYKN  427



>gb|KCW68539.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
 gb|KCW68540.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
 gb|KCW68541.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
 gb|KCW68542.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
Length=427

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/427 (90%), Positives = 413/427 (97%), Gaps = 0/427 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDPAKWGVNVQ LSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFGLDPAKWGVNVQSLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNE+TGYI
Sbjct  61    PANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNETTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQLEKSA L+RPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAAGVI
Sbjct  121   DYDQLEKSAILYRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAAGVI  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQG
Sbjct  181   PSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTIT LAVALKQA TPEY+AYQEQVLSNCS+F+Q+L+EKGYELVSGGTENHLVLVN
Sbjct  241   GPHNHTITALAVALKQAMTPEYKAYQEQVLSNCSRFSQSLLEKGYELVSGGTENHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             L+N+GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDF +VA
Sbjct  301   LRNQGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFGEEDFARVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             ++FDAAVKL++K+KA ++GTKLK+FVAT+QS   IQ+EI KLR DVEEYAKQFPTIGFEK
Sbjct  361   DFFDAAVKLALKVKANSKGTKLKDFVATMQSDANIQSEITKLREDVEEYAKQFPTIGFEK  420

Query  1725  HTMKYKN  1745
              TM+YKN
Sbjct  421   ETMRYKN  427



>gb|KHG13288.1| Serine hydroxymethyltransferase, mitochondrial [Gossypium arboreum]
Length=477

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/472 (83%), Positives = 409/472 (87%), Gaps = 37/472 (8%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             +W  QLNA LE +DPEIA IIELEKARQWKGLELIPSENFTSLSVMQAVGSVM NKYSEG
Sbjct  43    NWIHQLNAPLEGIDPEIATIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMINKYSEG  102

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNEYIDMAESLCQ RALEAF LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+
Sbjct  103   YPGARYYGGNEYIDMAESLCQTRALEAFGLDPAKWGVNVQSLSGSPANFQVYTALLKPHE  162

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNE TGYIDYDQLEKSA LFRPK
Sbjct  163   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNEGTGYIDYDQLEKSAVLFRPK  222

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             LIVAGASAYARLYDY RIRKVCDKQKAI+LADMAHISGLVAAGVIPSPF+YADVVTTTTH
Sbjct  223   LIVAGASAYARLYDYARIRKVCDKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTH  282

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKG+KE+NKQGKEV+YD EDKINQAVFPGLQGGPHNHTI GLAVALK
Sbjct  283   KSLRGPRGAMIFFRKGLKEINKQGKEVMYDLEDKINQAVFPGLQGGPHNHTIAGLAVALK  342

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             Q  TPEY+AYQEQVLSNCSKF+Q L+E GYELVSGGTENHLVLVNL+NKGIDGSRVEKVL
Sbjct  343   QVRTPEYKAYQEQVLSNCSKFSQRLLENGYELVSGGTENHLVLVNLRNKGIDGSRVEKVL  402

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             ESVHIAANKNTVPGDVSAMVPGGIRM                                  
Sbjct  403   ESVHIAANKNTVPGDVSAMVPGGIRM----------------------------------  428

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
                GTKLK+FVATLQS    Q EIAKLR +VEEYAKQFPTIGFEK  MKYK+
Sbjct  429   ---GTKLKDFVATLQSDTYFQTEIAKLRQEVEEYAKQFPTIGFEKEAMKYKD  477



>gb|ABR16633.1| unknown [Picea sitchensis]
Length=428

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/428 (86%), Positives = 405/428 (95%), Gaps = 1/428 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDP KWGVNVQPLSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPDKWGVNVQPLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYI
Sbjct  61    PANFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQLEKSA LFRPKLIVAGASAYAR YDY R+RKVCDKQKA+LLADMAHISGLVA GV+
Sbjct  121   DYDQLEKSAVLFRPKLIVAGASAYARHYDYARMRKVCDKQKAVLLADMAHISGLVAGGVV  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPF++ADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQG+EV YDYE+KIN AVFPGLQG
Sbjct  181   PSPFEFADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQGQEVKYDYEEKINAAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTITGLAVALKQATT EY+AYQEQVLSNC+ FA+ L E+GYELVSGGT+NHLVLVN
Sbjct  241   GPHNHTITGLAVALKQATTSEYKAYQEQVLSNCAHFAKCLSERGYELVSGGTDNHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             LKNKGIDGSRVE+VLE VHIAANKNTVPGD+SAMVPGGIRMGTPALTSRGF+E+DF KVA
Sbjct  301   LKNKGIDGSRVERVLELVHIAANKNTVPGDISAMVPGGIRMGTPALTSRGFIEDDFAKVA  360

Query  1545  EYFDAAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFE  1721
             E+FD A +L+++IK+ T+ G+KLK+F AT++SS   QAEIA LRH+VEEYAKQFPTIGFE
Sbjct  361   EFFDIAAQLAIRIKSETKGGSKLKDFKATMESSPHFQAEIASLRHNVEEYAKQFPTIGFE  420

Query  1722  KHTMKYKN  1745
             K ++KYK+
Sbjct  421   KTSLKYKD  428



>gb|ABF98773.1| Serine hydroxymethyltransferase, mitochondrial precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=464

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/402 (91%), Positives = 386/402 (96%), Gaps = 0/402 (0%)
 Frame = +3

Query  540   EYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHG  719
              YIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTALLKPH+RIMALDLPHG
Sbjct  63    RYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHG  122

Query  720   GHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYA  899
             GHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA LFRPKLIVAGASAYA
Sbjct  123   GHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSAVLFRPKLIVAGASAYA  182

Query  900   RLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAM  1079
             RLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+PSPFDYADVVTTTTHKSLRGPRGAM
Sbjct  183   RLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDYADVVTTTTHKSLRGPRGAM  242

Query  1080  IFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAY  1259
             IFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITGLAVALKQATTPEYRAY
Sbjct  243   IFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITGLAVALKQATTPEYRAY  302

Query  1260  QEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKN  1439
             QEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLK+KGIDGSRVEKVLE+VHIAANKN
Sbjct  303   QEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKSKGIDGSRVEKVLENVHIAANKN  362

Query  1440  TVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEF  1619
             TVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVA++FDAAV L++K+KAA  GTKLK+F
Sbjct  363   TVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVADFFDAAVNLALKVKAAAGGTKLKDF  422

Query  1620  VATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             VATLQS   IQ+EIAKLRHDVEEYAKQFPTIGFEK TMKYKN
Sbjct  423   VATLQSDSNIQSEIAKLRHDVEEYAKQFPTIGFEKETMKYKN  464



>gb|KCW68544.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
Length=398

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/398 (89%), Positives = 384/398 (96%), Gaps = 0/398 (0%)
 Frame = +3

Query  552   MAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLS  731
             MAE+LCQKRALEAF LDPAKWGVNVQ LSGSP+NFQVYTALLKPH+RIMALDLPHGGHLS
Sbjct  1     MAETLCQKRALEAFGLDPAKWGVNVQSLSGSPANFQVYTALLKPHERIMALDLPHGGHLS  60

Query  732   HGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYD  911
             HGYQTDTKKISAVSIFFETMPYRLNE+TGYIDYDQLEKSA L+RPKLIVAGASAYARLYD
Sbjct  61    HGYQTDTKKISAVSIFFETMPYRLNETTGYIDYDQLEKSAILYRPKLIVAGASAYARLYD  120

Query  912   YDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYR  1091
             Y+RIRKVCDKQKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+R
Sbjct  121   YERIRKVCDKQKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFR  180

Query  1092  KGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQV  1271
             KGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTIT LAVALKQA TPEY+AYQEQV
Sbjct  181   KGVKEINKKGQEVLYDYEDKINQAVFPGLQGGPHNHTITALAVALKQAMTPEYKAYQEQV  240

Query  1272  LSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPG  1451
             LSNCS+F+Q+L+EKGYELVSGGTENHLVLVNL+N+GIDGSRVEKVLESVHIAANKNTVPG
Sbjct  241   LSNCSRFSQSLLEKGYELVSGGTENHLVLVNLRNQGIDGSRVEKVLESVHIAANKNTVPG  300

Query  1452  DVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATL  1631
             DVSAMVPGGIRMGTPALTSRGF EEDF +VA++FDAAVKL++K+KA ++GTKLK+FVAT+
Sbjct  301   DVSAMVPGGIRMGTPALTSRGFGEEDFARVADFFDAAVKLALKVKANSKGTKLKDFVATM  360

Query  1632  QSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             QS   IQ+EI KLR DVEEYAKQFPTIGFEK TM+YKN
Sbjct  361   QSDANIQSEITKLREDVEEYAKQFPTIGFEKETMRYKN  398



>ref|XP_005643716.1| SHMT-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19172.1| SHMT-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=504

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/477 (75%), Positives = 407/477 (85%), Gaps = 3/477 (1%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             K +V+WPK LNA L EVDPE+ DIIE EK RQWKGLELIPSENF S SVM+AVGSVMTNK
Sbjct  30    KAKVTWPKLLNAPLSEVDPELEDIIEHEKNRQWKGLELIPSENFVSSSVMEAVGSVMTNK  89

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALL  677
             YSEGYPGARYYGGNE+ID AE LCQ+RAL+AFRLDP KWGVNVQ LSGSP+NFQVYTALL
Sbjct  90    YSEGYPGARYYGGNEFIDQAERLCQERALKAFRLDPEKWGVNVQSLSGSPANFQVYTALL  149

Query  678   KPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  857
              PHDRIM LDLPHGGHLSHGYQTDTK+ISAVSIFFETM YRL+E TG IDYD+LE++A L
Sbjct  150   NPHDRIMGLDLPHGGHLSHGYQTDTKRISAVSIFFETMAYRLDEETGIIDYDRLEENAAL  209

Query  858   FRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVT  1037
             FRPKLIVAGASAYAR YDY R+R + DK KA LLADMAHISGLVAAGV+PSPFDYADVVT
Sbjct  210   FRPKLIVAGASAYARHYDYPRMRAIADKHKAFLLADMAHISGLVAAGVVPSPFDYADVVT  269

Query  1038  TTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLA  1217
             TTTHKSLRGPRGAMIF+RKGV+ V+K+GKE++YD EDKIN +VFPGLQGGPHNHTI+GLA
Sbjct  270   TTTHKSLRGPRGAMIFFRKGVRSVDKKGKEIMYDMEDKINFSVFPGLQGGPHNHTISGLA  329

Query  1218  VALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRV  1397
              ALKQA  PE++AYQEQVL N    A  L ++G++LVSGGTENHLVL +L+ KG+DGSRV
Sbjct  330   CALKQAAGPEFKAYQEQVLKNSKALADGLQKRGFKLVSGGTENHLVLADLRPKGVDGSRV  389

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             E+VLE  HIAANKNTVPGD SA+VPGG+RMG PALTSRGF E DF KVAE+ D AV+++V
Sbjct  390   ERVLELAHIAANKNTVPGDKSALVPGGLRMGAPALTSRGFTEADFDKVAEFVDRAVQITV  449

Query  1578  KIKAAT-QGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              +K     G KLK+F A + S++    EI +L+  VEE+AK FPTIGFEK  M+YK+
Sbjct  450   DLKNKEGAGPKLKDFKAYVDSNEV--PEIKELKSAVEEFAKDFPTIGFEKSEMRYKD  504



>gb|KCW68543.1| hypothetical protein EUGRSUZ_F02167 [Eucalyptus grandis]
Length=389

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/386 (90%), Positives = 374/386 (97%), Gaps = 0/386 (0%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF LDPAKWGVNVQ LSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFGLDPAKWGVNVQSLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNE+TGYI
Sbjct  61    PANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNETTGYI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYDQLEKSA L+RPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADMAHISGLVAAGVI
Sbjct  121   DYDQLEKSAILYRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADMAHISGLVAAGVI  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQG  1184
             PSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NK+G+EVLYDYEDKINQAVFPGLQG
Sbjct  181   PSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKKGQEVLYDYEDKINQAVFPGLQG  240

Query  1185  GPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVN  1364
             GPHNHTIT LAVALKQA TPEY+AYQEQVLSNCS+F+Q+L+EKGYELVSGGTENHLVLVN
Sbjct  241   GPHNHTITALAVALKQAMTPEYKAYQEQVLSNCSRFSQSLLEKGYELVSGGTENHLVLVN  300

Query  1365  LKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVA  1544
             L+N+GIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGF EEDF +VA
Sbjct  301   LRNQGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFGEEDFARVA  360

Query  1545  EYFDAAVKLSVKIKAATQGTKLKEFV  1622
             ++FDAAVKL++K+KA ++G++   F 
Sbjct  361   DFFDAAVKLALKVKANSKGSRNLAFC  386



>ref|XP_001701451.1| serine hydroxymethyltransferase [Chlamydomonas reinhardtii]
 gb|AAL35384.1|AF442558_1 serine hydroxymethyltransferase [Chlamydomonas reinhardtii]
 gb|EDO97448.1| serine hydroxymethyltransferase [Chlamydomonas reinhardtii]
Length=520

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/480 (72%), Positives = 399/480 (83%), Gaps = 5/480 (1%)
 Frame = +3

Query  309   EKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             +  +  V+WPK LNA L EVDP++ DIIE EK RQ+KGLELIPSENF S SVM+AVGSVM
Sbjct  45    DASRAHVTWPKVLNAGLAEVDPDLFDIIEKEKNRQFKGLELIPSENFVSASVMEAVGSVM  104

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEGYPGARYYGGNE+ID AE LCQ+RAL+AF LDPA+WGVNVQ LSGSPSNFQVYT
Sbjct  105   TNKYSEGYPGARYYGGNEFIDQAERLCQERALKAFHLDPAQWGVNVQSLSGSPSNFQVYT  164

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALL+PHDRIMALDLPHGGHLSHGYQTDTKKISA SI+FE MPYRLNE TG IDYD LEK+
Sbjct  165   ALLQPHDRIMALDLPHGGHLSHGYQTDTKKISATSIYFEQMPYRLNEETGLIDYDMLEKT  224

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             A LFRPKLIVAGASAY R YDY R+R + DK  A LLADMAHISGLVAA ++PSPF +AD
Sbjct  225   AVLFRPKLIVAGASAYTRHYDYARMRAIADKVGAWLLADMAHISGLVAADLVPSPFGFAD  284

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVN-KQGKEVLYDYEDKINQAVFPGLQGGPHNHTI  1205
             VVTTTTHKSLRGPRGAMIFYRKGV+  + K GK + YD EDKIN AVFPGLQGGPHNHTI
Sbjct  285   VVTTTTHKSLRGPRGAMIFYRKGVRRTDAKTGKPINYDIEDKINFAVFPGLQGGPHNHTI  344

Query  1206  TGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGID  1385
              GLA ALKQA TPE+++YQ+QVLSN    A  L ++G++LVSGGT+NH+VLV+L+ KG+D
Sbjct  345   AGLACALKQAATPEFKSYQQQVLSNSQALAGALAKRGFKLVSGGTDNHIVLVDLRPKGVD  404

Query  1386  GSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAV  1565
             GSRVE+VLE  HIAANKNTVPGDVSA+VPGG+RMG+PALTSRGFVE+DF +VAE+ D AV
Sbjct  405   GSRVERVLELAHIAANKNTVPGDVSALVPGGLRMGSPALTSRGFVEKDFEQVAEFVDRAV  464

Query  1566  KLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              ++V +K   +  KLKEF   +        +I  L+ DVE +A +FPTIGF+K  M+YKN
Sbjct  465   NIAVDLK--KKYPKLKEFREAMAKEST--PDINALKKDVETFAMRFPTIGFDKAAMRYKN  520



>ref|XP_001422748.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01065.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=525

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/473 (73%), Positives = 401/473 (85%), Gaps = 2/473 (0%)
 Frame = +3

Query  321   CQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKY  500
               V+WP+ +N  +EEVDPE+++IIE EKARQWKGLELIPSENF S SVM AVGS+MTNKY
Sbjct  51    ANVTWPEIINKPIEEVDPEMSEIIEREKARQWKGLELIPSENFVSKSVMDAVGSIMTNKY  110

Query  501   SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLK  680
             SEGYPGARYYGGNE+IDMAES+CQ+RAL+AF LDPAKWGVNVQ LSGSP+NFQVYTALL+
Sbjct  111   SEGYPGARYYGGNEFIDMAESMCQERALKAFNLDPAKWGVNVQSLSGSPANFQVYTALLQ  170

Query  681   PHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             PHD+IMALDLPHGGHLSHGYQTDTKKISA SIFF ++PYRL+ESTG IDYD  EK+A L 
Sbjct  171   PHDKIMALDLPHGGHLSHGYQTDTKKISATSIFFTSVPYRLDESTGLIDYDACEKTAALV  230

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLIVAGASAYARLYDY R+RK+ D   AILLADMAHISGLVAAG +PSPFDYADVVTT
Sbjct  231   RPKLIVAGASAYARLYDYPRMRKIADNSNAILLADMAHISGLVAAGEVPSPFDYADVVTT  290

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             TTHKSLRGPRGAMIFYRKG K  +K+G  ++YD E KI+ AVFPGLQGGPHNHTI GLAV
Sbjct  291   TTHKSLRGPRGAMIFYRKGEKGKDKKGNPIMYDLESKIDFAVFPGLQGGPHNHTIAGLAV  350

Query  1221  ALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             ALKQA +PE++AYQ QV+SN    A  LV+ G +LVSGGT+NHL L++L+  G+DGSRVE
Sbjct  351   ALKQAASPEFKAYQRQVMSNMQAMANRLVQHGIKLVSGGTDNHLALLDLRPMGVDGSRVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE  HIA NKNTVPGDVSAMVPGG+R+GTPALTSRGF E+DF +VAE+    +K++  
Sbjct  411   RVLELAHIACNKNTVPGDVSAMVPGGLRIGTPALTSRGFTEKDFEQVAEFIVRGIKIAQD  470

Query  1581  IKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +K+ ++GTKLK+F A L+S +    E+ +L  DVEE+A QFPTIGFEK   KY
Sbjct  471   VKSKSEGTKLKDFRAALESKE--WPELTQLTKDVEEFATQFPTIGFEKAEGKY  521



>gb|KFM26246.1| Serine hydroxymethyltransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=589

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/517 (68%), Positives = 404/517 (78%), Gaps = 45/517 (9%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + WPK LNA L EVDPE+ DIIE EK RQWKGLELIPSENF S SVM AVGS+MTNKYSE
Sbjct  74    LQWPKVLNAPLSEVDPELYDIIEHEKNRQWKGLELIPSENFVSKSVMDAVGSIMTNKYSE  133

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ-----VYTA  671
             GYPGARYYGGNE+ID AESLCQKRAL AFRLDPA+WGVNVQ LSGSP+NFQ     VYTA
Sbjct  134   GYPGARYYGGNEFIDQAESLCQKRALAAFRLDPAEWGVNVQSLSGSPANFQAGSCSVYTA  193

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPHDRI++LDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+E TG IDYD LE++A
Sbjct  194   LLKPHDRILSLDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLSEETGLIDYDALERTA  253

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              L+RPKLIVAGASAY R YDY R+R++ D+ K+ILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  254   ELYRPKLIVAGASAYTRHYDYPRMRQIADRHKSILLADMAHISGLVAAGVVPSPFDYADV  313

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVK  +K+G ++ YD E  IN +VFPGLQGGPHNHTI+G
Sbjct  314   VTTTTHKSLRGPRGAMIFYRKGVKGQDKKGNDIKYDLEGPINFSVFPGLQGGPHNHTISG  373

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             LAVALKQA  PE+RAYQEQVL+NC   A+ L++ G  LVSGGTENHLVL +L+ +G+DGS
Sbjct  374   LAVALKQAAGPEFRAYQEQVLANCQALAKGLLDAGVNLVSGGTENHLVLADLRPRGVDGS  433

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVE+VLE  HIAANKNTVPGDVSAMVPGG+RMGTPALTSRGFVE DF KVA + +  V +
Sbjct  434   RVERVLELAHIAANKNTVPGDVSAMVPGGLRMGTPALTSRGFVESDFAKVAAFVNRGVDI  493

Query  1572  SVKIKAATQGTKLKEFVATLQSS-----------------------------------DA  1646
             + ++K    G KLK+F   L +                                    DA
Sbjct  494   AKELK-GKHGPKLKDFRDALATDVRPGMGEGNGDGMAVGVDIAKELKGKHGPKLKDFRDA  552

Query  1647  ----IQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
                 +  +I +L+ +VE +A QFPTIGFEK  M+YK+
Sbjct  553   LATDVPPQIQELKEEVEAFATQFPTIGFEKADMRYKD  589



>gb|KHN26165.1| Serine hydroxymethyltransferase, mitochondrial [Glycine soja]
Length=427

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/462 (76%), Positives = 376/462 (81%), Gaps = 74/462 (16%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQ LSGS
Sbjct  1     MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQSLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             PSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI
Sbjct  61    PSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  120

Query  825   DYDQ--------------------LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQ  944
             DYDQ                    LEKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQ
Sbjct  121   DYDQMGIEGRIGQLESIRKERREDLEKSAVLFRPKLIVAGASAYARLYDYARVRKVCDKQ  180

Query  945   KAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGK  1124
             KA+LLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGK
Sbjct  181   KAVLLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGK  240

Query  1125  EVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFA---  1295
             EVLYDYED+INQAVFPGLQGGPHNHTI+GLAVALKQA TPE++ YQ+QVLSNCS FA   
Sbjct  241   EVLYDYEDRINQAVFPGLQGGPHNHTISGLAVALKQAMTPEFKNYQKQVLSNCSAFAQPD  300

Query  1296  --------------QTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAAN  1433
                           Q+L+EKGYELVSGGT+NHLVLVNL+NKGIDGSRVEKVLE+VHIAAN
Sbjct  301   IFSVITDPTVLFELQSLLEKGYELVSGGTDNHLVLVNLRNKGIDGSRVEKVLEAVHIAAN  360

Query  1434  KNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLK  1613
             KNTVPGDVSAMVPGGIRM                                     GTKLK
Sbjct  361   KNTVPGDVSAMVPGGIRM-------------------------------------GTKLK  383

Query  1614  EFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +FVA +QS + +Q++IA LRH+VE+YAKQFPTIGF+  TMKY
Sbjct  384   DFVAAMQSDEQVQSKIANLRHEVEDYAKQFPTIGFDIETMKY  425



>emb|CEG02148.1| Serine hydroxymethyltransferase, pyridoxal phosphate binding 
site [Ostreococcus tauri]
Length=525

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/472 (72%), Positives = 397/472 (84%), Gaps = 2/472 (0%)
 Frame = +3

Query  324   QVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYS  503
              V+WP+ +N  LEE+DPE+ +IIE EKARQWKGLELIPSENF S SVM AVGS+MTNKYS
Sbjct  52    NVTWPEMINKPLEEIDPEMCEIIEHEKARQWKGLELIPSENFVSRSVMDAVGSIMTNKYS  111

Query  504   EGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKP  683
             EGYPGARYYGGNE+IDMAE+LCQ+RAL+AF LDPAKWGVNVQ LSGSP+NFQVYTALL+P
Sbjct  112   EGYPGARYYGGNEFIDMAETLCQERALKAFGLDPAKWGVNVQSLSGSPANFQVYTALLQP  171

Query  684   HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFR  863
             HD+IMALDLPHGGHLSHGYQTDTKKISA SIFF ++PYRLNE TG+IDY+  EK+ATL R
Sbjct  172   HDKIMALDLPHGGHLSHGYQTDTKKISATSIFFTSVPYRLNEETGFIDYEMCEKTATLVR  231

Query  864   PKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTT  1043
             PKLIVAGASAYA+LYDY ++R +CDK  +ILLADMAHISGLVAAGV+PSPF+YADVVTTT
Sbjct  232   PKLIVAGASAYAQLYDYKKMRDICDKTNSILLADMAHISGLVAAGVVPSPFEYADVVTTT  291

Query  1044  THKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             THKSLRGPRGAMIFYRKG K  +K+G  ++YDYEDKIN AVFPGLQGGPHNHTITGLAVA
Sbjct  292   THKSLRGPRGAMIFYRKGEKGKDKKGNAIMYDYEDKINFAVFPGLQGGPHNHTITGLAVA  351

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             LKQA +PE++AYQ QVLSN    A+ L E G +LVSGGT NHL L++L+  G+DGSRVE+
Sbjct  352   LKQAASPEFKAYQLQVLSNMQACAKRLQEHGVKLVSGGTVNHLALLDLRPMGVDGSRVER  411

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE  HIA NKNTVPGDVSAMVPGG+R+GTPALTSRGF+E+DF  VA+     + ++  I
Sbjct  412   VLELAHIACNKNTVPGDVSAMVPGGLRIGTPALTSRGFLEKDFETVADLIVRGIHITKTI  471

Query  1584  KAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
               + +GTKLK+F   L S +    E+ +L  DVE  A +FPTIGFEK   KY
Sbjct  472   NDSAKGTKLKDFREALASKE--WPELTQLTKDVENLATRFPTIGFEKAEGKY  521



>ref|XP_003083071.1| serine hydroxymet (ISS) [Ostreococcus tauri]
Length=543

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/469 (73%), Positives = 395/469 (84%), Gaps = 2/469 (0%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             WP+ +N  LEE+DPE+ +IIE EKARQWKGLELIPSENF S SVM AVGS+MTNKYSEGY
Sbjct  73    WPEMINKPLEEIDPEMCEIIEHEKARQWKGLELIPSENFVSRSVMDAVGSIMTNKYSEGY  132

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGNE+IDMAE+LCQ+RAL+AF LDPAKWGVNVQ LSGSP+NFQVYTALL+PHD+
Sbjct  133   PGARYYGGNEFIDMAETLCQERALKAFGLDPAKWGVNVQSLSGSPANFQVYTALLQPHDK  192

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTDTKKISA SIFF ++PYRLNE TG+IDY+  EK+ATL RPKL
Sbjct  193   IMALDLPHGGHLSHGYQTDTKKISATSIFFTSVPYRLNEETGFIDYEMCEKTATLVRPKL  252

