BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c48803_g1_i1 len=163 path=[1:0-162]

Length=163
                                                                      Score     E

sp|P52397.1|E13J_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  85.1    4e-19   Nicotiana tabacum [American tobacco]
pir||E38257  glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), ac...  85.1    5e-19
sp|P52398.1|E13K_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  86.3    1e-18   Nicotiana tabacum [American tobacco]
gb|AAD33880.1|AF141653_1  beta-1,3-glucanase                          86.3    1e-18   Nicotiana tabacum [American tobacco]
ref|XP_009801409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  86.3    1e-18   
ref|XP_009596559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      85.5    2e-18   
sp|P23432.1|E13C_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  85.5    2e-18   Nicotiana tabacum [American tobacco]
sp|P23433.1|E13D_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  85.5    2e-18   Nicotiana tabacum [American tobacco]
sp|P52399.1|E13L_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  85.5    2e-18   Nicotiana tabacum [American tobacco]
ref|XP_009607576.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  85.5    2e-18   
ref|XP_009796657.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      85.5    2e-18   
ref|XP_009619948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  85.1    3e-18   
pir||D38257  glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), ac...  82.4    5e-18
ref|XP_009374912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  82.4    2e-17   
ref|XP_009780913.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  82.0    3e-17   
gb|KHN05499.1|  Glucan endo-1,3-beta-glucosidase, acidic isoform ...  82.0    4e-17   
gb|ACU20860.1|  unknown                                               82.0    4e-17   Glycine max [soybeans]
ref|NP_001237271.1|