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYA+LYDY ++R +CDK  +ILLADMAHISGLVAAGV+PSPF+YADVVTTTTHK
Sbjct  253   IVAGASAYAQLYDYKKMRDICDKTNSILLADMAHISGLVAAGVVPSPFEYADVVTTTTHK  312

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIFYRKG K  +K+G  ++YDYEDKIN AVFPGLQGGPHNHTITGLAVALKQ
Sbjct  313   SLRGPRGAMIFYRKGEKGKDKKGNAIMYDYEDKINFAVFPGLQGGPHNHTITGLAVALKQ  372

Query  1233  ATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE  1412
             A +PE++AYQ QVLSN    A+ L E G +LVSGGT NHL L++L+  G+DGSRVE+VLE
Sbjct  373   AASPEFKAYQLQVLSNMQACAKRLQEHGVKLVSGGTVNHLALLDLRPMGVDGSRVERVLE  432

Query  1413  SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAA  1592
               HIA NKNTVPGDVSAMVPGG+R+GTPALTSRGF+E+DF  VA+     + ++  I  +
Sbjct  433   LAHIACNKNTVPGDVSAMVPGGLRIGTPALTSRGFLEKDFETVADLIVRGIHITKTINDS  492

Query  1593  TQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              +GTKLK+F   L S +    E+ +L  DVE  A +FPTIGFEK   KY
Sbjct  493   AKGTKLKDFREALASKE--WPELTQLTKDVENLATRFPTIGFEKAEGKY  539



>ref|XP_002505413.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66671.1| predicted protein [Micromonas sp. RCC299]
Length=491

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/479 (71%), Positives = 390/479 (81%), Gaps = 2/479 (0%)
 Frame = +3

Query  306   YEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSV  485
             Y+     VSWP+  N SL E+DPE+ADIIE EKARQWKGLELIPSENFTS SVM+AVGSV
Sbjct  10    YKSLASGVSWPEACNKSLAEMDPEMADIIEHEKARQWKGLELIPSENFTSRSVMEAVGSV  69

Query  486   MTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVY  665
             MTNKYSEGYPGARYYGGNE+ID AE+LCQKRALEAFRLDP KWGVNVQ LSGSPSNFQVY
Sbjct  70    MTNKYSEGYPGARYYGGNEFIDQAETLCQKRALEAFRLDPEKWGVNVQSLSGSPSNFQVY  129

Query  666   TALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEK  845
             T LL PHDRIM LDLPHGGHLSHG+QTDTKKISAVSIFFE+MPYRL+ESTG IDYD  + 
Sbjct  130   TGLLNPHDRIMGLDLPHGGHLSHGFQTDTKKISAVSIFFESMPYRLDESTGLIDYDACQT  189

Query  846   SATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYA  1025
              AT +RPKL++AGASAY+RLYDY R+R++ D   A LLADMAHISGLVAA +IPSPF+Y+
Sbjct  190   LATAYRPKLLIAGASAYSRLYDYKRMREIADSTGAYLLADMAHISGLVAADMIPSPFEYS  249

Query  1026  DVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTI  1205
             DVVTTTTHKSLRGPRGAMIFYRKG K V+K+G  V+YD EDKIN +VFPGLQGGPHNHTI
Sbjct  250   DVVTTTTHKSLRGPRGAMIFYRKGQKGVDKKGAPVMYDLEDKINFSVFPGLQGGPHNHTI  309

Query  1206  TGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGID  1385
              GLAVALKQA +PE++AYQ QV+ N    ++ L   G ELVSGGT+NHLVL +L+  G+D
Sbjct  310   AGLAVALKQAASPEFKAYQTQVMRNMHAMSERLKSHGIELVSGGTDNHLVLADLRPLGVD  369

Query  1386  GSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAV  1565
             GSRVE+VLE  HIA NKNTVPGD SAMVPGG+R+GTPALT+RGFVE DF KVA++    +
Sbjct  370   GSRVERVLELAHIACNKNTVPGDKSAMVPGGLRLGTPALTTRGFVEADFEKVADFVVRGI  429

Query  1566  KLSVKIKAATQGTKLKEFVATL-QSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              ++  +K    G KLK+F   L  + +    EI  L+ +VE +A  FPTIGF+K   KY
Sbjct  430   HIAKDLKTKL-GPKLKDFRDGLSHAPEGKFPEIDALKAEVEAFAATFPTIGFDKAEGKY  487



>ref|XP_007141300.1| hypothetical protein PHAVU_008G184200g [Phaseolus vulgaris]
 gb|ESW13294.1| hypothetical protein PHAVU_008G184200g [Phaseolus vulgaris]
Length=389

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/360 (90%), Positives = 343/360 (95%), Gaps = 0/360 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             + +EK+K +  W KQLN  LE VDPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVG
Sbjct  30    SAHEKDKSRADWTKQLNDPLEAVDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVG  89

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPAKWGVNVQ LSGSPSNFQ
Sbjct  90    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQSLSGSPSNFQ  149

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLK H+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL
Sbjct  150   VYTALLKSHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  209

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFD
Sbjct  210   EKSAALFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFD  269

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YAD+VTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  270   YADIVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHNH  329

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI GLAVALKQA TPE++ YQEQVLSNCS FAQ+L+EKGY+LVSGGT+NHLVLVNL+NKG
Sbjct  330   TIAGLAVALKQAMTPEFKNYQEQVLSNCSAFAQSLLEKGYDLVSGGTDNHLVLVNLRNKG  389



>gb|KDD76609.1| serine hydroxymethyltransferase [Helicosporidium sp. ATCC 50920]
Length=520

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/474 (70%), Positives = 391/474 (82%), Gaps = 3/474 (1%)
 Frame = +3

Query  324   QVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYS  503
             +V+WP+ LNA L EVDPE+ DIIELEK RQ KGLELIPSENF S SVM+AVGSVMTNKYS
Sbjct  50    KVTWPQLLNAPLSEVDPELFDIIELEKNRQCKGLELIPSENFVSRSVMEAVGSVMTNKYS  109

Query  504   EGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKP  683
             EGYPGARYYGGNE+ID AE LCQKRALE F LDPAKWGVNVQ LSGSP+NFQ YT LL P
Sbjct  110   EGYPGARYYGGNEHIDAAERLCQKRALETFGLDPAKWGVNVQSLSGSPANFQAYTGLLSP  169

Query  684   HDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFR  863
             +DRIM LDLPHGGHLSHGYQTDTKKISAVS++F+TMPYRL+ESTG IDYD LE+SA LFR
Sbjct  170   NDRIMGLDLPHGGHLSHGYQTDTKKISAVSVYFQTMPYRLDESTGLIDYDALERSAVLFR  229

Query  864   PKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTT  1043
             PKLIVAGASAY R YDY R+R + D+  A+LL+DMAH+SGLVAAGV PSPF+++DVVTTT
Sbjct  230   PKLIVAGASAYTRHYDYPRMRAIADRVGAVLLSDMAHVSGLVAAGVAPSPFEHSDVVTTT  289

Query  1044  THKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             THKSLRGPRGAMIF+R+GVK  +K+G EV +DYED+IN AVFPGLQGGPHNHTI+GLAVA
Sbjct  290   THKSLRGPRGAMIFFRRGVKGQDKKGNEVRFDYEDRINFAVFPGLQGGPHNHTISGLAVA  349

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             L+QA   ++RAYQ QVL+N    A+ L  +   LVSGGT+NH+VL +L+ +G+DGSR E+
Sbjct  350   LRQAQGADFRAYQRQVLANAQALARGLAARDVRLVSGGTDNHMVLADLRPRGVDGSRAER  409

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE   IA NKNTVPGD SA+VPGG+R+G PALTSRGFVE DF +VAE  +  V ++  +
Sbjct  410   VLELAEIAVNKNTVPGDTSALVPGGVRLGAPALTSRGFVERDFERVAELVNRGVDIARDL  469

Query  1584  KAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             K    G KLK+F A L+    I   I +LR +VEE++K+FPTIGFEK +M+Y N
Sbjct  470   KGKL-GPKLKDFKAALEQE--IPTSIMELRAEVEEFSKEFPTIGFEKSSMRYGN  520



>gb|AAR07090.1| putative glycine hydroxymethyltransferase [Oryza sativa Japonica 
Group]
Length=434

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/355 (92%), Positives = 344/355 (97%), Gaps = 0/355 (0%)
 Frame = +3

Query  312   KEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMT  491
             +E+  V+WPKQLNA LEEVDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAVGSVMT
Sbjct  80    EERSGVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMT  139

Query  492   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTA  671
             NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+NF VYTA
Sbjct  140   NKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTA  199

Query  672   LLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA  851
             LLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG IDYDQ+EKSA
Sbjct  200   LLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGLIDYDQMEKSA  259

Query  852   TLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADV  1031
              LFRPKLIVAGASAYARLYDYDR+RKVCDKQKAILLADMAHISGLVAAGV+PSPFDYADV
Sbjct  260   VLFRPKLIVAGASAYARLYDYDRMRKVCDKQKAILLADMAHISGLVAAGVVPSPFDYADV  319

Query  1032  VTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             VTTTTHKSLRGPRGAMIFYRKGVK VNKQGKEV+YD+EDKIN AVFPGLQGGPHNHTITG
Sbjct  320   VTTTTHKSLRGPRGAMIFYRKGVKGVNKQGKEVMYDFEDKINAAVFPGLQGGPHNHTITG  379

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNK  1376
             LAVALKQATTPEYRAYQEQV+SNC+KFAQ+L  KGYELVSGGT+NHLVLVNLK+K
Sbjct  380   LAVALKQATTPEYRAYQEQVMSNCAKFAQSLTAKGYELVSGGTDNHLVLVNLKSK  434



>ref|XP_006596396.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial isoform 
X2 [Glycine max]
Length=385

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/360 (90%), Positives = 344/360 (96%), Gaps = 0/360 (0%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             + +EK K +  W KQLN  LE +DPEIADIIELEKARQWKG ELIPSENFTSLSVMQAVG
Sbjct  26    SAHEKHKSRADWIKQLNDPLEAIDPEIADIIELEKARQWKGFELIPSENFTSLSVMQAVG  85

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             SVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAF+LDPAKWGVNVQ LSGSPSNFQ
Sbjct  86    SVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFQLDPAKWGVNVQSLSGSPSNFQ  145

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL
Sbjct  146   VYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  205

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             EKSA LFRPKLIVAGASAYARLYDY R+RKVCDKQKA+LLADMAHISGLVAAGVIPSPFD
Sbjct  206   EKSAALFRPKLIVAGASAYARLYDYARVRKVCDKQKAVLLADMAHISGLVAAGVIPSPFD  265

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNH  1199
             YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVLYDYEDKINQAVFPGLQGGPHNH
Sbjct  266   YADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDYEDKINQAVFPGLQGGPHNH  325

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI+GLAVALKQA TPE++ YQ+QVLSNCS FAQ+L+EKGYELVSGGT+NHLVLVNL+NKG
Sbjct  326   TISGLAVALKQAMTPEFKNYQKQVLSNCSAFAQSLLEKGYELVSGGTDNHLVLVNLRNKG  385



>ref|XP_003059685.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55637.1| predicted protein [Micromonas pusilla CCMP1545]
Length=517

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/476 (69%), Positives = 388/476 (82%), Gaps = 2/476 (0%)
 Frame = +3

Query  315   EKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             +K  V+WP+  N SL E+DPE+ +I+E EK+RQWKGLELIPSENFTS SVM A+GSVMTN
Sbjct  39    DKAHVTWPEACNKSLAEMDPEVNEIVEKEKSRQWKGLELIPSENFTSRSVMDALGSVMTN  98

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNE+ID  E+LCQ+RAL AF LDP KWGVNVQ LSGSP+NFQVYT L
Sbjct  99    KYSEGYPGARYYGGNEFIDQCETLCQQRALAAFHLDPEKWGVNVQSLSGSPANFQVYTGL  158

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             LKPHDRIM LDLPHGGHLSHG+QTDTKKISAVSIFFE+MPYRL+ESTG IDY+  +K AT
Sbjct  159   LKPHDRIMGLDLPHGGHLSHGFQTDTKKISAVSIFFESMPYRLDESTGLIDYESCDKLAT  218

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
              FRPKLIVAGASAY+RLYDY ++R + DK  A LLADMAHISGLVAA +IPSPFD+ADVV
Sbjct  219   AFRPKLIVAGASAYSRLYDYPKMRAIADKVGAFLLADMAHISGLVAAQMIPSPFDHADVV  278

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGL  1214
             TTTTHKSLRGPRGAMIFYRKG K V+K+G  ++YD E+KIN +VFPGLQGGPHNHTI GL
Sbjct  279   TTTTHKSLRGPRGAMIFYRKGQKGVDKKGNPIMYDLEEKINFSVFPGLQGGPHNHTIAGL  338

Query  1215  AVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSR  1394
             AVALKQA +P+++ YQ QV+ N    +  L + G ELVSGGT+NHLVL +L+  G+DGSR
Sbjct  339   AVALKQAMSPDFKKYQNQVMKNMVAMSDRLKKHGVELVSGGTDNHLVLADLRPLGVDGSR  398

Query  1395  VEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS  1574
             VE+VLE  HIA NKNTVPGD SAMVPGG+R+GTPALT+RGFVE DF +VA+     ++++
Sbjct  399   VERVLELAHIACNKNTVPGDKSAMVPGGLRLGTPALTTRGFVEADFERVADMVWKGIEIT  458

Query  1575  VKIKAATQGTKLKEF-VATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              K+K    G KLK+F VA   +      EI  L+ +VE +A QFPTIGF+K   KY
Sbjct  459   KKLK-EVHGPKLKDFRVALADAPPGKFPEIDALKSEVEAFAAQFPTIGFDKKDGKY  513



>gb|AAL33594.1| serine hydroxymethyltransferase [Zea mays]
Length=343

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/343 (93%), Positives = 336/343 (98%), Gaps = 0/343 (0%)
 Frame = +3

Query  471   AVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPS  650
             AVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSP+
Sbjct  1     AVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPA  60

Query  651   NFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDY  830
             NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISA SIFFETMPYRL+ESTG IDY
Sbjct  61    NFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISATSIFFETMPYRLDESTGLIDY  120

Query  831   DQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPS  1010
             DQL+KSA LFRPKLI+AGASAYARLYDYDR+RK+C KQKAILLADMAHISGLVAAGV+PS
Sbjct  121   DQLKKSAVLFRPKLIIAGASAYARLYDYDRMRKICTKQKAILLADMAHISGLVAAGVVPS  180

Query  1011  PFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGP  1190
             PFDYADVVTTTTHKSLRGPRGAMIFYRKGVKE+NKQGKEV+YD+EDKIN AVFPGLQGGP
Sbjct  181   PFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEINKQGKEVMYDFEDKINAAVFPGLQGGP  240

Query  1191  HNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK  1370
             HNHTITGLAVALKQATTPEYRAYQEQV+SNC+KFAQ+L+ KGYELVSGGT+NHLVLVNLK
Sbjct  241   HNHTITGLAVALKQATTPEYRAYQEQVISNCAKFAQSLISKGYELVSGGTDNHLVLVNLK  300

Query  1371  NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPA  1499
             NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPA
Sbjct  301   NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPA  343



>ref|XP_007510016.1| serine hydroxymethyltransferase [Bathycoccus prasinos]
 emb|CCO19131.1| serine hydroxymethyltransferase [Bathycoccus prasinos]
Length=521

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/479 (69%), Positives = 390/479 (81%), Gaps = 3/479 (1%)
 Frame = +3

Query  306   YEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSV  485
             Y K K  ++WPK  N  L+ VDPEI DIIE EK RQWKGLELIPSENFTS S+++A+GSV
Sbjct  43    YAKLKPGITWPKACNDDLKTVDPEIFDIIEREKERQWKGLELIPSENFTSASILEALGSV  102

Query  486   MTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVY  665
             MTNKYSEGYPGARYYGGNE+IDMAESLCQKRALEAF L+P +WGVNVQ LSGSP+NFQVY
Sbjct  103   MTNKYSEGYPGARYYGGNEWIDMAESLCQKRALEAFHLNPDEWGVNVQSLSGSPANFQVY  162

Query  666   TALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEK  845
             TALL P DRIM LDLPHGGHLSHG+QTD KKISA SI+F +MPYRL+ESTG IDY++L++
Sbjct  163   TALLNPGDRIMGLDLPHGGHLSHGFQTDAKKISATSIYFNSMPYRLDESTGLIDYEKLDE  222

Query  846   SATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYA  1025
              A  FRPK+I+AGASAY+R  DY R+RK CD  KA++LADMAHISGLVAA +IPSPF+YA
Sbjct  223   LAQAFRPKIIIAGASAYSRKIDYARMRKTCDDTKALMLADMAHISGLVAAKLIPSPFEYA  282

Query  1026  DVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHT  1202
             DVVTTTTHKSLRGPRGAMIFYRKG K VNK+ GK+++YDYE+KIN +VFPGLQGGPHNHT
Sbjct  283   DVVTTTTHKSLRGPRGAMIFYRKGKKGVNKKTGKDIMYDYEEKINFSVFPGLQGGPHNHT  342

Query  1203  ITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGI  1382
             I+GLAVALKQA T E+  YQ+QV+ N       L E G ++VS GT+NHLVL +L+  G+
Sbjct  343   ISGLAVALKQAQTQEFVKYQQQVMKNMVAMVDRLKEHGVKIVSEGTDNHLVLCDLRPFGV  402

Query  1383  DGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAA  1562
             DGSRVE+VLE  HIA NKNTVPGD SA+VPGG+R+GTPALT+RGF EEDFVKVA+Y    
Sbjct  403   DGSRVERVLELAHIACNKNTVPGDKSALVPGGLRLGTPALTTRGFTEEDFVKVADYIKKG  462

Query  1563  VKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             + +SV+I    +G K  +F   L+S +     IA L+ +VE  A++FPTIGF+K   KY
Sbjct  463   IDISVEISKEVEGKKFGDFKKVLESKEF--PAIAALKKEVETLAEEFPTIGFDKAEGKY  519



>ref|XP_005843102.1| serine hydroxymethyltransferase [Chlorella variabilis]
 gb|EFN51000.1| serine hydroxymethyltransferase [Chlorella variabilis]
Length=521

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/482 (69%), Positives = 388/482 (80%), Gaps = 14/482 (3%)
 Frame = +3

Query  318   KCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNK  497
             +  V+WP+ LN+ L EVDPE+ DIIE EK RQ+KGLELIPSENF S SVM+AVGSVMTNK
Sbjct  48    RKHVTWPRVLNSGLAEVDPELYDIIEHEKNRQYKGLELIPSENFVSASVMEAVGSVMTNK  107

Query  498   YSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALL  677
             YSEGYPGARYYGGNE+ID AE LCQKRALEAFRLDPAKWGVNVQ LSGSPSNFQVYTALL
Sbjct  108   YSEGYPGARYYGGNEFIDQAERLCQKRALEAFRLDPAKWGVNVQSLSGSPSNFQVYTALL  167

Query  678   KPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATL  857
             KPHDRIMALDLPHGGHLSHGYQTDTKKISA SIFFETMPYRL+ESTG IDYD +EK+ATL
Sbjct  168   KPHDRIMALDLPHGGHLSHGYQTDTKKISATSIFFETMPYRLDESTGIIDYDMMEKTATL  227

Query  858   FRPKLIVAGASAYARLYDYDRIRKVCDKQK-AILLADMAHISGLVAAGVIPSPFDYADVV  1034
             FRPKLIVAGASAY R YDY R+R V  +       A +   SG      +P     A VV
Sbjct  228   FRPKLIVAGASAYTRHYDYPRMRAVAGEPSWRPAGAALVFGSGQRQRWAVP-----AHVV  282

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQ-----GGPHNH  1199
             TTTTHKSLRGPRGAMIFYRKG K  +K+G  ++YD E  IN AVFPGLQ     GGPHNH
Sbjct  283   TTTTHKSLRGPRGAMIFYRKGQKGTDKKGNPIMYDLETPINFAVFPGLQASAGRGGPHNH  342

Query  1200  TITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG  1379
             TI+GLA ALKQATTPE++AYQEQVL N    A+ L ++G+ LVSGGT+NH+VL +L+ KG
Sbjct  343   TISGLACALKQATTPEFKAYQEQVLRNSQALAKGLQQRGFALVSGGTDNHIVLADLRPKG  402

Query  1380  IDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDA  1559
             +DGSRVE+VLE  HIAANKNTVPGDVSAMVPGG+RMG+PALTSRGF+E DF +VA++ D 
Sbjct  403   VDGSRVERVLELAHIAANKNTVPGDVSAMVPGGLRMGSPALTSRGFIEPDFEQVAQFVDR  462

Query  1560  AVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             AV+++  +K ++ G KLK+F   L+  + +   +  LR +VE++AKQFPT+GFEK TM+Y
Sbjct  463   AVQIAADLKKSS-GPKLKDFREALEKEEPV--ALGALRREVEDFAKQFPTVGFEKATMRY  519

Query  1740  KN  1745
             K+
Sbjct  520   KD  521



>ref|XP_005852729.1| glycine hydroxymethyltransferase [Nannochloropsis gaditana CCMP526]
 gb|EKU23102.1| glycine hydroxymethyltransferase [Nannochloropsis gaditana CCMP526]
 gb|EWM22099.1| serine hydroxymethyltransferase [Nannochloropsis gaditana]
Length=493

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/463 (68%), Positives = 374/463 (81%), Gaps = 1/463 (0%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             SW   LN  L+  DP++  IIE EK RQ + L LI SENFTS SV  A+GSVM+NKYSEG
Sbjct  32    SWATSLNEPLKTTDPDLHAIIEQEKVRQRESLVLIASENFTSKSVFDALGSVMSNKYSEG  91

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNE ID  ESLCQ+RAL AF LDPA+WGVNVQ LSGSP+NFQ YTA+L PHD
Sbjct  92    YPGARYYGGNENIDKVESLCQQRALAAFNLDPARWGVNVQTLSGSPANFQAYTAVLAPHD  151

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIMALDLPHGGHLSHGYQTD+KKISAVSIFFET PYRL+E TG IDYD++E++A LFRPK
Sbjct  152   RIMALDLPHGGHLSHGYQTDSKKISAVSIFFETFPYRLDERTGRIDYDKMEENAALFRPK  211

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             L+VAGASAYAR  DY+R+RK+ DK  A LL+DMAHISGLVAAG IPSPF ++D+VTTTTH
Sbjct  212   LLVAGASAYARTIDYERMRKIADKHNAYLLSDMAHISGLVAAGAIPSPFPHSDIVTTTTH  271

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIFYRKGV+ V K+G E+ YD E+KIN AVFPGLQGGPHNHTI  LA ALK
Sbjct  272   KSLRGPRGAMIFYRKGVRRVTKKGVEIPYDLEEKINFAVFPGLQGGPHNHTIAALATALK  331

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QA +PE++ YQEQVL N  + A+TL + GY LVSGGT+NHLVLV+LK + +DG+RVE+V+
Sbjct  332   QAASPEFKKYQEQVLQNSKRLAETLTKAGYSLVSGGTDNHLVLVDLKPQQVDGARVERVM  391

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             E  ++AANKNTVPGD SA+ PGGIR+G PALTSRGF EEDF +V  +FD AVK++ +IK 
Sbjct  392   ELANMAANKNTVPGDKSALTPGGIRIGCPALTSRGFTEEDFEQVGHFFDRAVKIAQEIKR  451

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGF  1718
              T G K+K+F   L+        +  L+ DV  +A++FPT+GF
Sbjct  452   ET-GPKIKDFKEALREGPGKHQALVDLKKDVVAFAQKFPTVGF  493



>emb|CDX90395.1| BnaA08g15890D [Brassica napus]
Length=350

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/350 (89%), Positives = 337/350 (96%), Gaps = 0/350 (0%)
 Frame = +3

Query  696   MALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLI  875
             MALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ+EKSATLFRPKLI
Sbjct  1     MALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQMEKSATLFRPKLI  60

Query  876   VAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKS  1055
             VAGASAYARLYDY RIRKVC+KQKA++LADMAHISGLVAAGVIPSPFDYADVVTTTTHKS
Sbjct  61    VAGASAYARLYDYARIRKVCNKQKAVMLADMAHISGLVAAGVIPSPFDYADVVTTTTHKS  120

Query  1056  LRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQA  1235
             LRGPRGAMIFYRKGVKE+NKQGKEVLYD+EDKINQAVFPGLQGGPHNHTITGLAVALKQA
Sbjct  121   LRGPRGAMIFYRKGVKEINKQGKEVLYDFEDKINQAVFPGLQGGPHNHTITGLAVALKQA  180

Query  1236  TTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLES  1415
             TT EY+AYQEQVLSN +KFAQTL+EKGYELVSGGT+NHLVLVNLK KGIDGSRVEKVLE+
Sbjct  181   TTSEYKAYQEQVLSNSAKFAQTLMEKGYELVSGGTDNHLVLVNLKPKGIDGSRVEKVLEA  240

Query  1416  VHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAAT  1595
             VHIA+NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDF KVAEYFD AV L++K+K+  
Sbjct  241   VHIASNKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAEYFDKAVTLALKVKSEA  300

Query  1596  QGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             QGTKLK+FV+ +++S  IQ+EIAKLRH+VEE+AKQFPTIGFEK TMKYKN
Sbjct  301   QGTKLKDFVSAMEASSTIQSEIAKLRHEVEEFAKQFPTIGFEKETMKYKN  350



>ref|XP_006675126.1| hypothetical protein BATDEDRAFT_15526 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83359.1| hypothetical protein BATDEDRAFT_15526 [Batrachochytrium dendrobatidis 
JAM81]
Length=505

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/472 (65%), Positives = 385/472 (82%), Gaps = 0/472 (0%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             + PK L++ L EVDP++ D+IELEK RQ   + LIPSENFTS SVM A+GS+M NKYSEG
Sbjct  34    TLPKILSSPLSEVDPDVFDLIELEKRRQRDSICLIPSENFTSSSVMGALGSIMQNKYSEG  93

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNE+ID AE LCQ RALEAF+LDPAKWGVNVQ LSG+P+N  VY+AL+KPH+
Sbjct  94    YPGARYYGGNEFIDRAERLCQARALEAFKLDPAKWGVNVQSLSGAPANLYVYSALMKPHE  153

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             R+M LDLPHGGHLSHGYQT  KKISAVS +FET+PYRLNE TG +D+D LEK+A L+RPK
Sbjct  154   RLMGLDLPHGGHLSHGYQTPAKKISAVSTYFETLPYRLNEETGVVDFDALEKTAILYRPK  213

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             +I+AGASAY R +DY R+RK+ D   A L++DMAHISG+VAAGV+PSPF+++D+VTTTTH
Sbjct  214   IIIAGASAYPRNWDYARMRKISDSVDAYLMSDMAHISGMVAAGVLPSPFEHSDIVTTTTH  273

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKG++ V+K+GKEV Y+ ED IN +VFPG QGGPHNHTIT LAVALK
Sbjct  274   KSLRGPRGAMIFFRKGIRSVDKKGKEVKYNLEDPINFSVFPGHQGGPHNHTITALAVALK  333

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QAT+PE++ YQ QVL NC    + L ++ Y +VSGGT++HL+L++L++K  DG+RVE++L
Sbjct  334   QATSPEFKEYQTQVLKNCKILEEELRKREYSMVSGGTDSHLLLIDLRSKKTDGARVERIL  393

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             E V+IA+NKNT+PGD SA+VP G+R+G+PA+T+RG VE DF  +AE  D AVK++V I  
Sbjct  394   ELVNIASNKNTIPGDKSALVPHGLRIGSPAMTTRGLVEADFANIAELIDRAVKITVDISN  453

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
               QGTKL +F AT+  +     EIAKLR DV  +A+ FP +GF++  MKY N
Sbjct  454   TIQGTKLSDFKATVGETGEAYPEIAKLREDVIAFARSFPAVGFKEAEMKYPN  505



>ref|XP_002959040.1| serine hydroxymethyltransferase [Volvox carteri f. nagariensis]
 gb|EFJ39901.1| serine hydroxymethyltransferase [Volvox carteri f. nagariensis]
Length=424

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/428 (74%), Positives = 364/428 (85%), Gaps = 5/428 (1%)
 Frame = +3

Query  465   MQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGS  644
             M+AVGSVMTNKYSEGYPGARYYGGNE+IDMAE LCQ RAL+AFRLDPA WGVNVQ LSGS
Sbjct  1     MEAVGSVMTNKYSEGYPGARYYGGNEFIDMAERLCQDRALKAFRLDPANWGVNVQSLSGS  60

Query  645   PSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYI  824
             P+NFQVYTALL+PHDRIMALDLPHGGHLSHGYQTDTKKISA SI+FE MPYRLNE TG I
Sbjct  61    PANFQVYTALLQPHDRIMALDLPHGGHLSHGYQTDTKKISATSIYFEQMPYRLNEETGLI  120

Query  825   DYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVI  1004
             DYD LE++A LFRPKLIVAGASAY R YDY R+R + DK  A LLADMAHISGLVAA ++
Sbjct  121   DYDMLERTAVLFRPKLIVAGASAYTRHYDYPRMRAIADKVGAWLLADMAHISGLVAADLV  180

Query  1005  PSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVN-KQGKEVLYDYEDKINQAVFPGLQ  1181
             PSPF YADVVTTTTHKSLRGPRGAMIF+R+GV+  + K GK V+YD EDKIN AVFPGLQ
Sbjct  181   PSPFGYADVVTTTTHKSLRGPRGAMIFFRRGVRRTDAKTGKPVMYDIEDKINFAVFPGLQ  240

Query  1182  GGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLV  1361
             GGPHNHTI+GLA ALKQA TPE+ AYQ+QVLSN    A+ + ++G++LVSGGT+NH+VLV
Sbjct  241   GGPHNHTISGLACALKQAATPEFVAYQKQVLSNSQALARGMAKRGHKLVSGGTDNHIVLV  300

Query  1362  NLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKV  1541
             +L+ KG+DGSRVE+VLE  HIAANKNTVPGD+SA+VPGG+RMG+PALTSRGFVE+DF +V
Sbjct  301   DLRPKGVDGSRVERVLELAHIAANKNTVPGDISALVPGGLRMGSPALTSRGFVEDDFEQV  360

Query  1542  AEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFE  1721
             AEY D AV ++V +K  +Q  KLKEF   L       AE+  L+ DVE +A +FPTIGFE
Sbjct  361   AEYVDRAVNIAVGLK--SQFPKLKEFREYLNKE--APAELTALKKDVETFAMRFPTIGFE  416

Query  1722  KHTMKYKN  1745
             K TM+YK+
Sbjct  417   KATMRYKH  424



>ref|XP_002177340.1| serine hydroxymethyltransferase [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC51803.1| serine hydroxymethyltransferase [Phaeodactylum tricornutum CCAP 
1055/1]
Length=501

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 377/467 (81%), Gaps = 1/467 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN +L E DPE++ +IE EKARQ   L LI SENFTS +V+ A+GSV++NKYSEGYPGAR
Sbjct  26    LNKTLLETDPELSQLIEQEKARQRNSLVLIASENFTSKAVLDALGSVLSNKYSEGYPGAR  85

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID  E LCQKRALEAF LDPA+WGVNVQ LSGSP+NFQVYTALL+ H RI+AL
Sbjct  86    YYGGNENIDQVELLCQKRALEAFHLDPAEWGVNVQSLSGSPANFQVYTALLETHARILAL  145

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKIS VS +FE+MPYRL+ESTG IDYDQ+EKSA LFRPK+IVAG
Sbjct  146   DLPHGGHLSHGYQTATKKISMVSRYFESMPYRLDESTGTIDYDQMEKSADLFRPKMIVAG  205

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY+RIRK+ D   A +++DMAHISGLVAA VIPS F+Y+DVVTTTTHKSLRG
Sbjct  206   ASAYSRLIDYERIRKIADGVGAYVMSDMAHISGLVAAQVIPSCFEYSDVVTTTTHKSLRG  265

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIFYRKG K  +K+G  ++YD E+KIN  VFPGLQGGPHNHTI  LA  LKQA T 
Sbjct  266   PRGAMIFYRKGQKGTDKKGNPIMYDLEEKINFTVFPGLQGGPHNHTIGALATCLKQAATA  325

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKG-IDGSRVEKVLESVH  1421
             ++  YQ+QVL N S+ A+ L + GY LVSGGT+NHLVL+++K+   IDG+RVE++LE   
Sbjct  326   DFVVYQKQVLKNSSRLAEELNKLGYTLVSGGTDNHLVLIDVKSSAKIDGARVERILELAC  385

Query  1422  IAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG  1601
             IA NKNTVPGD SA++PGGIRMGTPALTSRGF E+DF KVA +FD AVK++VK+K   QG
Sbjct  386   IATNKNTVPGDTSALMPGGIRMGTPALTSRGFKEDDFTKVAHFFDRAVKIAVKLKNTDQG  445

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
              KLK F        ++ A++ +LRHDV E+A  FPT+GF +  M ++
Sbjct  446   AKLKGFREMCAVGPSVDADLVQLRHDVSEFACLFPTVGFNEDEMTFE  492



>gb|ESA09573.1| hypothetical protein GLOINDRAFT_203282 [Rhizophagus irregularis 
DAOM 181602]
Length=504

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/465 (66%), Positives = 380/465 (82%), Gaps = 0/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  L E+DPE+ DIIE EK RQ + + LIPSENFTS +V++A+GS+M NKYSEGYPGAR
Sbjct  39    LNKHLSEIDPEVFDIIEKEKKRQRESIVLIPSENFTSRAVIEALGSIMQNKYSEGYPGAR  98

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQKRALEAF L  ++WGVNVQPLSGSP+N  VY A+LKPH+R+M L
Sbjct  99    YYGGNEFIDQAEILCQKRALEAFNLKDSEWGVNVQPLSGSPANLYVYNAILKPHERLMGL  158

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQTDTKKISAVS +FET+PYRLNE TG IDYD LE SA L+RPK+I+AG
Sbjct  159   DLPHGGHLSHGYQTDTKKISAVSSYFETLPYRLNEKTGIIDYDALEASAVLYRPKVIIAG  218

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY R YDY R++++ +K  A L+AD+AHISGL++AGV+PSPF++AD+VTTTTHKSLRG
Sbjct  219   ASAYPRNYDYARMKQITEKVNAYLIADIAHISGLISAGVLPSPFEFADIVTTTTHKSLRG  278

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGA+IFYRKGV++V+K+GKE+LYD E+ INQ+VFPG QGGPHNHTIT LAVALKQA +P
Sbjct  279   PRGALIFYRKGVRKVDKKGKEILYDLENPINQSVFPGHQGGPHNHTITALAVALKQAKSP  338

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ+QVL N   FA+   + GY LVSGGT+ HL+LV+LK+K IDG+RVE+VLE  +I
Sbjct  339   IFKEYQQQVLKNSLSFAEAFKKMGYNLVSGGTDTHLLLVDLKSKNIDGARVERVLELANI  398

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGD SA +PGG+R+GTPA+T+RG  E DF K+AE+ D  VKL+V IK    GT
Sbjct  399   AANKNTVPGDKSAFIPGGLRVGTPAMTTRGLNESDFEKIAEFIDRGVKLTVDIKKKVTGT  458

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             KL +F   L    + +  I  L+ +V  +AK+FPTIGF++  MKY
Sbjct  459   KLLDFKEHLGDHGSSEPLIKDLKDEVINFAKKFPTIGFDESEMKY  503



>ref|XP_002683182.1| hydroxymethyltransferase [Naegleria gruberi]
 gb|EFC50438.1| hydroxymethyltransferase [Naegleria gruberi]
Length=501

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/474 (67%), Positives = 384/474 (81%), Gaps = 17/474 (4%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W  QLNASL++VDPE+ DIIE EK RQ+KGL+LIPSENFTS +V+ A+GSVM NKYSEGY
Sbjct  41    WAAQLNASLKDVDPELFDIIEHEKNRQYKGLQLIPSENFTSKAVLDALGSVMQNKYSEGY  100

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PG RYYGGNEYIDM+ESLCQKRALEAF LDP +WGVNVQ LSGSP+NF VYTALL+PHDR
Sbjct  101   PGKRYYGGNEYIDMSESLCQKRALEAFNLDPKEWGVNVQSLSGSPANFYVYTALLQPHDR  160

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             I++LDLPHGGHLSHGYQT TKKISAVSI+FET+ YRLNE TG IDY ++E+ A  +RPKL
Sbjct  161   ILSLDLPHGGHLSHGYQTPTKKISAVSIYFETLGYRLNEETGLIDYAKMEELADYYRPKL  220

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             +VAGASAY+RL DY   RKVCDK  A L++DMAHISGLVAAGVIPSPF+++ VVTTTTHK
Sbjct  221   VVAGASAYSRLIDYAAFRKVCDKHNAYLVSDMAHISGLVAAGVIPSPFEHSHVVTTTTHK  280

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIFYRK ++ +           EDKIN AVFPG QGGPHNHTI+ LAVALK 
Sbjct  281   SLRGPRGAMIFYRKSIEGL-----------EDKINAAVFPGHQGGPHNHTISALAVALKM  329

Query  1233  ATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE  1412
             ATTPEY+ YQEQVL NC    + + + GY++VS GT+NHL+LV+L+NKG+DG+RVE VLE
Sbjct  330   ATTPEYKEYQEQVLKNCKVLTEEMKKLGYKIVSDGTDNHLLLVDLRNKGVDGARVEAVLE  389

Query  1413  SVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLS--VKIK  1586
                IA NKNTVPGD SAMVPGGIRMG+PALT+RGF+E DF +VA++    ++++   K++
Sbjct  390   RSSIAVNKNTVPGDKSAMVPGGIRMGSPALTTRGFLETDFAQVAQFVHEGIQIAQKTKVE  449

Query  1587  AATQG-TKLKEFVATL-QSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
                QG  K+K+F   L Q+ DA+   I +LR+ +E ++K FP+IGF+K  MKYK
Sbjct  450   LEKQGLKKVKDFKDHLDQNPDAVG--ITQLRNKIESFSKSFPSIGFDKEFMKYK  501



>gb|EXX50872.1| glycine hydroxymethyltransferase SHM2 [Rhizophagus irregularis 
DAOM 197198w]
Length=505

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/466 (66%), Positives = 380/466 (82%), Gaps = 1/466 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  L E+DPE+ DIIE EK RQ + + LIPSENFTS +V++A+GS+M NKYSEGYPGAR
Sbjct  39    LNKHLSEIDPEVFDIIEKEKKRQRESIVLIPSENFTSRAVIEALGSIMQNKYSEGYPGAR  98

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSG-SPSNFQVYTALLKPHDRIMA  701
             YYGGNE+ID AE LCQKRALEAF L  ++WGVNVQPLSG SP+N  VY A+LKPH+R+M 
Sbjct  99    YYGGNEFIDQAEILCQKRALEAFNLKDSEWGVNVQPLSGRSPANLYVYNAILKPHERLMG  158

Query  702   LDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVA  881
             LDLPHGGHLSHGYQTDTKKISAVS +FET+PYRLNE TG IDYD LE SA L+RPK+I+A
Sbjct  159   LDLPHGGHLSHGYQTDTKKISAVSSYFETLPYRLNEKTGIIDYDALEASAVLYRPKVIIA  218

Query  882   GASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLR  1061
             GASAY R YDY R++++ +K  A L+AD+AHISGL++AGV+PSPF++AD+VTTTTHKSLR
Sbjct  219   GASAYPRNYDYARMKQITEKVNAYLIADIAHISGLISAGVLPSPFEFADIVTTTTHKSLR  278

Query  1062  GPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             GPRGA+IFYRKGV++V+K+GKE+LYD E+ INQ+VFPG QGGPHNHTIT LAVALKQA +
Sbjct  279   GPRGALIFYRKGVRKVDKKGKEILYDLENPINQSVFPGHQGGPHNHTITALAVALKQAKS  338

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVH  1421
             P ++ YQ+QVL N   FA+   + GY LVSGGT+ HL+LV+LK+K IDG+RVE+VLE  +
Sbjct  339   PIFKEYQQQVLKNSLSFAEAFKKMGYNLVSGGTDTHLLLVDLKSKNIDGARVERVLELAN  398

Query  1422  IAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG  1601
             IAANKNTVPGD SA +PGG+R+GTPA+T+RG  E DF K+AE+ D  VKL+V IK    G
Sbjct  399   IAANKNTVPGDKSAFIPGGLRVGTPAMTTRGLNESDFEKIAEFIDRGVKLTVDIKKKVTG  458

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             TKL +F   L    + +  I  L+ +V  +AK+FPTIGF++  MKY
Sbjct  459   TKLLDFKEHLGDHGSSEPLIKDLKDEVINFAKKFPTIGFDESEMKY  504



>gb|EYU36434.1| hypothetical protein MIMGU_mgv1a0053861mg, partial [Erythranthe 
guttata]
Length=363

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/334 (90%), Positives = 320/334 (96%), Gaps = 0/334 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A  +K+  +++W KQLN  LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  30    QAASQKDTSRITWTKQLNEPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  89

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALE F+LDPAKWGVNVQ LSGSPSNF
Sbjct  90    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALETFQLDPAKWGVNVQSLSGSPSNF  149

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  150   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  209

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  210   LEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  269

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV+YDYED+INQAVFPGLQGGPHN
Sbjct  270   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVMYDYEDRINQAVFPGLQGGPHN  329

Query  1197  HTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQ  1298
             HTIT LAVALKQA TPEY+AYQEQVLSNCS FA+
Sbjct  330   HTITALAVALKQAMTPEYKAYQEQVLSNCSTFAK  363



>ref|XP_008866643.1| hypothetical protein H310_04194 [Aphanomyces invadans]
 gb|ETW05205.1| hypothetical protein H310_04194 [Aphanomyces invadans]
Length=497

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/476 (66%), Positives = 373/476 (78%), Gaps = 2/476 (0%)
 Frame = +3

Query  321   CQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKY  500
               + W K LN  L+E DPE+ DIIE EK RQ K L LI SENFTS +V  A+GSVM+NKY
Sbjct  23    ASLQWAKDLNKPLKESDPELFDIIEREKQRQRKCLSLIASENFTSRAVYDALGSVMSNKY  82

Query  501   SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLK  680
             SEGYPG RYYGGN+ ID AE LCQKRALEAF LDP  WGVNVQ LSGSP+NFQVYTALL+
Sbjct  83    SEGYPGQRYYGGNKIIDQAELLCQKRALEAFNLDPEVWGVNVQSLSGSPANFQVYTALLQ  142

Query  681   PHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             PHDRIM+LDLPHGGHLSHG+QT  KKISA SIFFE+MPYRL+  T  IDYD L K+A LF
Sbjct  143   PHDRIMSLDLPHGGHLSHGFQTGAKKISATSIFFESMPYRLDPDTDLIDYDSLAKNAELF  202

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLIVAG SAY+R  DY R++++     AILLADMAHISGLVAAGV+PSPF+YADVVTT
Sbjct  203   RPKLIVAGTSAYSRHIDYARMKEIAVANNAILLADMAHISGLVAAGVVPSPFEYADVVTT  262

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             TTHKSLRGPRGAMIFYRKG + V+K+GKE+ YD + +I+  VFPGLQGGPHNHTI+ LA 
Sbjct  263   TTHKSLRGPRGAMIFYRKGTQSVDKKGKEIKYDLQGRIDFTVFPGLQGGPHNHTISALAT  322

Query  1221  ALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRV  1397
             ALKQA TPE+ AYQ+QVL+N    AQ L++ GY+LVS GT+NHL LVNLK +KGIDG+RV
Sbjct  323   ALKQANTPEFVAYQKQVLANSKALAQRLLDIGYKLVSNGTDNHLSLVNLKSSKGIDGARV  382

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             E +LE V+I  NKNTVPGD SA+VPGG+R+G PALTSRG  EEDFV VA   +  V LSV
Sbjct  383   EFLLEEVNIVINKNTVPGDKSALVPGGMRLGAPALTSRGLTEEDFVTVANLINEGVDLSV  442

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              I  A +G KL++F   +++    +AEI  L   V  + + FPT+GFE+ +M YK+
Sbjct  443   SINKAVEGKKLQDFKNYVKNG-GHKAEIQALEEKVATFMRSFPTVGFEETSMVYKD  497



>ref|XP_005717158.1| serine hydroxymethyltransferase, cytosolic (glycine hydroxymethyltransferase) 
[Chondrus crispus]
 emb|CDF37339.1| serine hydroxymethyltransferase, cytosolic (glycine hydroxymethyltransferase) 
[Chondrus crispus]
Length=494

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/466 (67%), Positives = 376/466 (81%), Gaps = 2/466 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  L EVDPE+ DIIE EKARQ K ++LIPSENFTS +VM+AVGSVMTNKYSEGYPGAR
Sbjct  29    LNQPLSEVDPEMFDIIEHEKARQIKSIQLIPSENFTSRAVMEAVGSVMTNKYSEGYPGAR  88

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E LCQ+RALEAF + P  WGVNVQ LSGSPSN  VYTALLKPHDRI++L
Sbjct  89    YYGGNEFIDMSERLCQQRALEAFNVSPDDWGVNVQALSGSPSNLAVYTALLKPHDRILSL  148

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHG+ TD K++SA S+FFE+MPYRL+ESTG IDYD+LE+SA LFRPKLI+AG
Sbjct  149   DLPHGGHLSHGFMTDKKRVSATSLFFESMPYRLDESTGIIDYDKLEESAVLFRPKLIIAG  208

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+R YDY R+R + DK  A L AD+AHISGLVAAGV+PSPF+YADV+TTTTHK+LRG
Sbjct  209   ASAYSRHYDYPRMRAIADKVGAYLHADIAHISGLVAAGVVPSPFEYADVITTTTHKALRG  268

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGA+IF+RKG++ V+K+GKE++Y+ E+ IN AVFPGLQGGPHNHTI  LAVALKQA  P
Sbjct  269   PRGALIFFRKGLRSVDKKGKEIMYNLENPINSAVFPGLQGGPHNHTIAALAVALKQAKEP  328

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             E+ AYQE+VLSN    A  L+ KGYELVSGGT+NHL+LVNLK +G+DG+R E+VLE   I
Sbjct  329   EFVAYQEKVLSNSQVLANELMGKGYELVSGGTDNHLMLVNLKARGMDGARAERVLELAGI  388

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA-ATQG  1601
             A NKNTVPGD SA  PGGIRMGT A+T+RG  E DF ++A Y D  ++++ KIK     G
Sbjct  389   ALNKNTVPGDKSAFNPGGIRMGTHAMTTRGCEESDFQQIANYLDRGIEIAAKIKKDLGTG  448

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              K+  +   L +  A   EIA+L+ +VE ++  F  IGF++  M Y
Sbjct  449   VKMAAYREALDNG-AGATEIAELKGEVEAFSIGFEPIGFDRADMVY  493



>gb|KDO26013.1| serine hydroxymethyltransferase [Saprolegnia parasitica CBS 223.65]
Length=496

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/476 (65%), Positives = 375/476 (79%), Gaps = 2/476 (0%)
 Frame = +3

Query  321   CQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKY  500
               + W K +N  L+E DP + DIIE EK RQ   + LI SENFTS SV  A+GSVM+NKY
Sbjct  22    ASLQWAKDMNKPLKETDPVLFDIIEKEKQRQRNSVSLIASENFTSRSVYDALGSVMSNKY  81

Query  501   SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLK  680
             SEGYPG RYYGGN+YID AE LCQ+RAL+AF L+P +WGVNVQ LSGSP+NFQVYTALL+
Sbjct  82    SEGYPGQRYYGGNKYIDQAELLCQERALQAFNLNPEEWGVNVQSLSGSPANFQVYTALLQ  141

Query  681   PHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             PHDRIM+LDLPHGGHLSHG+QT TKKISA SIFFE+MPYR +ESTG IDYD LEK+A LF
Sbjct  142   PHDRIMSLDLPHGGHLSHGFQTGTKKISATSIFFESMPYRCDESTGLIDYDTLEKNAELF  201

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLIVAG SAYAR  DY R++++  +  AILLADMAHISGLVAAGV+PSPF+YADVVTT
Sbjct  202   RPKLIVAGTSAYARHIDYARMKQIAQQNNAILLADMAHISGLVAAGVVPSPFEYADVVTT  261

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             TTHKSLRGPRGAMIFYRKGV+ V+K+GKE++YD   +I+  VFPGLQGGPHNHTI+ LA 
Sbjct  262   TTHKSLRGPRGAMIFYRKGVQSVDKKGKEIMYDLASRIDFTVFPGLQGGPHNHTISALAT  321

Query  1221  ALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRV  1397
             AL QA +P + AYQ+QVL+N    A  L++KGY LVS GT+NHL LV+LK +KGIDGSRV
Sbjct  322   ALLQAQSPSFIAYQKQVLANSKALAGRLMDKGYTLVSNGTDNHLCLVDLKRSKGIDGSRV  381

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             E +LE+V++  NKNTVPGD SA+VPGG+R+G PALT+RG  EEDFV+VA+  D  V L+V
Sbjct  382   EFLLENVNMVINKNTVPGDKSALVPGGMRLGAPALTTRGLTEEDFVQVADLIDEGVNLAV  441

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              I     G K+++F   + + +A   E+  L   V  + + FPTIGFE+  M Y++
Sbjct  442   AISKKVTGKKVQDFKDYITAGNA-ATEVEALEAKVTSFMRSFPTIGFEEEDMTYRD  496



>ref|XP_008608875.1| serine hydroxymethyltransferase, mitochondrial [Saprolegnia diclina 
VS20]
 gb|EQC37942.1| serine hydroxymethyltransferase, mitochondrial [Saprolegnia diclina 
VS20]
Length=496

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 374/476 (79%), Gaps = 2/476 (0%)
 Frame = +3

Query  321   CQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKY  500
               + W K +N  L+E DP + DIIE EK RQ   + LI SENFTS SV  A+GSVM+NKY
Sbjct  22    ASLQWAKDMNKPLKETDPVLFDIIEKEKQRQRNSVSLIASENFTSRSVYDALGSVMSNKY  81

Query  501   SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLK  680
             SEGYPG RYYGGN+YID AE LCQ+RAL+AF L+P +WGVNVQ LSGSP+NFQVYTALL+
Sbjct  82    SEGYPGQRYYGGNKYIDQAELLCQERALQAFNLNPEEWGVNVQSLSGSPANFQVYTALLQ  141

Query  681   PHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             PHDRIM+LDLPHGGHLSHG+QT TKKISA SIFFE+MPYR +ESTG IDYD LEK+A LF
Sbjct  142   PHDRIMSLDLPHGGHLSHGFQTGTKKISATSIFFESMPYRCDESTGLIDYDTLEKNAELF  201

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLIVAG SAYAR  DY R++++  +  AILLADMAHISGLVAAGV+PSPF+YADVVTT
Sbjct  202   RPKLIVAGTSAYARHIDYARMKQIAQQNNAILLADMAHISGLVAAGVVPSPFEYADVVTT  261

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             TTHKSLRGPRGAMIFYRKGV+ V+K+GKE+ YD   +I+  VFPGLQGGPHNHTI+ LA 
Sbjct  262   TTHKSLRGPRGAMIFYRKGVQSVDKKGKEIKYDLASRIDFTVFPGLQGGPHNHTISALAT  321

Query  1221  ALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRV  1397
             AL QA +P + AYQ+QVL+N    A  L+EKGY LVS GT+NHL LV+LK +KGIDGSRV
Sbjct  322   ALLQAQSPSFIAYQKQVLANSKALAGRLMEKGYTLVSNGTDNHLCLVDLKRSKGIDGSRV  381

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             E +LE+V++  NKNTVPGD SA+VPGG+R+G PALT+RG  EEDFV+VA+  D  V L+V
Sbjct  382   EFLLENVNMVINKNTVPGDKSALVPGGMRLGAPALTTRGLTEEDFVQVADLIDEGVNLAV  441

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              I     G K+++F   + + +A   +I  L   V  + + FPTIGFE+  M Y++
Sbjct  442   AISKKVTGKKVQDFKDYITAGNA-ATDIEALEAKVTSFMRSFPTIGFEEEDMTYRD  496



>gb|ETI42217.1| hypothetical protein F443_12615 [Phytophthora parasitica P1569]
 gb|ETK82235.1| hypothetical protein L915_12346 [Phytophthora parasitica]
 gb|ETL35628.1| hypothetical protein L916_12262 [Phytophthora parasitica]
 gb|ETL88866.1| hypothetical protein L917_12102 [Phytophthora parasitica]
 gb|ETM42107.1| hypothetical protein L914_12186 [Phytophthora parasitica]
 gb|ETO70840.1| hypothetical protein F444_12720 [Phytophthora parasitica P1976]
 gb|ETP11953.1| hypothetical protein F441_12585 [Phytophthora parasitica CJ01A1]
Length=502

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/478 (65%), Positives = 378/478 (79%), Gaps = 5/478 (1%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + W   +N  L E DP++ DIIE EK RQ   + LI SEN TS+SV+ A+GSVM+NKYSE
Sbjct  25    LQWAAAMNKPLAESDPQLFDIIEREKQRQRDCISLIASENCTSVSVLDALGSVMSNKYSE  84

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH  686
             GYPG RYYGGN+ ID AE LC+ RALEAF LDP +WGVNVQ LSGSP+NFQVYTALL PH
Sbjct  85    GYPGQRYYGGNQIIDQAEELCRARALEAFNLDPEQWGVNVQSLSGSPANFQVYTALLAPH  144

Query  687   DRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRP  866
             DRIMALDLPHGGHLSHGYQ   KKISA SIFFE+MPYRL+ESTG IDYD LEK+A LFRP
Sbjct  145   DRIMALDLPHGGHLSHGYQLGRKKISATSIFFESMPYRLDESTGLIDYDGLEKTAALFRP  204

Query  867   KLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTT  1046
             KLIVAG SAY+R  DY R+R++CD+Q A+LLADMAHISGLVAAGV+PSPF+YADVVTTTT
Sbjct  205   KLIVAGTSAYSRSIDYARMREICDQQDAVLLADMAHISGLVAAGVVPSPFEYADVVTTTT  264

Query  1047  HKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             HKSLRGPRGAMIFYRKGV+ V+K+ GKEV+YD + KI+ AVFPGLQGGPHNHTI  L+ A
Sbjct  265   HKSLRGPRGAMIFYRKGVQSVDKKSGKEVMYDLQQKIDFAVFPGLQGGPHNHTIAALSTA  324

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVE  1400
             L QA +PE++AYQ QV++N       L+++GY++VS GT+NHL LV++ K++G+DG+RVE
Sbjct  325   LLQAQSPEFKAYQSQVIANSRAMVAELMKRGYDVVSNGTDNHLALVDVKKSRGVDGARVE  384

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
              VLES ++  NKNTVPGD SA VPGGIR+G PALT+RG  EEDF +VA + D  VKL+ +
Sbjct  385   FVLESANMVVNKNTVPGDKSAFVPGGIRLGAPALTTRGCTEEDFQQVAAFIDDGVKLTAE  444

Query  1581  I--KAATQGT-KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +  +A  QG  K+K+F   +      Q ++  L+ +V  + +QFPTIGF +  MKYK+
Sbjct  445   LNERARGQGVKKVKDFKDFVADDAEAQQKVDALKSEVTAFVRQFPTIGFSEEDMKYKD  502



>ref|XP_008908968.1| hypothetical protein PPTG_13257 [Phytophthora parasitica INRA-310]
 gb|ETN05904.1| hypothetical protein PPTG_13257 [Phytophthora parasitica INRA-310]
Length=502

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/478 (65%), Positives = 378/478 (79%), Gaps = 5/478 (1%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + W   +N  L E DP++ DIIE EK RQ   + LI SEN TS+SV+ A+GSVM+NKYSE
Sbjct  25    LQWAAAMNKPLAESDPQLFDIIEREKQRQRDCISLIASENCTSVSVLDALGSVMSNKYSE  84

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH  686
             GYPG RYYGGN+ ID AE LC+ RALEAF LDP +WGVNVQ LSGSP+NFQVYTALL PH
Sbjct  85    GYPGQRYYGGNQIIDQAEELCRARALEAFNLDPEQWGVNVQSLSGSPANFQVYTALLAPH  144

Query  687   DRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRP  866
             DRIMALDLPHGGHLSHGYQ   KKISA SIFFE+MPYRL+ESTG IDYD LEK+A LFRP
Sbjct  145   DRIMALDLPHGGHLSHGYQLGRKKISATSIFFESMPYRLDESTGLIDYDGLEKTAALFRP  204

Query  867   KLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTT  1046
             KLIVAG SAY+R  DY R+R++CD+Q A+LLADMAHISGLVAAGV+PSPF+YADVVTTTT
Sbjct  205   KLIVAGTSAYSRSIDYARMREICDQQDAVLLADMAHISGLVAAGVVPSPFEYADVVTTTT  264

Query  1047  HKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             HKSLRGPRGAMIFYRKGV+ V+K+ GKEV+YD + KI+ AVFPGLQGGPHNHTI  L+ A
Sbjct  265   HKSLRGPRGAMIFYRKGVQSVDKKSGKEVMYDLQQKIDFAVFPGLQGGPHNHTIAALSTA  324

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVE  1400
             L QA +PE++AYQ QV++N       L+++GY++VS GT+NHL LV++ K++G+DG+RVE
Sbjct  325   LLQAQSPEFKAYQSQVIANSRAMVAELMKRGYDVVSNGTDNHLALVDVKKSRGVDGARVE  384

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
              VLES ++  NKNTVPGD SA VPGGIR+G PALT+RG  EE+F +VA + D  VKL+ +
Sbjct  385   FVLESANMVVNKNTVPGDKSAFVPGGIRLGAPALTTRGCTEENFQQVAAFIDDGVKLTAE  444

Query  1581  I--KAATQGT-KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +  +A  QG  K+K+F   +      Q ++  L+ +V  + +QFPTIGF +  MKYKN
Sbjct  445   LNERARGQGVKKVKDFKDFVADDAEAQQKVDALKSEVTAFVRQFPTIGFSEEDMKYKN  502



>ref|XP_009534723.1| hypothetical protein PHYSODRAFT_361869 [Phytophthora sojae]
 gb|EGZ09862.1| hypothetical protein PHYSODRAFT_361869 [Phytophthora sojae]
Length=502

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/478 (65%), Positives = 376/478 (79%), Gaps = 5/478 (1%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + W   +N  L E DP + DIIE EK RQ   + LI SEN TS++V+ A+GSVM+NKYSE
Sbjct  25    LQWAAAMNKPLAESDPALFDIIEREKQRQRDCISLIASENCTSVAVLDALGSVMSNKYSE  84

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH  686
             GYPG RYYGGN+ ID AE LC+ RALE F LDP +WGVNVQ LSGSP+NFQVYTALL PH
Sbjct  85    GYPGQRYYGGNQIIDEAEELCRARALEVFNLDPEQWGVNVQSLSGSPANFQVYTALLAPH  144

Query  687   DRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRP  866
             DRIMALDLPHGGHLSHGYQ   KKISA SIFFE+MPYRL+ESTG IDYD LEKSA LFRP
Sbjct  145   DRIMALDLPHGGHLSHGYQLGRKKISATSIFFESMPYRLDESTGLIDYDGLEKSAALFRP  204

Query  867   KLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTT  1046
             +LIVAG SAY+R  DY R+R++CD+Q A+LLADMAHISGLVAAGV+PSPF+YADVVTTTT
Sbjct  205   RLIVAGTSAYSRHIDYARMREICDQQDAVLLADMAHISGLVAAGVVPSPFEYADVVTTTT  264

Query  1047  HKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             HKSLRGPRGAMIFYRKGV  V+K+ GKEV+YD + KI+ AVFPGLQGGPHNHTI  L+ A
Sbjct  265   HKSLRGPRGAMIFYRKGVHHVDKKSGKEVMYDLQQKIDFAVFPGLQGGPHNHTIAALSTA  324

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVE  1400
             L QA +PE++AYQ QV++N    A  L+E+GYE++S GT+NHL LV++ K++G+DG+RVE
Sbjct  325   LLQAQSPEFKAYQTQVINNSRALAGELMERGYEIISNGTDNHLALVDVKKSRGVDGARVE  384

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
              VLES ++  NKNTVP D SA VPGGIR+G PALT+RG  EEDF +VA + D  VKL+ +
Sbjct  385   FVLESANMVVNKNTVPSDKSAFVPGGIRLGAPALTTRGCTEEDFKQVAAFIDNGVKLTAE  444

Query  1581  I--KAATQGT-KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +  +A  QG  K+K+F   + +    + ++  L+ DV  + +QFPTIGF +  MKYKN
Sbjct  445   LNERARAQGMKKVKDFKDFVAADAEAKGQVDALKADVTAFVRQFPTIGFSEEDMKYKN  502



>gb|EYU36435.1| hypothetical protein MIMGU_mgv1a0053861mg, partial [Erythranthe 
guttata]
Length=346

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/322 (93%), Positives = 312/322 (97%), Gaps = 0/322 (0%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W KQLN  LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY
Sbjct  25    WTKQLNEPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  84

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGNEYIDMAE+LCQKRALE F+LDPAKWGVNVQ LSGSPSNFQVYTALLKPH+R
Sbjct  85    PGARYYGGNEYIDMAETLCQKRALETFQLDPAKWGVNVQSLSGSPSNFQVYTALLKPHER  144

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQLEKSA LFRPKL
Sbjct  145   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQLEKSAVLFRPKL  204

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF+YADVVTTTTHK
Sbjct  205   IVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPFEYADVVTTTTHK  264

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIF+RKGVKE+NKQGKEV+YDYED+INQAVFPGLQGGPHNHTIT LAVALKQ
Sbjct  265   SLRGPRGAMIFFRKGVKEINKQGKEVMYDYEDRINQAVFPGLQGGPHNHTITALAVALKQ  324

Query  1233  ATTPEYRAYQEQVLSNCSKFAQ  1298
             A TPEY+AYQEQVLSNCS FA+
Sbjct  325   AMTPEYKAYQEQVLSNCSTFAK  346



>gb|ETP40070.1| hypothetical protein F442_12532 [Phytophthora parasitica P10297]
Length=502

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/478 (65%), Positives = 377/478 (79%), Gaps = 5/478 (1%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + W   +N  L E DP++ DIIE EK RQ   + LI SEN TS+SV+ A+GSVM+NKYSE
Sbjct  25    LQWAAAMNKPLAESDPQLFDIIEREKQRQRDCISLIASENCTSVSVLDALGSVMSNKYSE  84

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH  686
             GYPG RYYGGN+ ID AE LC+ RALEAF LDP +WGVNVQ LSGSP+NFQVYTALL PH
Sbjct  85    GYPGQRYYGGNQIIDQAEELCRARALEAFNLDPEQWGVNVQSLSGSPANFQVYTALLAPH  144

Query  687   DRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRP  866
             DRIMALDLPHGGHLSHGYQ   KKISA SIFFE+MPYRL+ESTG IDYD LEK+A LFRP
Sbjct  145   DRIMALDLPHGGHLSHGYQLGRKKISATSIFFESMPYRLDESTGLIDYDGLEKTAALFRP  204

Query  867   KLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTT  1046
             KLIVAG SAY+R  DY R+R++CD+Q A+LLADMAHISGLVAAGV+PSPF+YADVVTTTT
Sbjct  205   KLIVAGTSAYSRSIDYARMREICDQQDAVLLADMAHISGLVAAGVVPSPFEYADVVTTTT  264

Query  1047  HKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             HKSLRGPRGAMIFYRKGV+ V+K+ GKEV+YD + KI+ AVFPGLQGGPHNHTI  L+ A
Sbjct  265   HKSLRGPRGAMIFYRKGVQSVDKKSGKEVMYDLQQKIDFAVFPGLQGGPHNHTIAALSTA  324

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVE  1400
             L QA +PE++AYQ QV++N       L++ GY++VS GT+NHL LV++ K++G+DG+RVE
Sbjct  325   LLQAQSPEFKAYQSQVIANSRAMVAELMKHGYDVVSNGTDNHLALVDVKKSRGVDGARVE  384

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
              VLES ++  NKNTVPGD SA VPGGIR+G PALT+RG  EEDF +VA + D  VKL+ +
Sbjct  385   FVLESANMVVNKNTVPGDKSAFVPGGIRLGAPALTTRGCTEEDFQQVAAFIDDGVKLTAE  444

Query  1581  I--KAATQGT-KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             +  +A  QG  K+K+F   +      Q ++  L+ +V  + +QFPTIGF +  MKYK+
Sbjct  445   LNERARGQGVKKVKDFKDFVADDAEAQQKVDALKSEVTAFVRQFPTIGFSEEDMKYKD  502



>emb|CEG84714.1| Putative Serine hydroxymethyltransferase [Rhizopus microsporus]
Length=496

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/465 (65%), Positives = 383/465 (82%), Gaps = 1/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE++DPE+ DIIE EK RQ + ++LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  33    LNERLEKIDPELFDIIENEKKRQKESVDLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  92

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E+LC+KRALEAF LD  KWGVNVQPLSG+P+N  VY ALLKPH+R+M L
Sbjct  93    YYGGNEFIDMSENLCRKRALEAFDLDSDKWGVNVQPLSGAPANLYVYGALLKPHERLMGL  152

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQ   KKIS VS +FET+PYRL+ESTG IDY+ LEK+A L+RPK+IVAG
Sbjct  153   DLPHGGHLSHGYQIPNKKISNVSAYFETLPYRLDESTGRIDYEALEKNAMLYRPKIIVAG  212

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R + DK  A L+AD+AHISGL+AAGV+P PF++AD+VTTTTHKSLRG
Sbjct  213   ASAYARNIDYARMRDIADKCGAYLMADIAHISGLIAAGVLPGPFEHADIVTTTTHKSLRG  272

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG++ V+K+G+E  YD E+ INQ+VFPG QGGPHNHTI+ LAVALKQ  +P
Sbjct  273   PRGAMIFFRKGLRSVDKKGRETYYDLENPINQSVFPGHQGGPHNHTISALAVALKQVKSP  332

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ+QVL N + FA+  ++  Y+LVSGGT+NHL+LV+L++KG+DG+RVE++LE V+I
Sbjct  333   LFKEYQQQVLKNNAAFAERFLQLNYDLVSGGTDNHLLLVDLRSKGVDGARVERILELVNI  392

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGD SA++PGG+R+GTPA+TSRG +E+DFVKVA++ D AV+++++ K    G 
Sbjct  393   AANKNTVPGDKSALIPGGLRIGTPAMTSRGLMEQDFVKVADFIDRAVQITLEEKKKVDGK  452

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             KL +F   +    AI + I  LR  V ++A +FPT+GF +  MK+
Sbjct  453   KLTDFKNHIGDGTAISS-ITDLRKGVIDFASEFPTVGFWESEMKF  496



>ref|XP_002998553.1| serine hydroxymethyltransferase, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY69906.1| serine hydroxymethyltransferase, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=502

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/482 (65%), Positives = 380/482 (79%), Gaps = 13/482 (3%)
 Frame = +3

Query  327   VSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSE  506
             + W   +N  L E DP++ DIIE EK RQ   + LI SEN TS++V+ A+GSVM+NKYSE
Sbjct  25    LQWSAAMNKPLSESDPQLFDIIEREKQRQRDCISLIASENCTSVAVLDALGSVMSNKYSE  84

Query  507   GYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPH  686
             GYPG RYYGGN+ ID AE LC+ RALEAF LDP +WGVNVQPLSGSP+NFQVYTALL PH
Sbjct  85    GYPGQRYYGGNQIIDQAEELCRARALEAFNLDPEQWGVNVQPLSGSPANFQVYTALLAPH  144

Query  687   DRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRP  866
             DRIMALDLPHGGHLSHGYQ   KKISA SIFFE+MPYRLNESTG IDYD LEK+A LFRP
Sbjct  145   DRIMALDLPHGGHLSHGYQLGRKKISATSIFFESMPYRLNESTGLIDYDGLEKTAALFRP  204

Query  867   KLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTT  1046
             KLIVAG SAY+R  DY R+R++CD+Q A+LLADMAHISGLVAAGV+PSPF+YADVVTTTT
Sbjct  205   KLIVAGTSAYSRSIDYARMREICDQQDAVLLADMAHISGLVAAGVVPSPFEYADVVTTTT  264

Query  1047  HKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVA  1223
             HKSLRGPRGAMIFYRKGV+ V+K+ GKEV+YD + KI+ AVFPGLQGGPHNHTI  L+ A
Sbjct  265   HKSLRGPRGAMIFYRKGVQHVDKKSGKEVMYDLQQKIDFAVFPGLQGGPHNHTIAALSTA  324

Query  1224  LKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVE  1400
             L QA + E++AYQ QV++N       L+++GY++VS GT+NHL LV++ K++G+DG+RVE
Sbjct  325   LLQAQSSEFKAYQTQVIANSRAMVSELMKRGYDVVSNGTDNHLALVDVKKSRGVDGARVE  384

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
              VLES ++  NKNTVPGD SA VPGGIR+G PAL++RG  EEDF +VA + D  VKL+ +
Sbjct  385   FVLESANMVVNKNTVPGDKSAFVPGGIRLGAPALSTRGCTEEDFQQVAAFIDDGVKLTAE  444

Query  1581  I--KAATQGTK----LKEFVA-TLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             +  +A  QG K     K+FVA   ++ D + A    L+ +V  + +QFPTIGF +  MKY
Sbjct  445   LNERARGQGVKKVKDFKDFVADDAEAKDKVDA----LKSEVTAFVRQFPTIGFSEEDMKY  500

Query  1740  KN  1745
             K+
Sbjct  501   KD  502



>emb|CEG73561.1| Putative Serine hydroxymethyltransferase [Rhizopus microsporus]
 emb|CEI90394.1| Putative Serine hydroxymethyltransferase [Rhizopus microsporus]
Length=496

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/465 (65%), Positives = 382/465 (82%), Gaps = 1/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE++DPE+ DIIE EK RQ + ++LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  33    LNERLEKMDPELFDIIENEKKRQKESVDLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  92

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E+LC+KRALEAF LD  KWGVNVQPLSG+P+N  VY ALLKPH+R+M L
Sbjct  93    YYGGNEFIDMSENLCRKRALEAFDLDSDKWGVNVQPLSGAPANLYVYGALLKPHERLMGL  152

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQ   KKIS VS +FET+PYRL+ESTG IDY+ LEK+A L+RPK+IVAG
Sbjct  153   DLPHGGHLSHGYQIPNKKISNVSAYFETLPYRLDESTGRIDYEALEKNAMLYRPKIIVAG  212

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R + DK  A L+AD+AHISGL+AAGV+P PF++AD+VTTTTHKSLRG
Sbjct  213   ASAYARNIDYARMRDIADKCGAYLMADIAHISGLIAAGVLPGPFEHADIVTTTTHKSLRG  272

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG++ V+K+G+E  YD E+ INQ+VFPG QGGPHNHTI+ LAVALKQ  +P
Sbjct  273   PRGAMIFFRKGLRSVDKKGRETYYDLENPINQSVFPGHQGGPHNHTISALAVALKQVKSP  332

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ+QVL N + FA+  ++  Y+LVSGGT+NHL+LV+L++KG+DG+RVE++LE V+I
Sbjct  333   LFKEYQQQVLKNNAAFAERFLQLNYDLVSGGTDNHLLLVDLRSKGVDGARVERILELVNI  392

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGD SA++PGG+R+GTPA+TSRG +E+DFVKVA++ D AV+++++ K    G 
Sbjct  393   AANKNTVPGDKSALIPGGLRIGTPAMTSRGLMEQDFVKVADFIDRAVQITLEEKKKVDGK  452

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             KL +F   +    AI + I  LR  V  +A +FPT+GF +  MK+
Sbjct  453   KLTDFKNHIGDGTAISS-ITDLRKSVINFASEFPTVGFWESEMKF  496



>emb|CBN75444.1| serine hydroxymethyltransferase 2 [Ectocarpus siliculosus]
Length=491

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/471 (66%), Positives = 368/471 (78%), Gaps = 3/471 (1%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             SW   +N  LEE DP++ DI+E EK RQ   L LI SENFTS SV  A+GS+M+NKYSEG
Sbjct  20    SWALAMNKPLEETDPDLFDIMEHEKVRQRDSLVLIASENFTSKSVYDALGSIMSNKYSEG  79

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPGARYYGGNE ID  ESLCQKRALEAF LDP  WGVNVQ LSGSP+NFQ YTA+L+PHD
Sbjct  80    YPGARYYGGNEQIDKVESLCQKRALEAFDLDPELWGVNVQTLSGSPANFQAYTAVLQPHD  139

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIM+LDLPHGGHLSHGYQTDTKKIS VS F+ET PYRL+ESTG IDYD +  +A LFRPK
Sbjct  140   RIMSLDLPHGGHLSHGYQTDTKKISMVSSFYETFPYRLDESTGQIDYDTMAANAKLFRPK  199

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             LIVAGASAY+R  DY R+++V D   A LL+DMAHISGLV+AGV+PSPF Y+D+VTTTTH
Sbjct  200   LIVAGASAYSRNIDYARMKEVADASGAWLLSDMAHISGLVSAGVVPSPFPYSDIVTTTTH  259

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIFYRKG +   K+G+ ++YD E KIN +VFPGLQGGPHNHTI  LA ALK
Sbjct  260   KSLRGPRGAMIFYRKGQRGTTKKGEPIMYDIESKINFSVFPGLQGGPHNHTIAALATALK  319

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNL-KNKGIDGSRVEKV  1406
             QA  PEY AYQ+QV+ N +  A+ L+  GY+LVSGGT+NHLVLV+L K+  IDG+RVE +
Sbjct  320   QAKAPEYVAYQKQVVKNSAAMAEKLIADGYQLVSGGTDNHLVLVDLKKSSNIDGARVELM  379

Query  1407  LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIK  1586
             LE V++A NKNTVPGD SA+ PGGIRMG PALTSRGF EEDF +VA +F   V L+ K+ 
Sbjct  380   LEVVNMATNKNTVPGDKSALTPGGIRMGAPALTSRGFTEEDFEQVAAFFHRGVTLAKKVA  439

Query  1587  AATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             A T   K+K +   L    +   EI +LR D+  +A+ FP IGF++ TM+Y
Sbjct  440   ADT--GKIKAYREALADGGSKYPEIKQLRDDINNFARTFPVIGFDQETMRY  488



>ref|XP_002295557.1| glycine or serine hydroxymethyltransferase, serine methylase 
[Thalassiosira pseudonana CCMP1335]
 gb|ACI64274.1| glycine or serine hydroxymethyltransferase, serine methylase 
[Thalassiosira pseudonana CCMP1335]
Length=531

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/467 (67%), Positives = 377/467 (81%), Gaps = 1/467 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  L +VDP ++ +IE EKARQ   L LI SENFTS +V+ A+GSV++NKYSEGYPGAR
Sbjct  56    LNQRLTQVDPTLSTLIEQEKARQRSSLVLIASENFTSRAVLDALGSVLSNKYSEGYPGAR  115

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID  E LCQ+RALE F L   +WGVNVQ LSGSP+NFQVYTALL+ HDRI++L
Sbjct  116   YYGGNENIDRVELLCQERALETFGLSGEEWGVNVQSLSGSPANFQVYTALLETHDRILSL  175

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHG+QT TKKISAVS +FE+MPYRLN +TG IDYD++E+SA LFRPKLIVAG
Sbjct  176   DLPHGGHLSHGFQTPTKKISAVSRYFESMPYRLNSTTGQIDYDEMERSAELFRPKLIVAG  235

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY+RIR++ DK  A ++ADMAHISGL+AA VIPS F YADVVTTTTHKSLRG
Sbjct  236   ASAYSRLIDYERIREIADKVGAYVMADMAHISGLIAAEVIPSCFPYADVVTTTTHKSLRG  295

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG K   K+G+ ++YD E+KIN AVFPGLQGGPHNHTI  LAVALKQA TP
Sbjct  296   PRGAMIFFRKGKKGETKKGEPIMYDLEEKINFAVFPGLQGGPHNHTIGALAVALKQANTP  355

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRVEKVLESVH  1421
             E+  YQ+QVL NC++    L   GYE+VSGGT+NHLVLVN+K +KGIDG+RVE+VLE   
Sbjct  356   EFVEYQKQVLKNCARLNSELQSLGYEIVSGGTDNHLVLVNVKSSKGIDGARVERVLELAC  415

Query  1422  IAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG  1601
             IA+NKNTVPGD SA+ PGGIRMGTPALTSRGF+EEDF KVA YFD AV ++ K+K   +G
Sbjct  416   IASNKNTVPGDTSALNPGGIRMGTPALTSRGFMEEDFAKVAHYFDRAVSIANKLKNTEEG  475

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYK  1742
              K+K F        ++  E+ +LR +V E+A  FPT+GFE+  M++K
Sbjct  476   KKMKGFREMCAVGPSVDPELVQLRKEVSEFASSFPTVGFEESEMEFK  522



>gb|EPB83205.1| serine hydroxymethyltransferase, mitochondrial [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=503

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/465 (65%), Positives = 379/465 (82%), Gaps = 1/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE++DPE+ DIIE EK RQ + ++LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  40    LNERLEKMDPEMFDIIEKEKKRQQESVDLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  99

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID +E+LC+KRALEAF LD  KWGVNVQPLSG+P+N  VY A++KPHDRIM L
Sbjct  100   YYGGNEFIDQSENLCRKRALEAFDLDSEKWGVNVQPLSGAPANLYVYGAIMKPHDRIMGL  159

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQ   KKIS VS +FET+PYRL+ESTG IDYD LEK+A L+RPK+IVAG
Sbjct  160   DLPHGGHLSHGYQIPNKKISQVSAYFETLPYRLDESTGRIDYDALEKNAILYRPKVIVAG  219

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R++ DK  A L+AD+AHISGL+AAGV+P PF+YAD+VTTTTHKSLRG
Sbjct  220   ASAYARNIDYARMREIADKCGAYLMADVAHISGLIAAGVLPGPFEYADIVTTTTHKSLRG  279

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG++ V+K+G+E  YD E+ INQ+VFPG QGGPHNHTI  L+VALKQ  +P
Sbjct  280   PRGAMIFFRKGLRSVDKKGRETHYDLENAINQSVFPGHQGGPHNHTIGALSVALKQVKSP  339

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ QVL N + FA  L +  Y+LVSGGT+NHL+LV+LK+KG+DG+RVE+VLE V+I
Sbjct  340   LFKEYQTQVLKNNAAFADRLNQLKYDLVSGGTDNHLLLVDLKSKGVDGARVERVLELVNI  399

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             ++NKNTVPGD SA++PGG+R+GTPA+TSRGF E DFVK+A++ D AVK++ + K    G 
Sbjct  400   SSNKNTVPGDKSALIPGGLRIGTPAMTSRGFKEADFVKIADFIDRAVKITQEEKGKAGGK  459

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             KL +F   +    AI + I +L+ +V ++A  FPT+GF +  MKY
Sbjct  460   KLADFKNHIGDGSAISS-IQELKKEVSDFASTFPTVGFWESEMKY  503



>gb|EIE82694.1| hypothetical protein RO3G_07399 [Rhizopus delemar RA 99-880]
Length=500

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/465 (64%), Positives = 382/465 (82%), Gaps = 1/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE++DPE+ DIIE EK RQ + + LIPSENFTS +VM A+GS+M NKYSEGYPGAR
Sbjct  36    LNERLEKMDPEMFDIIEKEKKRQKESIVLIPSENFTSRAVMDALGSIMQNKYSEGYPGAR  95

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E+LC+KRALEAF L   +WGVNVQPLSG+P+N  VY ALLKPH+RIM L
Sbjct  96    YYGGNEFIDMSENLCRKRALEAFDLKEDQWGVNVQPLSGAPANLYVYGALLKPHERIMGL  155

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQ  +KKIS+VS +FET+PYRL+ESTG IDYD LE+++ L+RPK+IVAG
Sbjct  156   DLPHGGHLSHGYQIPSKKISSVSAYFETLPYRLDESTGRIDYDTLEQNSMLYRPKIIVAG  215

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R++ DK  A L+AD+AHISGL+AA V+P PF++AD+VTTTTHKSLRG
Sbjct  216   ASAYARNIDYARMRQIADKCGAYLMADIAHISGLIAADVLPGPFEHADIVTTTTHKSLRG  275

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG++ V+K+GKE  YD E+ INQ+VFPG QGGPHNHTI+ L+VALKQ  +P
Sbjct  276   PRGAMIFFRKGLRSVDKKGKETFYDLENPINQSVFPGHQGGPHNHTISALSVALKQVKSP  335

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ QVL N + FA+  ++  Y+LVSGGT+NHL+LV+LK+KG+DG+RVE+VLE V+I
Sbjct  336   LFKEYQTQVLKNNAAFAERFLQLNYDLVSGGTDNHLLLVDLKSKGVDGARVERVLELVNI  395

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGD SA++PGG+R+GTPA+TSRG  E+DFVK+A++ D AV+++V+ K    G 
Sbjct  396   AANKNTVPGDKSALIPGGLRIGTPAMTSRGLKEDDFVKIADFIDRAVEITVEEKKKVDGK  455

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             KL +F   +    +IQ+ I  LR +V ++A  FPT+GF +  MKY
Sbjct  456   KLSDFKTHVNDGSSIQS-IQHLRANVSQFASAFPTVGFWESEMKY  499



>emb|CDS07753.1| hypothetical protein LRAMOSA01702 [Absidia idahoensis var. thermophila]
Length=502

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/465 (66%), Positives = 375/465 (81%), Gaps = 2/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE  DPE+  IIE EK RQ + + LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  38    LNEHLETEDPEMFKIIEGEKKRQRESICLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  97

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E LCQ+RALEAF LD  KWGVNVQ LSG+P+N  VY AL+KPHDR+M L
Sbjct  98    YYGGNEFIDMSEKLCQQRALEAFNLDSDKWGVNVQALSGAPANLYVYGALMKPHDRLMGL  157

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISAVS +FET PYRLNE TG IDYD LE +A L+RPK+IVAG
Sbjct  158   DLPHGGHLSHGYQTPTKKISAVSSYFETFPYRLNEKTGQIDYDALEANAILYRPKIIVAG  217

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R + DK  A L++DMAHISGLVAAGV+P PF+++D+VTTTTHKSLRG
Sbjct  218   ASAYARNIDYARMRDIADKTGAYLMSDMAHISGLVAAGVLPGPFEHSDIVTTTTHKSLRG  277

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRG+MIF+RKGV++ +K+G +++YD E+ INQ+VFPG QGGPHNHTI+ LAVALKQA +P
Sbjct  278   PRGSMIFFRKGVRKTDKKGNQIMYDLENPINQSVFPGHQGGPHNHTISALAVALKQAKSP  337

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQEQVLSN   FA+  +  GYELVSGGT+NHL+LVNLK K IDG+RVE++LE V+I
Sbjct  338   LFKEYQEQVLSNNQAFAKAFLNLGYELVSGGTDNHLLLVNLKPKSIDGARVERILELVNI  397

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG-  1601
             AANKNTVPGD SA++PGG+R+GTPA+TSRG  E DF KVA + D AV+++++ K+  QG 
Sbjct  398   AANKNTVPGDKSALIPGGLRIGTPAMTSRGLKESDFEKVASFIDRAVQIALEEKSKVQGS  457

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             TKL +F   +     I A I +L+ +V E++  FPT+GF +  MK
Sbjct  458   TKLVDFKKHVGDGQQIPA-IQELKKEVAEFSSSFPTVGFYESEMK  501



>emb|CDH48796.1| serine hydroxymethyltransferase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=502

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/465 (65%), Positives = 376/465 (81%), Gaps = 2/465 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE  DPE+  IIE EK RQ + + LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  38    LNEHLETEDPEMFKIIEGEKKRQRESICLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  97

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E LCQ+RALEAF LD  KWGVNVQ LSG+P+N  VY AL+KPHDR+M L
Sbjct  98    YYGGNEFIDMSERLCQQRALEAFNLDSDKWGVNVQALSGAPANLYVYGALMKPHDRLMGL  157

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISAVS +FET PYRLNE TG IDYD LE +A L+RPK+IVAG
Sbjct  158   DLPHGGHLSHGYQTPTKKISAVSSYFETFPYRLNEKTGQIDYDALEANAVLYRPKIIVAG  217

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR  DY R+R++ DK  A L++DMAHISGLVAAGV+P PF+++D+VTTTTHKSLRG
Sbjct  218   ASAYARNIDYARMREIADKTGAYLMSDMAHISGLVAAGVLPGPFEHSDIVTTTTHKSLRG  277

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRG+MIF+RKGV++ +K+G +++YD E+ INQ+VFPG QGGPHNHTI+ LAVALKQA +P
Sbjct  278   PRGSMIFFRKGVRKTDKKGNQIMYDLENPINQSVFPGHQGGPHNHTISALAVALKQAKSP  337

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQEQVL+N   FA+  +  GYELVSGGT+NHL+LVNLK K IDG+RVE++LE V+I
Sbjct  338   LFKEYQEQVLANNQAFAKAFLNLGYELVSGGTDNHLLLVNLKPKSIDGARVERILELVNI  397

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG-  1601
             AANKNTVPGD SA++PGG+R+GTPA+TSRG  + DF KVA + D AV+++++ K+  QG 
Sbjct  398   AANKNTVPGDKSALIPGGLRIGTPAMTSRGLKQSDFEKVASFIDRAVQIALEEKSKVQGS  457

Query  1602  TKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMK  1736
             TKL +F   +     I A I +L+ +V E++  FPT+GF +  MK
Sbjct  458   TKLADFKKHVGDGQQI-AAIQQLKKEVTEFSSSFPTVGFYESDMK  501



>ref|XP_009832078.1| hypothetical protein H257_08015 [Aphanomyces astaci]
 gb|ETV78495.1| hypothetical protein H257_08015 [Aphanomyces astaci]
Length=497

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 366/476 (77%), Gaps = 2/476 (0%)
 Frame = +3

Query  321   CQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKY  500
               + W K LN  L+E DP + DIIE EK RQ   L LI SENFTS +V  A+GSVM+NKY
Sbjct  23    ASLQWAKDLNKPLKETDPALFDIIEREKQRQRNCLSLIASENFTSRAVYDALGSVMSNKY  82

Query  501   SEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLK  680
             SEGYPG RYYGGN+ ID AE LCQKRALEAF+LDP  WGVNVQ LSGSP+NFQVYTALL+
Sbjct  83    SEGYPGQRYYGGNKIIDQAELLCQKRALEAFKLDPEVWGVNVQSLSGSPANFQVYTALLQ  142

Query  681   PHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             PHDRIM+LDLPHGGHLSHG+QT  KKISA SIFFE+MPYRL+  T  IDYD L  +A LF
Sbjct  143   PHDRIMSLDLPHGGHLSHGFQTGAKKISATSIFFESMPYRLDPKTDLIDYDSLATNAELF  202

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLIVAG SAY+R  DY R++++     AILLADMAHISGLVAAGV+PSPF+YADVVTT
Sbjct  203   RPKLIVAGTSAYSRHIDYARMKEIAVANNAILLADMAHISGLVAAGVVPSPFEYADVVTT  262

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             TTHKSLRGPRGAMIFYRKG + V+K+G E  YD + KI+ +VFPGLQGGPHNHTI+ LA 
Sbjct  263   TTHKSLRGPRGAMIFYRKGTQSVDKKGIETKYDLQGKIDFSVFPGLQGGPHNHTISALAT  322

Query  1221  ALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRV  1397
             ALKQA TPE+ AYQ+QVL+N    A  L++ GY LVS GT+NHL LVNLK +KGIDG+RV
Sbjct  323   ALKQANTPEFVAYQKQVLANSKALATRLMDIGYNLVSNGTDNHLSLVNLKSSKGIDGARV  382

Query  1398  EKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSV  1577
             E +LE V+I  NKNTVPGD SA+VPGG+R+G PALTSRG  EEDFV VA   +  V LSV
Sbjct  383   EFLLEEVNIVINKNTVPGDKSALVPGGMRLGAPALTSRGLTEEDFVTVANLINEGVDLSV  442

Query  1578  KIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              I  A  G K+++F  T   +   +AEI  L   V  + + FPT+GFE+ +M YK+
Sbjct  443   AISKAVTGKKVQDF-KTYVINGGHKAEIQALEEKVATFMRSFPTVGFEESSMVYKD  497



>ref|XP_005826504.1| hypothetical protein GUITHDRAFT_160011 [Guillardia theta CCMP2712]
 gb|EKX39524.1| hypothetical protein GUITHDRAFT_160011 [Guillardia theta CCMP2712]
Length=466

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/464 (64%), Positives = 380/464 (82%), Gaps = 10/464 (2%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             +W K     L+E+DPEI  +I+ E+ RQ +G+ LIPSEN+ SL+V QA+GSVMTNKYSEG
Sbjct  8     TWDK----PLQELDPEIHHLIQAEQNRQHRGIALIPSENYASLAVSQALGSVMTNKYSEG  63

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPG RYYGGNE ID  E+LC+ RAL AFRLDP +WGVNVQ LSGSP+NF VYTALL+PHD
Sbjct  64    YPGQRYYGGNEIIDKNENLCRARALSAFRLDPERWGVNVQALSGSPANFAVYTALLQPHD  123

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             RIM LDLPHGGHLSHG+ T TKKISA S++FE MPYRL+E TG IDYD+L ++A LFRPK
Sbjct  124   RIMGLDLPHGGHLSHGFSTPTKKISATSVYFEQMPYRLDEKTGLIDYDRLAENALLFRPK  183

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             +I+AGASAYAR Y+Y ++R++ D   A+LLADMAHISGLVAAG++P PF YAD+VTTTTH
Sbjct  184   IIIAGASAYARHYNYAKMREIADSVNAVLLADMAHISGLVAAGIVPDPFQYADIVTTTTH  243

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             KSLRGPRGAMIF+RKG K  +KQGK ++YDYE++INQAVFPGLQGGPHNHTI  LAVALK
Sbjct  244   KSLRGPRGAMIFFRKGEKSKDKQGKSIMYDYEERINQAVFPGLQGGPHNHTICALAVALK  303

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QA+TPE++AYQEQV+ N +  A+ L  +GY LVSGGTENHLVL++L++KG+DG+RVE++L
Sbjct  304   QASTPEFKAYQEQVIKNSAAMAKALTARGYNLVSGGTENHLVLIDLRDKGVDGARVERIL  363

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             E  +I  NKNTVPGD SA+VP G+R+G+PA+TSRG VE+DF ++  + D A+K+++++K+
Sbjct  364   ELCNIHCNKNTVPGDKSALVPHGLRVGSPAMTSRGLVEKDFEEIVGFVDRAIKITMELKS  423

Query  1590  ATQGTKLKEFVATLQSS--DAIQAEIAKLRHDVEEYAKQFPTIG  1715
             A    KLK+F A L +S  D+++     L  +V++++++FP  G
Sbjct  424   AHPEHKLKDFKALLDASPPDSLKT----LAKEVDQWSQKFPMPG  463



>emb|CCA16797.1| unnamed protein product [Albugo laibachii Nc14]
Length=510

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/476 (65%), Positives = 369/476 (78%), Gaps = 5/476 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W + LN  L   DP + DIIE EK RQ   L L+ SENFTS+SV+ A+GSV++NKYSEGY
Sbjct  35    WTRLLNEKLSVTDPTLNDIIEKEKKRQRDSLSLVASENFTSVSVLNALGSVLSNKYSEGY  94

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PG RYYGGN+YID  E LCQ RALEAF LD  +WGVNVQ LSGSP+NFQVYTALLKPHDR
Sbjct  95    PGHRYYGGNKYIDEIERLCQMRALEAFHLDDKRWGVNVQSLSGSPANFQVYTALLKPHDR  154

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTD KKISAVSI+FE+MPYRLN  T  IDY++LE++A LFRPKL
Sbjct  155   IMALDLPHGGHLSHGYQTDQKKISAVSIYFESMPYRLNLDTELIDYEKLEENAMLFRPKL  214

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAG SAY+R  DY R+R++CD+  AILLADMAHISGLVAA VIPSPF++ADVVTTTTHK
Sbjct  215   IVAGTSAYSRNIDYKRMREICDRCNAILLADMAHISGLVAAQVIPSPFEFADVVTTTTHK  274

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             SLRGPRGAMIFYR GVK+VNK+  E + YD ++KI+ +VFPGLQGGPHNHTI  LA ALK
Sbjct  275   SLRGPRGAMIFYRTGVKQVNKKTNEPIFYDLQEKIDFSVFPGLQGGPHNHTIAALATALK  334

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRVEKV  1406
             QA  PE+ AYQEQV+ N       L+  GY ++S GT+NHL LV++K ++GIDG+RVE +
Sbjct  335   QAQAPEFVAYQEQVIKNAKAVVDELMALGYYIISKGTDNHLALVDVKSSRGIDGARVEYL  394

Query  1407  LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIK  1586
             LESV++  NKNTVP D SA VP GIR+GTPALT+RGF E DFV+VA + D  V+L+V++ 
Sbjct  395   LESVNVVLNKNTVPNDTSAFVPSGIRIGTPALTTRGFTEADFVQVAHFIDEGVQLTVQLD  454

Query  1587  AATQGT---KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
             A  +     KLK+F   +Q       E  KLR  V ++A  +PTIGF +  MKYKN
Sbjct  455   AKARENGLKKLKDFKTFVQEDPHSVQETTKLRERVVQFANTYPTIGFSEADMKYKN  510



>emb|CCI42335.1| unnamed protein product [Albugo candida]
Length=480

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/475 (65%), Positives = 372/475 (78%), Gaps = 7/475 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W K LN  L   DP + DIIE EK RQ   L L+ SENFTS+SV+ A+G+V++NKYSEGY
Sbjct  5     WTKLLNEKLHVTDPILDDIIEKEKKRQRDSLSLVASENFTSVSVLNALGTVLSNKYSEGY  64

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PG RYYGGN+YID  E LCQ RALEAF LD  KWGVNVQ LSGSP+NFQVYTALLKPHDR
Sbjct  65    PGHRYYGGNKYIDEIERLCQTRALEAFHLDNEKWGVNVQSLSGSPANFQVYTALLKPHDR  124

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IM+LDLPHGGHLSHGYQTD KKISAVSI+FE+MPYRLN  TG IDYD+LE+SA LFRPKL
Sbjct  125   IMSLDLPHGGHLSHGYQTDQKKISAVSIYFESMPYRLNLDTGIIDYDKLEESALLFRPKL  184

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAG SAY+R  DY R+R++CD+  AILLADMAHISGLVAA VIPSPF++ADVVTTTTHK
Sbjct  185   IVAGTSAYSRNIDYKRMREICDRCNAILLADMAHISGLVAAQVIPSPFEFADVVTTTTHK  244

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             SLRGPRGAMIFY+ GVK+VNK+  E +LYD ++KI+ +VFPGLQGGPHNHTI  LA ALK
Sbjct  245   SLRGPRGAMIFYKTGVKQVNKKTNEPILYDLQEKIDFSVFPGLQGGPHNHTIAALATALK  304

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK-NKGIDGSRVEKV  1406
             QA  PE+ AYQ+QV+ N     + L+  GY ++S GT+NHL LV++K ++GIDG+RVE V
Sbjct  305   QAQMPEFVAYQQQVIKNAKAVVEELMSLGYRIISDGTDNHLALVDVKSSRGIDGARVEYV  364

Query  1407  LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIK  1586
             LE V++  NKNTVP D SA VP GIR+GTPALT+RGF E DFV+VA + D  V+L++++ 
Sbjct  365   LECVNVVLNKNTVPNDTSAFVPSGIRIGTPALTTRGFTETDFVQVAHFIDEGVQLTIELD  424

Query  1587  AATQGT---KLKEFVATLQ-SSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
             A  +     KLK+F   +Q  + A+QA   +LR  V  +A  FPTIGF +  MKY
Sbjct  425   AKARENGLKKLKDFKTFVQEDAQAVQA-TTELREKVVHFANTFPTIGFSESDMKY  478



>emb|CEJ01602.1| Putative Serine hydroxymethyltransferase [Rhizopus microsporus]
Length=457

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/458 (65%), Positives = 378/458 (83%), Gaps = 1/458 (0%)
 Frame = +3

Query  366   VDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEY  545
             +DPE+ DIIE EK RQ + ++LIPSENFTS +VM A+GSVM NKYSEGYPGARYYGGNE+
Sbjct  1     MDPELFDIIENEKKRQKESVDLIPSENFTSRAVMDALGSVMQNKYSEGYPGARYYGGNEF  60

Query  546   IDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGH  725
             IDM+E+LC+KRALEAF LD  KWGVNVQPLSG+P+N  VY ALLKPH+R+M LDLPHGGH
Sbjct  61    IDMSENLCRKRALEAFDLDSDKWGVNVQPLSGAPANLYVYGALLKPHERLMGLDLPHGGH  120

Query  726   LSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARL  905
             LSHGYQ   KKIS VS +FET+PYRL+ESTG IDY+ LEK+A L+RPK+IVAGASAYAR 
Sbjct  121   LSHGYQIPNKKISNVSAYFETLPYRLDESTGRIDYEALEKNAMLYRPKIIVAGASAYARN  180

Query  906   YDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF  1085
              DY R+R + DK  A L+AD+AHISGL+AAGV+P PF++AD+VTTTTHKSLRGPRGAMIF
Sbjct  181   IDYARMRDIADKCGAYLMADIAHISGLIAAGVLPGPFEHADIVTTTTHKSLRGPRGAMIF  240

Query  1086  YRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQE  1265
             +RKG++ V+K+G+E  YD E+ INQ+VFPG QGGPHNHTI+ LAVALKQ  +P ++ YQ+
Sbjct  241   FRKGLRSVDKKGRETYYDLENPINQSVFPGHQGGPHNHTISALAVALKQVKSPLFKEYQQ  300

Query  1266  QVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTV  1445
             QVL N + FA+  ++  Y+LVSGGT+NHL+LV+L++KG+DG+RVE+VLE V+IAANKNTV
Sbjct  301   QVLKNNAAFAERFLQLNYDLVSGGTDNHLLLVDLRSKGVDGARVERVLELVNIAANKNTV  360

Query  1446  PGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVA  1625
             PGD SA++PGG+R+GTPA+TSRG +E+DFVK+A++ D AV+++++ K    G KL +F  
Sbjct  361   PGDKSALIPGGLRIGTPAMTSRGLMEQDFVKIADFIDRAVQITLEEKKKVDGKKLTDFKN  420

Query  1626  TLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTMKY  1739
              +    AI + I  LR  V ++A +FPT+GF +  MK+
Sbjct  421   HIGDGTAISS-ITDLRKGVIDFASKFPTVGFWESEMKF  457



>ref|XP_005785878.1| hypothetical protein EMIHUDRAFT_429491 [Emiliania huxleyi CCMP1516]
 gb|EOD33449.1| hypothetical protein EMIHUDRAFT_429491 [Emiliania huxleyi CCMP1516]
Length=515

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/484 (65%), Positives = 369/484 (76%), Gaps = 11/484 (2%)
 Frame = +3

Query  324   QVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYS  503
              V +   LNASL E DP++ DI+E EK RQ   L LIPSENF S SV+ A+GSVM NKYS
Sbjct  32    NVPFATSLNASLAETDPQLFDIVEQEKRRQRCSLVLIPSENFASQSVLDALGSVMQNKYS  91

Query  504   EGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKP  683
             EGYP ARYYGGNEYIDMAE LC+ RALEAF + P  WGVNVQP SGSP+NF V++ALL+P
Sbjct  92    EGYPHARYYGGNEYIDMAEDLCRSRALEAFGVTPDAWGVNVQPHSGSPANFAVFSALLQP  151

Query  684   HDRIMALDLPHGGHLSHGYQTDT-KKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLF  860
             HDR+M LDLPHGGHLSHG+QT+T + IS VS +F +MPYRLNE+TG IDYD+LE+SAT+F
Sbjct  152   HDRLMGLDLPHGGHLSHGFQTETGRSISMVSRYFTSMPYRLNEATGIIDYDKLEESATIF  211

Query  861   RPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTT  1040
             RPKLI+AG SAY+R  DY R+R++CDK  A+LLADMAHISGLVAA V+PSP DYADVVTT
Sbjct  212   RPKLIIAGTSAYSRHIDYARMRQICDKVGAVLLADMAHISGLVAAKVVPSPLDYADVVTT  271

Query  1041  TTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAV  1220
             T HKSLRGPRGAMIFYRKGVK V+K+GKE+ Y+ E  INQAVFPG QGGPHNHTI  LA 
Sbjct  272   TRHKSLRGPRGAMIFYRKGVKGVDKKGKEIAYELEGPINQAVFPGHQGGPHNHTIAALAT  331

Query  1221  ALKQATTPEY---RAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK------N  1373
             ALKQA  PE+   RA  EQVL N ++FA  + E+GY LVSGGT+NHL+LV+LK       
Sbjct  332   ALKQAAAPEFPASRAPGEQVLRNSARFADAMSERGYSLVSGGTDNHLLLVDLKPWRDTSR  391

Query  1374  KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYF  1553
               IDG+RVE VLE  ++A NKNTVPGD SA +PGGIR+GTPALTSRGF EEDF  VAE+ 
Sbjct  392   TCIDGARVESVLELANVALNKNTVPGDKSAFIPGGIRVGTPALTSRGFAEEDFAAVAEFI  451

Query  1554  DAAVKLSVKIKAATQ-GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHT  1730
                V ++ +I  A   G KL +F A            + LR DVE +A QFP +GF++ T
Sbjct  452   HRGVGIAKEINGADGVGRKLADFKARPPHPAPASRPASSLRADVEAFASQFPVVGFDETT  511

Query  1731  MKYK  1742
             MKYK
Sbjct  512   MKYK  515



>ref|XP_005704469.1| glycine/serine hydroxymethyltransferase [Galdieria sulphuraria]
 gb|EME27949.1| glycine/serine hydroxymethyltransferase [Galdieria sulphuraria]
Length=500

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/477 (64%), Positives = 376/477 (79%), Gaps = 8/477 (2%)
 Frame = +3

Query  300   AVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVG  479
             AV    K QV  P  LN+SL++VD EI ++IE EK RQ +G++LIPSENFTS +V++A+G
Sbjct  28    AVDSGTKSQV--PNNLNSSLQQVDTEIFELIEQEKRRQTRGIQLIPSENFTSRAVLEAIG  85

Query  480   SVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQ  659
             S +TNKYSEGYPGARYYGGN++ID  ESLCQKRALEAF L+P +WGVNVQ LSGSP+N  
Sbjct  86    SCLTNKYSEGYPGARYYGGNQFIDQVESLCQKRALEAFHLNPEEWGVNVQALSGSPANLA  145

Query  660   VYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQL  839
             VYTALL+PHDRIM LDLPHGGHLSHG+ T  K++SA SIFFE+MPYRLNESTG IDYD+L
Sbjct  146   VYTALLRPHDRIMGLDLPHGGHLSHGFMTAKKRVSATSIFFESMPYRLNESTGLIDYDKL  205

Query  840   EKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFD  1019
             E++A LF PKLI+AG SAY+R YDY R+RK+ D+ ++ L+AD+AHISGLVAA V+PSPF 
Sbjct  206   EENAALFHPKLIIAGFSAYSRHYDYARMRKIADQNESYLMADIAHISGLVAADVVPSPFP  265

Query  1020  YADVVTTTTHKSLRGPRGAMIFYRKGVK--EVNKQGKEVLYDYEDKINQAVFPGLQGGPH  1193
             +ADVVTTTTHK+LRGPRGA+IFYRKGVK  + N   + + YD E+ IN AVFPGLQGGPH
Sbjct  266   FADVVTTTTHKALRGPRGALIFYRKGVKGYQKNNPKEPIYYDLENAINSAVFPGLQGGPH  325

Query  1194  NHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKN  1373
             NHTI  LAVALK ATT E++AYQ+QVL N  + A  L E+GY LVSGGT+NHL+LV+L+ 
Sbjct  326   NHTIGALAVALKLATTEEFKAYQQQVLKNSKRLATRLQERGYHLVSGGTDNHLLLVDLRP  385

Query  1374  KGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYF  1553
              G+DG+R E+VLE + IA NKNTVPGD SA  PGGIRMGT A+TSRG +E DF K+AE  
Sbjct  386   NGMDGARAERVLEMISIAVNKNTVPGDKSAFTPGGIRMGTHAMTSRGLLERDFDKIAELV  445

Query  1554  DAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEK  1724
             DA V L+ K+K  + G KLK+F   L++      EI  L+  VEE+A  F T+G+ K
Sbjct  446   DAGVLLAAKVKKNS-GPKLKDFKEALEN---YSNEIENLKQQVEEFAYSFDTVGYTK  498



>ref|XP_006379384.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
 gb|ERP57181.1| hypothetical protein POPTR_0008s00350g [Populus trichocarpa]
Length=379

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/339 (91%), Positives = 320/339 (94%), Gaps = 0/339 (0%)
 Frame = +3

Query  222   SSIEKPIKTlyngggslyymsslssEAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELE  401
             SS +KP++       SLYYMSSL  EAVYEKEK  V+WPKQLNA LE VDP+IADIIELE
Sbjct  14    SSFDKPLRPALFKATSLYYMSSLPDEAVYEKEKPGVTWPKQLNAPLEVVDPQIADIIELE  73

Query  402   KARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRA  581
             KARQWKGLELIPSENFTS+SVMQAVGSVMTNKYSEGYPGARYYGGNE+IDMAESLCQKRA
Sbjct  74    KARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEFIDMAESLCQKRA  133

Query  582   LEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKI  761
             LEAFRLDPAKWGVNVQ LSGSPSNFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKI
Sbjct  134   LEAFRLDPAKWGVNVQSLSGSPSNFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKI  193

Query  762   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDK  941
             SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDK
Sbjct  194   SAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDK  253

Query  942   QKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQG  1121
             QKAILLADMAHISGLVAAGVIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQG
Sbjct  254   QKAILLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQG  313

Query  1122  KEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             KEV YDYEDKINQAVFPGLQGGPHNHTI GLAVALKQ +
Sbjct  314   KEVFYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQVS  352



>emb|CEG73562.1| Putative Serine hydroxymethyltransferase [Rhizopus microsporus]
Length=514

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/483 (62%), Positives = 382/483 (79%), Gaps = 19/483 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN  LE++DPE+ DIIE EK RQ + ++LIPSENFTS +VM A+GSVM NKYSEGYPGAR
Sbjct  33    LNERLEKMDPELFDIIENEKKRQKESVDLIPSENFTSRAVMDALGSVMQNKYSEGYPGAR  92

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDM+E+LC+KRALEAF LD  KWGVNVQPLSG+P+N  VY ALLKPH+R+M L
Sbjct  93    YYGGNEFIDMSENLCRKRALEAFDLDSDKWGVNVQPLSGAPANLYVYGALLKPHERLMGL  152

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQ   KKIS VS +FET+PYRL+ESTG IDY+ LEK+A L+RPK+IVAG
Sbjct  153   DLPHGGHLSHGYQIPNKKISNVSAYFETLPYRLDESTGRIDYEALEKNAMLYRPKIIVAG  212

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHIS------------------GLVAAGVIPS  1010
             ASAYAR  DY R+R + DK  A L+AD+AHIS                  GL+AAGV+P 
Sbjct  213   ASAYARNIDYARMRDIADKCGAYLMADIAHISGKKKSAYYPAFFFNQNIIGLIAAGVLPG  272

Query  1011  PFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGP  1190
             PF++AD+VTTTTHKSLRGPRGAMIF+RKG++ V+K+G+E  YD E+ INQ+VFPG QGGP
Sbjct  273   PFEHADIVTTTTHKSLRGPRGAMIFFRKGLRSVDKKGRETYYDLENPINQSVFPGHQGGP  332

Query  1191  HNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLK  1370
             HNHTI+ LAVALKQ  +P ++ YQ+QVL N + FA+  ++  Y+LVSGGT+NHL+LV+L+
Sbjct  333   HNHTISALAVALKQVKSPLFKEYQQQVLKNNAAFAERFLQLNYDLVSGGTDNHLLLVDLR  392

Query  1371  NKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEY  1550
             +KG+DG+RVE++LE V+IAANKNTVPGD SA++PGG+R+GTPA+TSRG +E+DFVKVA++
Sbjct  393   SKGVDGARVERILELVNIAANKNTVPGDKSALIPGGLRIGTPAMTSRGLMEQDFVKVADF  452

Query  1551  FDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHT  1730
              D AV+++++ K    G KL +F   +    AI + I  LR  V  +A +FPT+GF +  
Sbjct  453   IDRAVQITLEEKKKVDGKKLTDFKNHIGDGTAISS-ITDLRKSVINFASEFPTVGFWESE  511

Query  1731  MKY  1739
             MK+
Sbjct  512   MKF  514



>ref|XP_010104572.1| Serine hydroxymethyltransferase [Morus notabilis]
 gb|EXC01173.1| Serine hydroxymethyltransferase [Morus notabilis]
Length=351

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/322 (91%), Positives = 307/322 (95%), Gaps = 0/322 (0%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W KQLN  LE +DPEIA+IIELEKARQWKG ELIPSENFTSLSVMQAVGSVMTNKYSEGY
Sbjct  29    WVKQLNDPLEVIDPEIANIIELEKARQWKGFELIPSENFTSLSVMQAVGSVMTNKYSEGY  88

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PGARYYGGNEYIDMAE+LCQKRALE F LDPAKWGVNVQ LSGSPSNFQVYTALLKPH+R
Sbjct  89    PGARYYGGNEYIDMAETLCQKRALETFNLDPAKWGVNVQSLSGSPSNFQVYTALLKPHER  148

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSA LFRPKL
Sbjct  149   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAALFRPKL  208

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             IVAGASAYARLYDY  IRKVCDKQKA++LAD+AHISGLVAAGVIPSPF+YADVVTTTTHK
Sbjct  209   IVAGASAYARLYDYAHIRKVCDKQKAVMLADIAHISGLVAAGVIPSPFEYADVVTTTTHK  268

Query  1053  SLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQ  1232
             SLRGPRGAMIFYRKGVKE+NK+G+EVLYDYEDKINQAVFPGLQGGPHNHTI GLAVALKQ
Sbjct  269   SLRGPRGAMIFYRKGVKEINKKGEEVLYDYEDKINQAVFPGLQGGPHNHTIAGLAVALKQ  328

Query  1233  ATTPEYRAYQEQVLSNCSKFAQ  1298
               TPE++AYQEQVL NC+KFAQ
Sbjct  329   VMTPEFKAYQEQVLKNCAKFAQ  350



>ref|XP_009776303.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Nicotiana sylvestris]
Length=319

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/319 (94%), Positives = 312/319 (98%), Gaps = 0/319 (0%)
 Frame = +3

Query  789   MPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADM  968
             MPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCDKQKAILLADM
Sbjct  1     MPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCDKQKAILLADM  60

Query  969   AHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYED  1148
             AHISGLVAAGVIPSPFDYA+VVTTTTHKSLRGPRGAMIF+RKGVKEVNKQGKEVLYDYED
Sbjct  61    AHISGLVAAGVIPSPFDYANVVTTTTHKSLRGPRGAMIFFRKGVKEVNKQGKEVLYDYED  120

Query  1149  KINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELV  1328
             KINQAVFPGLQGGPHNHTITGLAVALKQA TPEY+AYQEQVLSNCSKFAQ L+E GYELV
Sbjct  121   KINQAVFPGLQGGPHNHTITGLAVALKQAITPEYKAYQEQVLSNCSKFAQALMENGYELV  180

Query  1329  SGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTS  1508
             SGGTENHLVLVNLKNKGIDGSRVEK+LE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTS
Sbjct  181   SGGTENHLVLVNLKNKGIDGSRVEKILEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTS  240

Query  1509  RGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEE  1688
             RGFVEEDFVKVAE+FDAAVKL+VK+KA TQGTKLK+FVATLQSS  I++EIAKLRHDVEE
Sbjct  241   RGFVEEDFVKVAEFFDAAVKLAVKVKAETQGTKLKDFVATLQSSAPIKSEIAKLRHDVEE  300

Query  1689  YAKQFPTIGFEKHTMKYKN  1745
             YAKQFPTIGFEK TMKYKN
Sbjct  301   YAKQFPTIGFEKETMKYKN  319



>gb|KDO78681.1| hypothetical protein CISIN_1g018231mg [Citrus sinensis]
Length=359

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/315 (94%), Positives = 305/315 (97%), Gaps = 0/315 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  V+WPKQLNA LE VDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAV
Sbjct  7     EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAV  66

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWGVNVQ LSGSPSNF
Sbjct  67    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGVNVQSLSGSPSNF  126

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  127   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  186

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+KQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  187   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPF  246

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YDYE+KINQAVFPGLQGGPHN
Sbjct  247   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHN  306

Query  1197  HTITGLAVALKQATT  1241
             HTITGLAVALKQ  T
Sbjct  307   HTITGLAVALKQVCT  321



>gb|EWY91189.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
FOSC 3-a]
Length=518

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/471 (65%), Positives = 372/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKINAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGAMIFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGAMIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLTDLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L + +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGNGET-ESEIVQLRSEVEDWVGTYP  511



>ref|XP_002175037.2| serine hydroxymethyltransferase Shm2 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB08744.2| serine hydroxymethyltransferase Shm2 [Schizosaccharomyces japonicus 
yFS275]
Length=490

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/459 (64%), Positives = 363/459 (79%), Gaps = 6/459 (1%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             + + A LEE DPE++ I++ E+ARQ + + LI SENFTS +VM A+GS+M NKYSEGYPG
Sbjct  30    RMIQAPLEECDPEMSRILKSEEARQKQSIALIASENFTSRAVMDALGSIMQNKYSEGYPG  89

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID  E LCQKRALEA+RLDP +WGVNVQP SGSP+N QVY A+LKPH+R+M
Sbjct  90    ARYYGGNEFIDQGERLCQKRALEAYRLDPEQWGVNVQPHSGSPANLQVYQAVLKPHERLM  149

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHG+ T  K ISAVS +F TMPYR+N STG IDYD LE+   LFRPK+IV
Sbjct  150   GLDLPHGGHLSHGFSTPQKAISAVSTYFTTMPYRVNPSTGIIDYDTLEQDVQLFRPKVIV  209

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AGASAYARL DY+R+RK+ D   A L++DMAHISGLVAAGVIPSPF+Y+D+VTTTTHKSL
Sbjct  210   AGASAYARLIDYERMRKIADSVNAYLMSDMAHISGLVAAGVIPSPFEYSDIVTTTTHKSL  269

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYR+GV++ +K+G  V+YD EDKIN +VFPG QGGPHNHTI+ LAVAL QA 
Sbjct  270   RGPRGAMIFYRRGVRKHDKKGNAVMYDLEDKINFSVFPGHQGGPHNHTISALAVALGQAK  329

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESV  1418
             TPE+RAYQE VL N     +  + + YELVSGGT+ HLVLVNL +KGIDG+RVE+VLE +
Sbjct  330   TPEFRAYQESVLRNAKALERAFLARNYELVSGGTDTHLVLVNLTSKGIDGARVERVLELI  389

Query  1419  HIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQ  1598
             +I+ANKNTVPGD SA++P G+R+GTPA T+RGF E+DF +V +Y D AV L+ +I A  +
Sbjct  390   NISANKNTVPGDKSALIPHGLRLGTPACTTRGFNEQDFERVVDYIDQAVALTKQINADAK  449

Query  1599  GT---KLKEFVATLQSSDAIQ-AEIAKLRHDVEEYAKQF  1703
              T   KL +F   L   D  Q  EI +L+ ++  +A  F
Sbjct  450   KTGKNKLSDFKQFL--GDGSQYPEIQRLKSEIGSWASGF  486



>ref|XP_005537546.1| serine hydroxymethyltransferase, cytosolic [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM81510.1| serine hydroxymethyltransferase, cytosolic [Cyanidioschyzon merolae 
strain 10D]
Length=529

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/472 (62%), Positives = 369/472 (78%), Gaps = 8/472 (2%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LNASL EVDP+I +IIE EK RQW  + LIPSENF   +V++A+GS +TNKYSEG PGAR
Sbjct  61    LNASLAEVDPDIVEIIEREKQRQWSCVTLIPSENFAPRAVLEAIGSPLTNKYSEGRPGAR  120

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID +E LC +RALEAF LDP +WGV+VQ LSGSP+N  VYTALL+PHDRIMAL
Sbjct  121   YYGGNEWIDRSEMLCTQRALEAFSLDPERWGVDVQALSGSPANMAVYTALLRPHDRIMAL  180

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHG+ T  K++SA SIFFE+MPYRLNE+TG IDYD+LE+ A LFRP+L++AG
Sbjct  181   DLPHGGHLSHGFMTAKKRVSATSIFFESMPYRLNEATGRIDYDKLEELANLFRPRLLIAG  240

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RLYDY+R+RK+ D Q A LLAD+AHISGLVAAGVIPSPF+YADVVTTTTHK+LRG
Sbjct  241   ASAYSRLYDYERMRKIADSQGAYLLADIAHISGLVAAGVIPSPFEYADVVTTTTHKALRG  300

Query  1065  PRGAMIFYRKGVKEVN-KQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGVK  + K G    YD E+ I  AVFPGLQGGPHNHTI  LAVALK A +
Sbjct  301   PRGALIFYRKGVKSKDPKTGIIEEYDLENPIKNAVFPGLQGGPHNHTICALAVALKMAKS  360

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVH  1421
             PE++ YQ QVL+N    A+ L E+G  +VSGGT+NHL+L +L+++G+DG+R E+VLE   
Sbjct  361   PEFKEYQRQVLANAQALARGLTERGVSIVSGGTDNHLLLCDLRSRGLDGARAERVLELAD  420

Query  1422  IAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQG  1601
             I+ NKNTVPGD+SAM P GIRMG  A+T+RG  E+DF ++AE  D  +K++ ++K    G
Sbjct  421   ISLNKNTVPGDLSAMNPSGIRMGAHAMTTRGCTEKDFARIAELVDEGLKVTGELK-KIAG  479

Query  1602  TKLKEFVATLQSSDAIQA----EIAKLRHDVEEYAKQFPTIGFEKHTMKYKN  1745
              KLK+F A +  +D  +      + +LR  V  +A+QF  +G+    MKY++
Sbjct  480   PKLKDFRALM--ADGAEGTRFPSLLELRDKVHRFARQFDPVGWSISEMKYRD  529



>gb|EXM32275.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. vasinfectum 25433]
Length=518

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKINAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKTPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>gb|EMT63779.1| Putative serine hydroxymethyltransferase, mitochondrial [Fusarium 
oxysporum f. sp. cubense race 4]
 gb|EXM01247.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. cubense tropical race 4 54006]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKVNAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>gb|ENH62761.1| Putative serine hydroxymethyltransferase, mitochondrial [Fusarium 
oxysporum f. sp. cubense race 1]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKINAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>gb|EGU80240.1| hypothetical protein FOXB_09167 [Fusarium oxysporum Fo5176]
 gb|EWZ37795.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
Fo47]
 gb|EWZ89543.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. lycopersici MN25]
 gb|EXA45396.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. pisi HDV247]
 gb|EXK91346.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. raphani 54005]
 gb|EXL57268.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. radicis-lycopersici 26381]
 gb|EXL84481.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. conglutinans race 2 54008]
Length=518

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKINAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>ref|XP_002494026.1| Mitochondrial serine hydroxymethyltransferase [Komagataella pastoris 
GS115]
 emb|CAY71847.1| Mitochondrial serine hydroxymethyltransferase [Komagataella pastoris 
GS115]
 emb|CCA40551.1| glycine hydroxymethyltransferase [Komagataella pastoris CBS 7435]
Length=497

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/453 (63%), Positives = 363/453 (80%), Gaps = 0/453 (0%)
 Frame = +3

Query  357   LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYGG  536
             ++E+DPE+A I+E EK RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG RYYGG
Sbjct  43    VQEIDPEMAQILEGEKQRQKHSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGERYYGG  102

Query  537   NEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLPH  716
             NE+ID AESLCQKRALEAF LDPA+WGVNVQPLSG+P+N   Y+A+L+  DR+M LDLPH
Sbjct  103   NEWIDKAESLCQKRALEAFELDPAQWGVNVQPLSGAPANLYAYSAVLEVGDRLMGLDLPH  162

Query  717   GGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAY  896
             GGHLSHGYQT+  KIS +S +F+TMPYRL+E+TG IDYD LE SA LFRPK+IVAGASAY
Sbjct  163   GGHLSHGYQTNATKISYISKYFQTMPYRLDENTGLIDYDALETSAVLFRPKVIVAGASAY  222

Query  897   ARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGA  1076
             AR  DY R+R++ DK  A LL+DMAHISGLV+A V  SPF Y+D+VTTTTHKSLRGPRGA
Sbjct  223   ARTIDYKRMREIADKVGAYLLSDMAHISGLVSAKVTESPFPYSDIVTTTTHKSLRGPRGA  282

Query  1077  MIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRA  1256
             MIF+RKG+++V K+GKE+ Y+ E KIN +VFP  QGGPHNHTI+ LAVALKQ  TPE+ +
Sbjct  283   MIFFRKGIRKVTKKGKEIPYELERKINFSVFPAHQGGPHNHTISALAVALKQTQTPEFVS  342

Query  1257  YQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANK  1436
             YQ+ V+ N   FA++ +++G++LVSGGT+ HL+LV+L+NK IDG+RVE VLE ++IAANK
Sbjct  343   YQQAVVDNSKSFAESFIKRGFQLVSGGTDTHLILVDLRNKKIDGARVENVLEKINIAANK  402

Query  1437  NTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKE  1616
             NTVPGDVSA+ P G+R+GTPA+T+RGF   DF +VA YF+ AV +++ +K+  +G+  KE
Sbjct  403   NTVPGDVSALFPSGLRVGTPAMTTRGFTAADFDRVAGYFEKAVAIAIDLKSGEKGSLAKE  462

Query  1617  FVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
              +A+ +S     AEI KL  +V E+A  FP  G
Sbjct  463   KLASFKSLAEDSAEIKKLAQEVSEWASTFPVPG  495



>gb|KFH72243.1| glycine hydroxymethyltransferase [Mortierella verticillata NRRL 
6337]
Length=507

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/463 (63%), Positives = 365/463 (79%), Gaps = 1/463 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             LN SL++ DPE+ DIIE EK RQ + + LI SENFTS SVM A+GS++ NKYSEGYPGAR
Sbjct  40    LNRSLKDQDPEMFDIIEREKKRQRESIVLIASENFTSRSVMGALGSILQNKYSEGYPGAR  99

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE IDM+E LCQKRALEAF L+P +WGVNVQPLSG+P+N  VY AL+KPH+R+M L
Sbjct  100   YYGGNEQIDMSERLCQKRALEAFNLNPEEWGVNVQPLSGAPANLYVYGALMKPHERLMGL  159

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQTDTKKIS VS +FET PY++N+ TG IDYD LEK++ L+RPK+I+AG
Sbjct  160   DLPHGGHLSHGYQTDTKKISMVSSYFETFPYQINQETGVIDYDTLEKNSKLYRPKIIIAG  219

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY R  DY R+RK+ D   A L++DMAHISGLVAA V+ SPF Y+D+VTTTTHKSLRG
Sbjct  220   ASAYPREIDYVRMRKIADGCGAYLMSDMAHISGLVAADVLASPFPYSDIVTTTTHKSLRG  279

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGA+IFYRKGV+  +K+G +++YD E+ INQ+VFPG QGGPHNHTI  LAVALKQ  T 
Sbjct  280   PRGALIFYRKGVRGTDKKGNKIMYDLENPINQSVFPGHQGGPHNHTIAALAVALKQTKTE  339

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
              ++ YQ QVL+N   FA    + GY++ SGGT+ HL+LV+L++KGIDG+RVE+VLE V+I
Sbjct  340   TFKEYQHQVLANSKAFADAFTKLGYKMSSGGTDTHLILVDLRSKGIDGARVERVLELVNI  399

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             A+NKNTV GD SAM+PGGIR+GTPA+TSRG  E+DF K+A + D AV ++    +     
Sbjct  400   ASNKNTVAGDKSAMIPGGIRVGTPAMTSRGLDEKDFTKIAGFIDRAVLIAKDANSKVGSK  459

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKHTM  1733
             K+K+F   +     I  EI  LR +VEE+A++FPT+GF +  M
Sbjct  460   KVKDFKDFVADGKHI-PEIQALRKEVEEFARKFPTVGFSEDEM  501



>gb|EXK39849.1| serine hydroxymethyltransferase, mitochondrial [Fusarium oxysporum 
f. sp. melonis 26406]
Length=518

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/471 (64%), Positives = 370/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDYD+LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYDKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKTNAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKG +  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGERRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>ref|XP_005098438.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
[Aplysia californica]
Length=488

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/470 (61%), Positives = 363/470 (77%), Gaps = 6/470 (1%)
 Frame = +3

Query  324   QVSWPKQL---NASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTN  494
             +VSW + +      ++E DPEI  II+ EK RQ  GLELI SENF S +V++A+GS + N
Sbjct  19    RVSWARSVWTGQEGIQEDDPEIYSIIQKEKFRQANGLELIASENFASRAVLEALGSCLNN  78

Query  495   KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTAL  674
             KYSEGYPGARYYGGNE ID+ E LCQ RALEAFRLDPA+WGVNVQP SGSP+NF  +TAL
Sbjct  79    KYSEGYPGARYYGGNENIDVIERLCQSRALEAFRLDPARWGVNVQPYSGSPANFAAFTAL  138

Query  675   LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT  854
             L+PHDRIM LDLP GGHL+HG+ TDTK++SA S +FE+MPYRLN  TG IDYD+L ++A 
Sbjct  139   LEPHDRIMGLDLPDGGHLTHGFMTDTKRVSATSKYFESMPYRLNPQTGRIDYDKLFETAR  198

Query  855   LFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVV  1034
             LFRP++I+AG +AY+RL DY   R++CD+ KA +LADMAHISGLVAA VIPSPF+YADVV
Sbjct  199   LFRPRVIIAGTTAYSRLLDYKAFRQICDEVKAHMLADMAHISGLVAADVIPSPFEYADVV  258

Query  1035  TTTTHKSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITG  1211
             T+TTHK+LRGPR  +IFYRKGVK V+K+ GKE+LYDY+  +N AVFP LQGGPH H + G
Sbjct  259   TSTTHKTLRGPRSGLIFYRKGVKSVDKKTGKEILYDYDKTVNGAVFPALQGGPHQHQVAG  318

Query  1212  LAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGS  1391
             +AVALKQA  PEYR YQ+QVL N    +Q LV++GY +VSGGT+NHLVL++LK KG DG+
Sbjct  319   VAVALKQAMQPEYRVYQQQVLKNAKVMSQALVDRGYSVVSGGTDNHLVLIDLKPKGTDGA  378

Query  1392  RVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKL  1571
             RVE+VLE   I  NKNT  GD SAM+PGG+R+G PALT+RGF E DF +V    D  V+L
Sbjct  379   RVERVLELCFITVNKNTCAGDKSAMIPGGLRLGAPALTTRGFKESDFEQVVALLDKGVQL  438

Query  1572  SVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFE  1721
             +++ +  T+   L+EF A +   D  Q +IA L+ +V+ +AK F   GF+
Sbjct  439   TLEAQKTTK--TLREFKAFVLEDDETQKKIAALKEEVQNFAKTFSMPGFD  486



>gb|EWG39983.1| serine hydroxymethyltransferase, mitochondrial [Fusarium verticillioides 
7600]
Length=518

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRL+E+TGYIDY++LE+ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLDETTGYIDYNKLEEMASIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R+VCDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREVCDKISAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNPKTKEDILYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNARAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>gb|KDO78680.1| hypothetical protein CISIN_1g018231mg [Citrus sinensis]
Length=356

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/315 (93%), Positives = 302/315 (96%), Gaps = 3/315 (1%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             EAVYEKEK  V+WPKQLNA LE VDPEIADIIE EKARQWKGLELIPSENFTS+SVMQAV
Sbjct  7     EAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAV  66

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDP KWG +   LSGSPSNF
Sbjct  67    GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGS---LSGSPSNF  123

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ
Sbjct  124   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  183

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSATLFRPKLIVAGASAYARLYDY+RIRKVC+KQKAI+LADMAHISGLVAAGVIPSPF
Sbjct  184   LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPF  243

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV YDYE+KINQAVFPGLQGGPHN
Sbjct  244   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHN  303

Query  1197  HTITGLAVALKQATT  1241
             HTITGLAVALKQ  T
Sbjct  304   HTITGLAVALKQVCT  318



>gb|KGO39556.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
 gb|KGO62556.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
 gb|KGO64867.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
Length=528

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 364/471 (77%), Gaps = 17/471 (4%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L ASLEE DP +  I++ EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPG
Sbjct  51    KLLAASLEESDPAVYSILQKEKKRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPG  110

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID +E LCQ+RALE FRLDP +WGVNVQPLSGSP+N   Y+ALL  HDR+M
Sbjct  111   ARYYGGNEHIDASERLCQQRALETFRLDPEEWGVNVQPLSGSPANLMAYSALLNTHDRLM  170

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQT TKKISA+S +FET PYRL+ESTG IDYD LEKSATL+RPKLI+
Sbjct  171   GLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSATLYRPKLII  230

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AG SAY+RL DY R+R + D   A LL+DMAHISGLVAA V+PSPF Y+DVVTTTTHKSL
Sbjct  231   AGTSAYSRLIDYPRMRAIADSVGAYLLSDMAHISGLVAADVLPSPFPYSDVVTTTTHKSL  290

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYRKGV+  +K+G  V+YD E+ IN +VFPG QGGPHNHTIT LAVALKQA 
Sbjct  291   RGPRGAMIFYRKGVRSTDKKGNSVMYDLENPINASVFPGHQGGPHNHTITALAVALKQAQ  350

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             TP+++AYQE VL N S  A  L +       GY +VSGGT+NHLVLV+LKN+G+DG+RVE
Sbjct  351   TPDFKAYQETVLLNSSALAARLGDSTSNGGLGYNIVSGGTDNHLVLVDLKNRGVDGARVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE   +A+NKNTVPGD SA+ PGG+R+GTPA+TSRGF  EDF +VA+  D AV ++ K
Sbjct  411   RVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVADIVDRAVTITQK  470

Query  1581  I-KAATQGTK---------LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             + KAA +  +         +K F+  +   + I +EI  LR +VE++   F
Sbjct  471   LDKAARESAQSRSVKNPNTVKAFLEYVGEGEEI-SEIVVLRQEVEDWVGTF  520



>gb|EYU24308.1| hypothetical protein MIMGU_mgv1a0229941mg, partial [Erythranthe 
guttata]
Length=341

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 300/312 (96%), Gaps = 0/312 (0%)
 Frame = +3

Query  297   EAVYEKEKCQVSWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  476
             +A  +K+  +++W KQLN  LEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV
Sbjct  30    QAASQKDTSRITWTKQLNEPLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAV  89

Query  477   GSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNF  656
             GSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALE F+LDPAKWGVNVQ LSGSPSNF
Sbjct  90    GSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALETFQLDPAKWGVNVQSLSGSPSNF  149

Query  657   QVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  836
             QVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTGYIDYDQ
Sbjct  150   QVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTGYIDYDQ  209

Query  837   LEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPF  1016
             LEKSA LFRPKLIVAGASAYARLYDY RIRKVCDKQKA+LLADMAHISGLVAAGVIPSPF
Sbjct  210   LEKSAVLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVLLADMAHISGLVAAGVIPSPF  269

Query  1017  DYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHN  1196
             +YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEV+YDYED+INQAVFPGLQGGPHN
Sbjct  270   EYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVMYDYEDRINQAVFPGLQGGPHN  329

Query  1197  HTITGLAVALKQ  1232
             HTIT LAVALKQ
Sbjct  330   HTITALAVALKQ  341



>gb|KFP04745.1| hypothetical protein N300_00700, partial [Calypte anna]
Length=454

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/455 (63%), Positives = 357/455 (78%), Gaps = 3/455 (1%)
 Frame = +3

Query  354   SLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYG  533
             SL E DPE+ ++++ EK RQ +GLELI SENF S + ++A+GS + NKYSEGYPG RYYG
Sbjct  2     SLAESDPEMWNLVQKEKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYG  61

Query  534   GNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLP  713
             G E +D  E LC++RALEAF LDPA+WGVNVQP SGSP+NF  YTALL+PHDR+M LDLP
Sbjct  62    GAEVVDQIELLCEQRALEAFDLDPARWGVNVQPYSGSPANFAAYTALLQPHDRLMGLDLP  121

Query  714   HGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASA  893
              GGHL+HGY +D K+ISA SIFFE+MPY+LN +TG IDYDQLE +A LFRP+LI+AG SA
Sbjct  122   DGGHLTHGYMSDIKRISATSIFFESMPYKLNPATGLIDYDQLEVTARLFRPRLIIAGTSA  181

Query  894   YARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRG  1073
             YARL DY R++KVC++ KA LLADMAHISGLVAA VIPSPF++ADVVT+TTHK+LRG R 
Sbjct  182   YARLIDYSRMKKVCEEVKAYLLADMAHISGLVAAKVIPSPFEHADVVTSTTHKTLRGARS  241

Query  1074  AMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY  1250
              +IFYRKGV+ V+K+ GKE+LYD ED+IN +VFP LQGGPHNHTI  +AVALKQA++P +
Sbjct  242   GLIFYRKGVRSVDKKTGKEILYDLEDRINFSVFPALQGGPHNHTIAAVAVALKQASSPAF  301

Query  1251  RAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAA  1430
             R Y +QVL N    AQ L+++GY LVSGGT+NHLVLV+L+ KGIDG+R E+VLE V I A
Sbjct  302   RQYCQQVLKNAKAMAQALLQRGYTLVSGGTDNHLVLVDLRPKGIDGARAERVLELVSITA  361

Query  1431  NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKL  1610
             NKNT PGD SA+ PGG+R+G PALTSR F EEDF KV  + D  + L++ +K+ T   KL
Sbjct  362   NKNTCPGDKSALTPGGLRLGAPALTSRHFHEEDFQKVVAFIDEGIALALDVKSKT--NKL  419

Query  1611  KEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
             ++F   L      Q  +A LR  VE +A+ FP  G
Sbjct  420   QDFKTFLLQDLETQQRLADLRQRVETFARAFPMPG  454



>gb|ESX01441.1| Serine hydroxymethyltransferase, mitochondrial [Ogataea parapolymorpha 
DL-1]
Length=486

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 367/457 (80%), Gaps = 0/457 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             ++ +LEEVD E+ DI++ EKARQ   + LIPSENFTS +VM  +GS M NKYSEGYPG R
Sbjct  28    ISKNLEEVDAEMYDILQKEKARQKNSITLIPSENFTSRAVMDILGSEMQNKYSEGYPGER  87

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+IDMAESLCQ+RAL+AF LDPA+WGVNVQPLSG+P+N   Y+A+L+  DR+M L
Sbjct  88    YYGGNEFIDMAESLCQQRALKAFGLDPAQWGVNVQPLSGAPANLYAYSAVLEVGDRLMGL  147

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT + KIS +S +F+TMPYRL+E TG IDYD LEK+A LFRPK+IVAG
Sbjct  148   DLPHGGHLSHGYQTASTKISYISKYFQTMPYRLDEKTGLIDYDTLEKTAVLFRPKVIVAG  207

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAYAR+ DY R++++ DK  A L++DMAHISGLVAAGV  SPF Y+D+VTTTTHKSLRG
Sbjct  208   ASAYARVVDYARMKQIADKVGAYLMSDMAHISGLVAAGVTDSPFPYSDIVTTTTHKSLRG  267

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG+++V K+GKE+ Y+ E KIN +VFP  QGGPHNHTI+ L+VALKQA TP
Sbjct  268   PRGAMIFFRKGIRKVTKKGKEIPYELEKKINFSVFPAHQGGPHNHTISALSVALKQAMTP  327

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             EY+ YQ  V+SN + FAQ L EKG +LVSGGT+ HL+L++L++KGIDG+RVE VLE  +I
Sbjct  328   EYKQYQADVVSNAAYFAQALQEKGLDLVSGGTDTHLILIDLRSKGIDGARVEAVLERANI  387

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGD+SA+ P G+R+GTPA+T+RGF++ +F KVA++ + A+K+++ +KA   G 
Sbjct  388   AANKNTVPGDISALFPSGLRVGTPAMTTRGFLKPEFAKVADFIEEAIKIAIDLKAKETGA  447

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
               KE +A  +   +    + +L   V+E+  Q+P  G
Sbjct  448   SPKEKLADFKRLASESDAVKQLGAKVQEFVSQYPVPG  484



>ref|XP_003612955.1| Serine hydroxymethyltransferase [Medicago truncatula]
Length=319

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/317 (91%), Positives = 307/317 (97%), Gaps = 0/317 (0%)
 Frame = +3

Query  789   MPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADM  968
             MPYRL+ESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDY RIRKVCDKQKA++LADM
Sbjct  1     MPYRLDESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYARIRKVCDKQKAVMLADM  60

Query  969   AHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVLYDYED  1148
             AHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIF+RKG+KEVNKQGKEV YDYED
Sbjct  61    AHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGLKEVNKQGKEVFYDYED  120

Query  1149  KINQAVFPGLQGGPHNHTITGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELV  1328
             KINQAVFPGLQGGPHNHTITGLAVALKQATTPEY+AYQEQVLSNC+KFAQ L EKGYELV
Sbjct  121   KINQAVFPGLQGGPHNHTITGLAVALKQATTPEYKAYQEQVLSNCAKFAQALSEKGYELV  180

Query  1329  SGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTS  1508
             SGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGTPALTS
Sbjct  181   SGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTS  240

Query  1509  RGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEE  1688
             RGFVEEDFVKVAEYFDA+V L++KIKA ++GTKLK+FV TLQSS  +Q+EI+KLRHDVEE
Sbjct  241   RGFVEEDFVKVAEYFDASVNLALKIKAESKGTKLKDFVETLQSSSYVQSEISKLRHDVEE  300

Query  1689  YAKQFPTIGFEKHTMKY  1739
             +AKQFPTIGFEK +MKY
Sbjct  301   FAKQFPTIGFEKSSMKY  317



>ref|XP_003126345.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoformX1 [Sus scrofa]
 ref|XP_003355531.2| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X1 [Sus scrofa]
 ref|XP_005663969.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X3 [Sus scrofa]
 ref|XP_005663975.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X4 [Sus scrofa]
Length=483

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/466 (63%), Positives = 357/466 (77%), Gaps = 5/466 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W  Q   SL + DPE+ +++  EK RQ +GLELI SENF S + ++A+GS + NKYSEGY
Sbjct  22    WSGQ--ESLSDSDPEMWELLRREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGY  79

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PG RYYGG E +D  E LCQ+RALEAF LDPA+WGVNVQP SGSP+N   YTALL+PHDR
Sbjct  80    PGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDR  139

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IM LDLP GGHL+HGY TD K+ISA SIFFE+MPY+LN  TG IDYDQL  +A LFRP+L
Sbjct  140   IMGLDLPDGGHLTHGYMTDVKRISATSIFFESMPYKLNPKTGLIDYDQLALTARLFRPRL  199

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             I+AG SAYARL DY R+R+VCD+ KA LLADMAHISGLVAA VIPSPF++ADVVTTTTHK
Sbjct  200   IIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFEHADVVTTTTHK  259

Query  1053  SLRGPRGAMIFYRKGVKEVN-KQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             +LRG R  +IFYRKGV+ V+ K G+E+ Y +ED+IN AVFP LQGGPHNH I  +AVALK
Sbjct  260   TLRGARSGLIFYRKGVRTVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALK  319

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QA TP +R Y  QVL N    A  L+E+GY LVSGGT+NHLVLV+L+ KG+DG+RVE+VL
Sbjct  320   QACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARVERVL  379

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             E V I ANKNT PGD SA+ PGG+R+GTPALTSR F E+DF KV  + D  V + +++K+
Sbjct  380   ELVSITANKNTCPGDRSAITPGGLRLGTPALTSRQFREDDFRKVVAFIDEGVSIGLEVKS  439

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKH  1727
              T  TKL++F + L         +A LR  VE++A+ FP  GFE+H
Sbjct  440   KT--TKLQDFKSFLLKDPETCRRLADLRQRVEQFARAFPMPGFEEH  483



>gb|ESU16513.1| serine hydroxymethyltransferase [Fusarium graminearum PH-1]
 gb|EYB22206.1| hypothetical protein FG05_09873 [Fusarium graminearum]
 emb|CEF75168.1| unnamed protein product [Fusarium graminearum]
Length=518

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLNKADPAVFDIIEKEKNRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID +E LCQ+RALE+F LDP +WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQSERLCQQRALESFGLDPKQWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRLNE+TGYIDY++L++ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTLTKKISAISKYFETLPYRLNETTGYIDYEKLDEVASVYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF +AD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKVNAYLLADIAHISGLVAAKVIPGPFAHADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGAMIFYRKG++  + + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGAMIFYRKGIRRQHPKTKEDILYDLEGPINNSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK  GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPHGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTIASRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  Q+EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGDKSPGKIKVFLEHLGDGET-QSEIVQLRSEVEDWVGTYP  511



>ref|XP_010285381.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial, partial 
[Phaethon lepturus]
Length=466

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/467 (62%), Positives = 359/467 (77%), Gaps = 5/467 (1%)
 Frame = +3

Query  330   SWPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEG  509
             SW  Q   SL E DPE+  +++ EK RQ +GLELI SENF S + ++A+GS + NKYSEG
Sbjct  4     SWTGQ--ESLAESDPEMWTLVQKEKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEG  61

Query  510   YPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHD  689
             YPG RYYGG E +D  E LC++RALEAF LDPA+WGVNVQP SGSP+NF  YTALL+PHD
Sbjct  62    YPGKRYYGGAEVVDQIELLCEQRALEAFDLDPARWGVNVQPYSGSPANFAAYTALLQPHD  121

Query  690   RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK  869
             R+M LDLP GGHL+HGY +D K+ISA SIFFE+MPY+L+ +TG IDYDQLE +A LFRP+
Sbjct  122   RLMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLDPATGLIDYDQLEVTARLFRPR  181

Query  870   LIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTH  1049
             L++AG SAYARL DY R++KVC++ KA LLADMAHISGLVAA  IPSPF++AD+VT+TTH
Sbjct  182   LVIAGTSAYARLIDYARMKKVCEEVKAYLLADMAHISGLVAAKAIPSPFEHADLVTSTTH  241

Query  1050  KSLRGPRGAMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVAL  1226
             K+LRG R  +IFYRKGV+ V+K+ GKE LYD ED+IN AVFP LQGGPHNH I  +AVAL
Sbjct  242   KTLRGARSGLIFYRKGVRSVDKKTGKETLYDLEDRINFAVFPSLQGGPHNHAIAAVAVAL  301

Query  1227  KQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKV  1406
             KQA++P +R Y +QVL N    AQ L+++GY LVSGGT+NHLVLV+L+ KG+DG+R E+V
Sbjct  302   KQASSPAFRQYCQQVLKNAKAMAQALLQRGYTLVSGGTDNHLVLVDLRPKGMDGARAERV  361

Query  1407  LESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIK  1586
             LE V I ANKNT PGD SA+ PGG+R+G PALTSR F EEDF KV  + D  + L++ +K
Sbjct  362   LELVSITANKNTCPGDKSALTPGGLRLGAPALTSRHFHEEDFQKVVAFIDEGIALALDVK  421

Query  1587  AATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKH  1727
             + T  +KL+EF   L      Q  +A LR  VE +A+ FP  GF  H
Sbjct  422   SKT--SKLQEFKTFLLQDAETQRRLADLRQRVETFARAFPMPGFSDH  466



>emb|CCT68776.1| probable glycine hydroxymethyltransferase [Fusarium fujikuroi 
IMI 58289]
Length=518

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/471 (64%), Positives = 369/471 (78%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLSKADPAVFDIIEKEKDRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE LCQ+RALE+F LDP  WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQAERLCQQRALESFGLDPKLWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKK+SA+S +FET+PYRL+E+TGYIDY++LE+ A ++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKVSAISKYFETLPYRLDETTGYIDYNKLEEMACIYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF YAD+VTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKINAYLLADIAHISGLVAAKVIPGPFAYADIVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGA+IFYRKGV+  N + KE  LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGALIFYRKGVRRQNAKTKEDTLYDLEGPINSSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK +GIDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPQGIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTITSRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  ++EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGEKSPGKIKVFLDHLGDGET-ESEIVQLRSEVEDWVGTYP  511



>gb|EKV13325.1| Serine hydroxymethyltransferase [Penicillium digitatum PHI26]
 gb|EKV13805.1| Serine hydroxymethyltransferase [Penicillium digitatum Pd1]
Length=528

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 364/471 (77%), Gaps = 17/471 (4%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L ASLE+ DP +  I++ EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPG
Sbjct  51    KLLAASLEDSDPAVYSILQKEKKRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPG  110

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID +E LCQ+RALE FRLDP +WGVNVQPLSGSP+N   Y+ALL  HDR+M
Sbjct  111   ARYYGGNEHIDASERLCQQRALETFRLDPEEWGVNVQPLSGSPANLMAYSALLNTHDRLM  170

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQT TKKISA+S +FET PYRL+ESTG IDYD LEKSATL+RPKLI+
Sbjct  171   GLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSATLYRPKLII  230

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AG SAY+RL DY R+R + D   A LL+DMAHISGLVAA V+PSPF Y+DVVTTTTHKSL
Sbjct  231   AGTSAYSRLIDYPRMRAIADSVSAYLLSDMAHISGLVAADVLPSPFPYSDVVTTTTHKSL  290

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYRKGV+  +K+G  V+YD E+ IN +VFPG QGGPHNHTIT LAVALKQA 
Sbjct  291   RGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTITALAVALKQAQ  350

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             TP+++AYQE VL N S  A  L +       GY +VSGGT+NHLVLV+LKN+G+DG+RVE
Sbjct  351   TPDFKAYQETVLLNSSALAARLGDSTSNGGLGYNIVSGGTDNHLVLVDLKNRGVDGARVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE   +A+NKNTVPGD SA+ PGG+R+GTPA+TSRGF  EDF +VA+  D AV ++ K
Sbjct  411   RVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVADIVDRAVTITQK  470

Query  1581  I------KAATQGTK----LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             +       A ++G K    ++ F+  +   + I +EI  LR +VE++   F
Sbjct  471   LDKAARESAQSRGVKNPDTVRAFLEYVGEGEEI-SEIIVLRQEVEDWVGTF  520



>emb|CCG80581.1| Probable serine hydroxymethyltransferase, cytosolic [Taphrina 
deformans PYCC 5710]
Length=484

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/453 (63%), Positives = 361/453 (80%), Gaps = 1/453 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L + L+E+DPEI  IIE EK RQ   + LIPSENFTS SVMQA+GS M NKYSEGYP AR
Sbjct  28    LASPLQEIDPEIYGIIENEKIRQRDSIVLIPSENFTSKSVMQALGSPMQNKYSEGYPKAR  87

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID AE  CQ+RALEAFRLD  +WGVNVQPLSGSP+N  VY AL+KPH+R+M L
Sbjct  88    YYGGNEFIDQAELACQRRALEAFRLDSTQWGVNVQPLSGSPANLYVYQALMKPHERLMGL  147

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLP GGHLSHGY T TK ISAVS +F  +PY+++  TG IDYD+LEK +  F+PK+I+AG
Sbjct  148   DLPSGGHLSHGYATPTKNISAVSTYFSNLPYQVDPKTGLIDYDELEKMSAAFKPKIIIAG  207

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
              SAYA L DY R+R++ DK  A +LADMAHISGLVAAGV+P+PFDYAD+VTTTTHKSLRG
Sbjct  208   TSAYAALIDYKRMRQIADKCGAYILADMAHISGLVAAGVVPTPFDYADIVTTTTHKSLRG  267

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKGV+  +K+GK+++YD E  IN +VFPG QGGPHNHTIT LAVALKQA +P
Sbjct  268   PRGAMIFFRKGVRSTDKKGKDIMYDLEGPINFSVFPGHQGGPHNHTITALAVALKQAASP  327

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             E++ YQ +VL+N    A+  ++KGYELV+GGTENHL+LV+L  KGIDG+RVE+VLE V+I
Sbjct  328   EFKDYQTKVLANSKVMAEEFLQKGYELVTGGTENHLILVDLTKKGIDGARVERVLELVNI  387

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             A+NKNTVPGD SA++P G+R+GTPA+T+RGF  ++F +V ++ D AV++++K+ A+  G 
Sbjct  388   ASNKNTVPGDKSALIPHGLRLGTPAMTTRGFEAKEFRQVVDFIDRAVEITLKVNASAPGK  447

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             KLK+F   L   +   ++IA L+ DV   +  F
Sbjct  448   KLKDFKDHLGEGEQF-SDIAALKKDVAALSSSF  479



>gb|KGO64975.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium italicum]
Length=528

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 364/471 (77%), Gaps = 17/471 (4%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L ASL+E DP +  I++ EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPG
Sbjct  51    KLLAASLKESDPAVYSILQKEKKRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPG  110

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID +E LCQ+RALE FRLDP +WGVNVQPLSGSP+N   Y+ALL  HDR+M
Sbjct  111   ARYYGGNEHIDASERLCQQRALETFRLDPEEWGVNVQPLSGSPANLMAYSALLNTHDRLM  170

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQT TKKISA+S +FET PYRL+ESTG IDYD LEKSATL+RPKLI+
Sbjct  171   GLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSATLYRPKLII  230

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AG SAY+RL DY R+R + D   A LL+DMAHISGLVAA V+PSPF Y+DVVTTTTHKSL
Sbjct  231   AGTSAYSRLIDYPRMRAIADSVGAYLLSDMAHISGLVAADVLPSPFPYSDVVTTTTHKSL  290

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYRKGV+  +K+G  V+YD E+ IN +VFPG QGGPHNHTIT L+VALKQA 
Sbjct  291   RGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTITALSVALKQAQ  350

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             TP+++AYQE VL N S  A  L +       GY +VSGGT+NHLVLV+LKN+G+DG+RVE
Sbjct  351   TPDFKAYQETVLLNSSALAARLGDSTSNGGLGYNIVSGGTDNHLVLVDLKNRGVDGARVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE   +A+NKNTVPGD SA+ PGG+R+GTPA+TSRGF  EDF +VA+  D AV ++ K
Sbjct  411   RVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVADIVDRAVTITQK  470

Query  1581  I------KAATQGTK----LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             +       A ++G K    +K F+  +   + I +EI  LR +VE++   F
Sbjct  471   LDKAARESAQSRGVKNPNTVKAFLDYVGEGEEI-SEIVVLRQEVEDWVGTF  520



>ref|XP_002550843.1| serine hydroxymethyltransferase, mitochondrial precursor [Candida 
tropicalis MYA-3404]
 gb|EER31411.1| serine hydroxymethyltransferase, mitochondrial precursor [Candida 
tropicalis MYA-3404]
Length=491

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/457 (62%), Positives = 363/457 (79%), Gaps = 0/457 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             ++ S+EEVDPE+ADI+  E+ RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG R
Sbjct  33    ISKSVEEVDPEMADILNQERTRQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGER  92

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID AE+LCQKRALEAF LDP +WGVNVQPLSG+P+N   Y+A+L+  DRIM L
Sbjct  93    YYGGNEIIDKAEALCQKRALEAFNLDPNEWGVNVQPLSGAPANLYAYSAILEVGDRIMGL  152

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT+T KIS +S +F+TMPYRLNE TG IDYD LEK+A LFRPK+IVAG
Sbjct  153   DLPHGGHLSHGYQTNTTKISYISKYFQTMPYRLNEETGIIDYDTLEKNAQLFRPKVIVAG  212

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+R+ DY R++++ DK  A L++DMAHISGLV+AGV  SPF Y+D+VTTTTHKSLRG
Sbjct  213   ASAYSRVIDYKRMKQIADKVGAYLMSDMAHISGLVSAGVTDSPFPYSDIVTTTTHKSLRG  272

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG+++V K+GKE+ Y+ E KIN +VFPG QGGPHNHTI+ LAVALKQ + P
Sbjct  273   PRGAMIFFRKGIRKVTKKGKEIPYELERKINFSVFPGHQGGPHNHTISALAVALKQCSAP  332

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             EY+ YQ+ V+SN   FA  LV KG++LVS GT+ HL+LV+L+++ IDG+RVE VLE  +I
Sbjct  333   EYKQYQQDVISNAKHFADALVSKGFKLVSDGTDTHLILVDLRSRNIDGARVEAVLERANI  392

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGDVSA+ P G+R+GTPA+T+RGF  E+F KVAE+ D AV +++++KA  QG 
Sbjct  393   AANKNTVPGDVSALFPSGLRVGTPAMTTRGFGPEEFDKVAEFIDKAVNIAIELKAQEQGK  452

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
               KE +A+ +       ++ +L  +V  +  ++P  G
Sbjct  453   VPKELLASFKKLADESDKVKELDQEVVSWVSKYPVPG  489



>gb|ADE75872.1| unknown [Picea sitchensis]
Length=539

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/476 (62%), Positives = 368/476 (77%), Gaps = 15/476 (3%)
 Frame = +3

Query  315   EKCQVSWPKQ--LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVM  488
             + C     KQ  ++  L E+DPE+  IIE EK RQ++GLELI SENFTS +VM+AVGS +
Sbjct  71    QPCNFPEGKQNFVDLPLSELDPEMHAIIEQEKQRQFRGLELIASENFTSRAVMEAVGSCL  130

Query  489   TNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYT  668
             TNKYSEG PG RYY GNE+ID +E LCQKRALEAF LD + WGVNVQPLSGSP+NF VYT
Sbjct  131   TNKYSEGLPGKRYYAGNEFIDQSERLCQKRALEAFHLDSSAWGVNVQPLSGSPANFAVYT  190

Query  669   ALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKS  848
             ALL+PHDRIM LDLPHGGHLSHG+ T  +++SA SI+FE+MPYRL+E TG IDY+ LEK+
Sbjct  191   ALLQPHDRIMGLDLPHGGHLSHGFMTAKRRVSATSIYFESMPYRLDECTGLIDYEVLEKT  250

Query  849   ATLFRPKLIVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYAD  1028
             A+LFRPK+IV GASAY R +DY R+R++ D   A L+ DMAHISGL+AA V+ +PFDY D
Sbjct  251   ASLFRPKIIVVGASAYPRDFDYPRMRQIADTVGAYLMMDMAHISGLIAASVMTNPFDYCD  310

Query  1029  VVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVL-YDYEDKINQAVFPGLQGGPHNHTI  1205
             VVTTTTHKSLRGPRG MIF++K         + VL  D E  IN AVFPGLQGGPHNHTI
Sbjct  311   VVTTTTHKSLRGPRGGMIFFKK---------ETVLGIDLEAAINNAVFPGLQGGPHNHTI  361

Query  1206  TGLAVALKQATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGID  1385
              GLAV LKQA T E++AYQ+QV++NC   A+ L++ GY LVSGG++NHLVLV+L+  GID
Sbjct  362   GGLAVCLKQAVTAEFKAYQQQVVANCRALAKRLMDFGYNLVSGGSDNHLVLVDLRPLGID  421

Query  1386  GSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAV  1565
             G+RVEKVLE   I  NKN+VPGD SAMVPGGIR+GTPALT+RGF+E DF+KVA+     V
Sbjct  422   GARVEKVLECASITLNKNSVPGDKSAMVPGGIRIGTPALTTRGFLENDFIKVADLIHEGV  481

Query  1566  KLSVKIKAATQGTKLKEFVATLQSSD-AIQAEIAKLRHDVEEYAKQFPT--IGFEK  1724
             +++++ K+  QGTKLKEF+  ++S D   Q+ I+ L+  VE +A +FP   +G EK
Sbjct  482   QIAIEAKSFVQGTKLKEFIEFIESDDFQKQSSISDLKSQVESFASRFPLPGVGTEK  537



>emb|CDM26957.1| Putative serine hydroxymethyltransferase, mitochondrial [Penicillium 
roqueforti FM164]
Length=528

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/471 (63%), Positives = 365/471 (77%), Gaps = 17/471 (4%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L ASLEE DP + +I++ EK RQ   + LIPSENFTS +V+ A+GS+M NKYSEGYPG
Sbjct  51    KLLAASLEESDPTVYNILQQEKNRQKHFINLIPSENFTSQAVLDALGSIMQNKYSEGYPG  110

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID +E LCQ+RALE FRL+P +WGVNVQPLSGSP+N   Y+ALL  HDR+M
Sbjct  111   ARYYGGNEFIDASERLCQQRALETFRLNPEEWGVNVQPLSGSPANLMAYSALLNTHDRLM  170

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQT TKKISA+S +FET PYRL+ESTG IDYD LEKSATL+RPKLI+
Sbjct  171   GLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSATLYRPKLII  230

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AG SAY+RL DY R+R + D   A LL+DMAHISGLVAA V+PSPF Y+DVVTTTTHKSL
Sbjct  231   AGTSAYSRLIDYSRMRAIADSVGAYLLSDMAHISGLVAADVLPSPFPYSDVVTTTTHKSL  290

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYRKGV+  +K+G  ++YD E+ IN +VFPG QGGPHNHTIT LAVALKQA 
Sbjct  291   RGPRGAMIFYRKGVRSTDKKGNPIMYDLENPINASVFPGHQGGPHNHTITALAVALKQAQ  350

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             TP+++AYQ+ VL N S  A  L +       GY +VSGGT+NHLVL++LKN+G+DG+RVE
Sbjct  351   TPDFKAYQQTVLLNASALADRLGDSTSNGGLGYNIVSGGTDNHLVLLDLKNRGVDGARVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE   +A+NKNTVPGD SA+ PGG+R+GTPA+TSRGF  EDF +VA+  D AV ++ K
Sbjct  411   RVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVADIVDRAVTITQK  470

Query  1581  I------KAATQGTK----LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             +       A ++G K    +K F+  +   + I +EI  LR +VE++   F
Sbjct  471   LDKAARESAQSRGVKNPNTVKAFLEYVGGGEEI-SEIVVLRQEVEDWVGTF  520



>ref|XP_002837687.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81878.1| unnamed protein product [Tuber melanosporum]
Length=502

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/456 (64%), Positives = 362/456 (79%), Gaps = 1/456 (0%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L  SL E DPEI+ I+  EK RQ   + LIPSENFTS SV+ A+GS M NKYSEGYPG
Sbjct  43    KLLRTSLAEADPEISKILVHEKNRQRDFVNLIPSENFTSQSVLDALGSPMQNKYSEGYPG  102

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID AE+LCQKRAL AF L+P +WGVNVQ LSG+P+N   Y+A+++PHDRIM
Sbjct  103   ARYYGGNEWIDAAETLCQKRALAAFDLNPEEWGVNVQSLSGAPANLYAYSAIIRPHDRIM  162

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQ   KKIS +S +FET+PYRL+ +TG IDYD +EK A L+RPK+I+
Sbjct  163   GLDLPHGGHLSHGYQVPGKKISKISEYFETLPYRLDPNTGLIDYDNMEKLAELYRPKIII  222

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AGASAY+R+ DY R++++ +K  A LL+DMAHISGLVAAGV  SPF ++D+VTTTTHKSL
Sbjct  223   AGASAYSRIIDYARMKQITEKYDAYLLSDMAHISGLVAAGVTESPFAHSDIVTTTTHKSL  282

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIF+RKGV++ NK+G+++LYD E+ IN +VFPG QGGPHNHTIT LAVALKQA 
Sbjct  283   RGPRGAMIFFRKGVRKTNKKGEDILYDLENPINASVFPGHQGGPHNHTITALAVALKQAK  342

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESV  1418
             T E++ YQ+QVL N    +  L   GYE+VSGGT+NHLVLV+LK KGIDG+RVE+VLE V
Sbjct  343   TQEFKEYQQQVLKNAKALSDKLSALGYEIVSGGTDNHLVLVDLKPKGIDGARVERVLELV  402

Query  1419  HIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQ  1598
             ++AANKNTVPGDVSA+ PGG+R+G+PA+T+RGF E DF KVA   D AVK+S    A   
Sbjct  403   NVAANKNTVPGDVSALRPGGLRLGSPAMTTRGFSEPDFEKVAGIVDRAVKISKDFNATVG  462

Query  1599  GTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
             G KLK++   L + +A+  E+ +L+ +V E+A  FP
Sbjct  463   GKKLKDYFGKLDNGEAV-PELVQLKKEVAEWAGDFP  497



>ref|XP_003002478.1| serine hydroxymethyltransferase [Verticillium alfalfae VaMs.102]
 gb|EEY20939.1| serine hydroxymethyltransferase [Verticillium alfalfae VaMs.102]
Length=536

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 371/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+++L++ DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  59    LSSNLQQADPAVFDIIEKEKNRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  118

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID +E LCQ+RALEAF LDP++WGVNVQ LSG+P+N  VY+AL+  HDR+M L
Sbjct  119   YYGGNEFIDQSERLCQQRALEAFDLDPSQWGVNVQALSGAPANLYVYSALMNTHDRLMGL  178

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRLNE+TG IDYD+LE+ A ++RPK+IVAG
Sbjct  179   DLPHGGHLSHGYQTPTKKISAISKYFETVPYRLNETTGIIDYDKLEEMAIIYRPKIIVAG  238

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+ L DY RIR++CDK  A LLADMAHISGLVAA V+PSPF +AD+VTTT+HKSLRG
Sbjct  239   ASAYSSLIDYKRIREICDKVDAYLLADMAHISGLVAAKVLPSPFSFADIVTTTSHKSLRG  298

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGAMIF+RKGV+  N + KE  LY+ E+ IN +VFPG QGGPHNHTIT L+VALKQA T
Sbjct  299   PRGAMIFFRKGVRRQNAKTKEDELYNLENPINSSVFPGHQGGPHNHTITALSVALKQAQT  358

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE+RAYQ QVLSN    A  L E       GY+LV GGTENHLVLV+LK +GIDGSRVE+
Sbjct  359   PEFRAYQTQVLSNAKALAHRLGESKEKGGLGYKLVGGGTENHLVLVDLKPQGIDGSRVER  418

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +A+NKNTVPGD SA+VPGG+R+GTPA+T+RGF EEDF +VA+  D AV ++V+I
Sbjct  419   VLELVGVASNKNTVPGDRSALVPGGLRIGTPAMTTRGFSEEDFGRVADIIDRAVTIAVRI  478

Query  1584  KAAT------QGTK----LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
               A       +G K     + F+A L + D+   EI +LR +V ++   +P
Sbjct  479   DKAAKKAAAERGEKKPGLQRIFMAHLGNGDS-DPEIVQLRSEVSDWVGTYP  528



>ref|XP_711664.1| hypothetical protein CaO19.8922 [Candida albicans SC5314]
 gb|EAK92442.1| hypothetical protein CaO19.8922 [Candida albicans SC5314]
 gb|KGR04654.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P78048]
 gb|KGU03842.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
L26]
 gb|KGU20196.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P34048]
 gb|KGU22868.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P57055]
 gb|KHC30354.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P76055]
 gb|KHC47509.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P37039]
 gb|KHC67931.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P78042]
Length=493

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/457 (63%), Positives = 364/457 (80%), Gaps = 0/457 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             ++ S+++VDPE+ADI+  E+ RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG R
Sbjct  35    ISKSVQDVDPEMADILNQERTRQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGER  94

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID AE+LCQKRALEAF LDP++WGVNVQPLSG+P+N   Y+A+L+  DRIM L
Sbjct  95    YYGGNEIIDKAEALCQKRALEAFGLDPSQWGVNVQPLSGAPANLYAYSAILEVGDRIMGL  154

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT+T KIS +S +F+TMPYRLNE TG IDYD LEK+A LFRPK+IVAG
Sbjct  155   DLPHGGHLSHGYQTNTTKISYISKYFQTMPYRLNEETGIIDYDTLEKNAQLFRPKVIVAG  214

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+R+ DY R+R++ DK  A LL+DMAHISGLV+AGV  SPF Y+D+VTTTTHKSLRG
Sbjct  215   ASAYSRVIDYKRMRQIADKVGAYLLSDMAHISGLVSAGVTDSPFPYSDIVTTTTHKSLRG  274

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG+++V K+GKE+ Y+ E KIN +VFPG QGGPHNHTI+ LAVALKQ T P
Sbjct  275   PRGAMIFFRKGIRKVTKKGKEIPYELERKINFSVFPGHQGGPHNHTISALAVALKQCTEP  334

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             EY  YQ++V+SN   FA  LV KG++LVS GT+ HL+LV+L+++ IDG+RVE VLE  +I
Sbjct  335   EYVKYQQEVVSNAKHFADALVSKGFKLVSDGTDTHLILVDLRSRNIDGARVEAVLERANI  394

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGDVSA+ P G+R+GTPA+T+RGF  E+F KVAE+ D AV +++++KA  QG 
Sbjct  395   AANKNTVPGDVSALFPSGLRVGTPAMTTRGFGPEEFDKVAEFIDQAVNIAIELKAQEQGK  454

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
               KE +A+ +       ++ +L  +V  +  ++P  G
Sbjct  455   VPKELLASFKKLADESDKVKQLDKEVVSWVSKYPVPG  491



>ref|XP_002558936.1| Pc13g05010 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP91570.1| Pc13g05010 [Penicillium rubens Wisconsin 54-1255]
Length=528

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 364/471 (77%), Gaps = 17/471 (4%)
 Frame = +3

Query  339   KQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPG  518
             K L ASLEE DP + +I++ EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPG
Sbjct  51    KLLAASLEESDPTVWNILQKEKQRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPG  110

Query  519   ARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIM  698
             ARYYGGNE+ID +E LCQ+RALE FRL+P +WGVNVQPLSGSP+N   Y+ALL  HDRIM
Sbjct  111   ARYYGGNEHIDASERLCQQRALETFRLNPEEWGVNVQPLSGSPANLMAYSALLNTHDRIM  170

Query  699   ALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIV  878
              LDLPHGGHLSHGYQT TKKISA+S +FET PYRL+ESTG IDYD LEKSATL+RPKLI+
Sbjct  171   GLDLPHGGHLSHGYQTPTKKISAISKYFETFPYRLDESTGLIDYDALEKSATLYRPKLII  230

Query  879   AGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSL  1058
             AG SAY+RL DY R+R + D   A LLADMAHISGLVAA V+PSPF Y+DVVTTTTHKSL
Sbjct  231   AGTSAYSRLIDYPRMRAIADSVGAYLLADMAHISGLVAADVLPSPFPYSDVVTTTTHKSL  290

Query  1059  RGPRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQAT  1238
             RGPRGAMIFYRKGV+  +K+G  V+YD E+ IN +VFPG QGGPHNHTIT L+VALKQA 
Sbjct  291   RGPRGAMIFYRKGVRSTDKKGNPVMYDLENPINASVFPGHQGGPHNHTITALSVALKQAQ  350

Query  1239  TPEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVE  1400
             +P++ AYQ+ VL N S  A  L +       GY +VSGGT+NHLVLV+LKN+G+DG+RVE
Sbjct  351   SPDFEAYQKTVLRNASALAGRLGDSTSNGGLGYNIVSGGTDNHLVLVDLKNRGVDGARVE  410

Query  1401  KVLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVK  1580
             +VLE   +A+NKNTVPGD SA+ PGG+R+GTPA+TSRGF  EDF +VA+  D AV ++ K
Sbjct  411   RVLELCGVASNKNTVPGDKSALKPGGLRLGTPAMTSRGFQPEDFTRVADIVDRAVTITQK  470

Query  1581  I------KAATQGTK----LKEFVATLQSSDAIQAEIAKLRHDVEEYAKQF  1703
             +       A ++G K    +K F+  +   + I +EI  LR +VE++   F
Sbjct  471   LDKAARESAQSRGVKNPNTVKAFLDYVGEGEEI-SEIVVLRQEVEDWVGTF  520



>ref|XP_009261600.1| hypothetical protein FPSE_10208 [Fusarium pseudograminearum CS3096]
 gb|EKJ69612.1| hypothetical protein FPSE_10208 [Fusarium pseudograminearum CS3096]
Length=518

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 370/471 (79%), Gaps = 18/471 (4%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             L+A L + DP + DIIE EK RQ   + LIPSENFTS +V+ A+GSVM NKYSEGYPGAR
Sbjct  42    LSAHLNKADPAVFDIIEKEKNRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGAR  101

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE+ID +E LCQ+RALE+F LDP +WGVNVQ LSG+P+N  VY+ALL  HDR+M L
Sbjct  102   YYGGNEFIDQSERLCQQRALESFGLDPKQWGVNVQALSGAPANLYVYSALLNTHDRLMGL  161

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT TKKISA+S +FET+PYRLNE+TGYIDY++L++ A+++RPK+IVAG
Sbjct  162   DLPHGGHLSHGYQTPTKKISAISKYFETLPYRLNETTGYIDYEKLDELASVYRPKIIVAG  221

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+RL DY R+R++CDK  A LLAD+AHISGLVAA VIP PF +ADVVTTT+HKSLRG
Sbjct  222   ASAYSRLIDYQRMREICDKVNAYLLADIAHISGLVAAKVIPGPFAHADVVTTTSHKSLRG  281

Query  1065  PRGAMIFYRKGVKEVNKQGKE-VLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATT  1241
             PRGAMIFYRKG++  + + KE +LYD E  IN +VFPG QGGPHNHTIT LAVALKQA T
Sbjct  282   PRGAMIFYRKGIRRQHPKTKEDILYDLEGPINNSVFPGHQGGPHNHTITALAVALKQAQT  341

Query  1242  PEYRAYQEQVLSNCSKFAQTLVEK------GYELVSGGTENHLVLVNLKNKGIDGSRVEK  1403
             PE++AYQ QVL N   FA+ L E       GY+LVSGGT+NHLVL +LK   IDG RVE+
Sbjct  342   PEFQAYQSQVLKNAKAFAKRLSEPKGKGGLGYKLVSGGTDNHLVLADLKPHSIDGGRVER  401

Query  1404  VLESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKI  1583
             VLE V +AANKNTVPGD SA+VPGG+RMGTPA+T+RGF E+DFV+VA+  D AV ++ +I
Sbjct  402   VLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFNEDDFVRVADVVDRAVTIASRI  461

Query  1584  -KAATQGT---------KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFP  1706
              KAA +           K+K F+  L   +  Q+EI +LR +VE++   +P
Sbjct  462   DKAARKAAEEKGDKSPGKIKVFLEHLGDGET-QSEIVQLRSEVEDWVGTYP  511



>ref|XP_003481682.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoformX2 [Sus scrofa]
 ref|XP_005663973.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial-like 
isoform X2 [Sus scrofa]
Length=505

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/466 (63%), Positives = 357/466 (77%), Gaps = 5/466 (1%)
 Frame = +3

Query  333   WPKQLNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGY  512
             W  Q   SL + DPE+ +++  EK RQ +GLELI SENF S + ++A+GS + NKYSEGY
Sbjct  44    WSGQ--ESLSDSDPEMWELLRREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGY  101

Query  513   PGARYYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDR  692
             PG RYYGG E +D  E LCQ+RALEAF LDPA+WGVNVQP SGSP+N   YTALL+PHDR
Sbjct  102   PGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDR  161

Query  693   IMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKL  872
             IM LDLP GGHL+HGY TD K+ISA SIFFE+MPY+LN  TG IDYDQL  +A LFRP+L
Sbjct  162   IMGLDLPDGGHLTHGYMTDVKRISATSIFFESMPYKLNPKTGLIDYDQLALTARLFRPRL  221

Query  873   IVAGASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHK  1052
             I+AG SAYARL DY R+R+VCD+ KA LLADMAHISGLVAA VIPSPF++ADVVTTTTHK
Sbjct  222   IIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFEHADVVTTTTHK  281

Query  1053  SLRGPRGAMIFYRKGVKEVN-KQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALK  1229
             +LRG R  +IFYRKGV+ V+ K G+E+ Y +ED+IN AVFP LQGGPHNH I  +AVALK
Sbjct  282   TLRGARSGLIFYRKGVRTVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALK  341

Query  1230  QATTPEYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVL  1409
             QA TP +R Y  QVL N    A  L+E+GY LVSGGT+NHLVLV+L+ KG+DG+RVE+VL
Sbjct  342   QACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARVERVL  401

Query  1410  ESVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKA  1589
             E V I ANKNT PGD SA+ PGG+R+GTPALTSR F E+DF KV  + D  V + +++K+
Sbjct  402   ELVSITANKNTCPGDRSAITPGGLRLGTPALTSRQFREDDFRKVVAFIDEGVSIGLEVKS  461

Query  1590  ATQGTKLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKH  1727
              T  TKL++F + L         +A LR  VE++A+ FP  GFE+H
Sbjct  462   KT--TKLQDFKSFLLKDPETCRRLADLRQRVEQFARAFPMPGFEEH  505



>ref|XP_005986325.1| PREDICTED: serine hydroxymethyltransferase, mitochondrial isoform 
X2 [Latimeria chalumnae]
Length=492

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/459 (61%), Positives = 360/459 (78%), Gaps = 3/459 (1%)
 Frame = +3

Query  354   SLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGARYYG  533
             S+ + DPE+ ++++ EK RQ +GLELI SENF S + ++A+GS + NKYSEGYPG RYYG
Sbjct  36    SMADSDPEMWNLVQKEKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYG  95

Query  534   GNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMALDLP  713
             G E +D  E LCQKRALEAF LDP++WGVNVQP SGSP+NF  YTALL+PHDRIM LDLP
Sbjct  96    GAEVVDQIEELCQKRALEAFDLDPSRWGVNVQPYSGSPANFAAYTALLQPHDRIMGLDLP  155

Query  714   HGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASA  893
              GGHL+HGY +D K+ISA SI+FE+MPY+LN STG IDYDQLE +A LFRP++++AG SA
Sbjct  156   DGGHLTHGYMSDVKRISATSIYFESMPYKLNPSTGLIDYDQLEVTARLFRPRMVIAGTSA  215

Query  894   YARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRGPRG  1073
             YARL DY R+RKVCD+ +A LLADMAHISGLV+A V+PSPF++AD+VT+TTHK+LRG R 
Sbjct  216   YARLIDYARMRKVCDEVRAYLLADMAHISGLVSAKVVPSPFEHADIVTSTTHKTLRGARA  275

Query  1074  AMIFYRKGVKEVNKQ-GKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTPEY  1250
              +IFYRKGV+ VNK+ GKEV+YD+EDKIN AVFP LQGGPHNH I  +AVALKQ  +  +
Sbjct  276   GLIFYRKGVQSVNKKTGKEVMYDFEDKINFAVFPSLQGGPHNHAIAAVAVALKQVNSAMF  335

Query  1251  RAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAA  1430
             R Y +QVL N    A +L +KG+ LVSGGT+NHLVLV+L+ KGIDG+R E+VLE V I A
Sbjct  336   REYAQQVLKNAKAMAASLNKKGFTLVSGGTDNHLVLVDLRPKGIDGARAERVLELVSITA  395

Query  1431  NKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGTKL  1610
             NKNT PGD SA+ PGG+R+G PALTSR F E DF +V ++ D  ++++V +K  T   KL
Sbjct  396   NKNTCPGDKSALTPGGLRLGAPALTSRQFREADFEQVVDFIDEGIQIAVDVKMKT--AKL  453

Query  1611  KEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIGFEKH  1727
             ++F + L   +  +A++A LR  VE++ + FP  GF+ H
Sbjct  454   QDFKSFLLKDEETKAKMADLRQRVEKFTRAFPMPGFQDH  492



>gb|KGQ82275.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P94015]
Length=493

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/457 (63%), Positives = 364/457 (80%), Gaps = 0/457 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             ++ S+++VDPE+ADI+  E+ RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG R
Sbjct  35    ISKSVQDVDPEMADILNQERTRQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGER  94

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID AE+LCQKRALEAF LDP++WGVNVQPLSG+P+N   Y+A+L+  DRIM L
Sbjct  95    YYGGNEIIDKAEALCQKRALEAFGLDPSQWGVNVQPLSGAPANLYAYSAILEVGDRIMGL  154

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT+T KIS +S +F+TMPYRLNE TG IDYD LEK+A LFRPK+IVAG
Sbjct  155   DLPHGGHLSHGYQTNTTKISYISKYFQTMPYRLNEETGIIDYDTLEKNAQLFRPKVIVAG  214

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+R+ DY R+R++ DK  A LL+DMAHISGLV+AGV  SPF Y+D+VTTTTHKSLRG
Sbjct  215   ASAYSRVIDYKRMRQIADKVGAYLLSDMAHISGLVSAGVTDSPFPYSDIVTTTTHKSLRG  274

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG+++V K+GKE+ Y+ E KIN +VFPG QGGPHNHTI+ LAVALKQ T P
Sbjct  275   PRGAMIFFRKGIRKVTKKGKEIPYELERKINFSVFPGHQGGPHNHTISALAVALKQCTEP  334

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             EY  YQ++V+SN   FA  LV KG++LVS GT+ HL+LV+L+++ IDG+RVE VLE  +I
Sbjct  335   EYIKYQQEVVSNAKHFADALVSKGFKLVSDGTDTHLILVDLRSRNIDGARVEAVLERANI  394

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGDVSA+ P G+R+GTPA+T+RGF  E+F KVAE+ D AV +++++KA  QG 
Sbjct  395   AANKNTVPGDVSALFPSGLRVGTPAMTTRGFGPEEFDKVAEFIDQAVNIAIELKAQEQGK  454

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
               KE +A+ +       ++ +L  +V  +  ++P  G
Sbjct  455   VPKELLASFKKLADESDKVKQLDKEVVSWVSKYPVPG  491



>gb|KGQ83654.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P37005]
 gb|KGR08384.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P37037]
 gb|KGU04097.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
19F]
 gb|KHC55413.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
P75010]
 gb|KHC72005.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
SC5314]
 gb|KHC79862.1| serine hydroxymethyltransferase, mitochondrial [Candida albicans 
SC5314]
Length=493

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/457 (63%), Positives = 364/457 (80%), Gaps = 0/457 (0%)
 Frame = +3

Query  345   LNASLEEVDPEIADIIELEKARQWKGLELIPSENFTSLSVMQAVGSVMTNKYSEGYPGAR  524
             ++ S+++VDPE+ADI+  E+ RQ   + LIPSENFTS +VM  +GS M NKYSEGYPG R
Sbjct  35    ISKSVQDVDPEMADILNQERTRQKNSITLIPSENFTSKAVMDLLGSEMQNKYSEGYPGER  94

Query  525   YYGGNEYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPSNFQVYTALLKPHDRIMAL  704
             YYGGNE ID AE+LCQKRALEAF LDP++WGVNVQPLSG+P+N   Y+A+L+  DRIM L
Sbjct  95    YYGGNEIIDKAEALCQKRALEAFGLDPSQWGVNVQPLSGAPANLYAYSAILEVGDRIMGL  154

Query  705   DLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAG  884
             DLPHGGHLSHGYQT+T KIS +S +F+TMPYRLNE TG IDYD LEK+A LFRPK+IVAG
Sbjct  155   DLPHGGHLSHGYQTNTTKISYISKYFQTMPYRLNEETGIIDYDTLEKNAQLFRPKVIVAG  214

Query  885   ASAYARLYDYDRIRKVCDKQKAILLADMAHISGLVAAGVIPSPFDYADVVTTTTHKSLRG  1064
             ASAY+R+ DY R+R++ DK  A LL+DMAHISGLV+AGV  SPF Y+D+VTTTTHKSLRG
Sbjct  215   ASAYSRVIDYKRMRQIADKVGAYLLSDMAHISGLVSAGVTDSPFPYSDIVTTTTHKSLRG  274

Query  1065  PRGAMIFYRKGVKEVNKQGKEVLYDYEDKINQAVFPGLQGGPHNHTITGLAVALKQATTP  1244
             PRGAMIF+RKG+++V K+GKE+ Y+ E KIN +VFPG QGGPHNHTI+ LAVALKQ T P
Sbjct  275   PRGAMIFFRKGIRKVTKKGKEIPYELERKINFSVFPGHQGGPHNHTISALAVALKQCTEP  334

Query  1245  EYRAYQEQVLSNCSKFAQTLVEKGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHI  1424
             EY  YQ++V+SN   FA  LV KG++LVS GT+ HL+LV+L+++ IDG+RVE VLE  +I
Sbjct  335   EYVKYQQEVVSNAKHFADALVSKGFKLVSDGTDTHLILVDLRSRNIDGARVEAVLERANI  394

Query  1425  AANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFVKVAEYFDAAVKLSVKIKAATQGT  1604
             AANKNTVPGDVSA+ P G+R+GTPA+T+RGF  E+F KVAE+ D AV +++++KA  QG 
Sbjct  395   AANKNTVPGDVSALFPSGLRVGTPAMTTRGFGPEEFDKVAEFIDQAVNIAIELKAQEQGK  454

Query  1605  KLKEFVATLQSSDAIQAEIAKLRHDVEEYAKQFPTIG  1715
               KE +A+ +       ++ +L  +V  +  ++P  G
Sbjct  455   VPKELLASFKKLADESDKVKQLDKEVVSWVSKYPVPG  491



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6209079152520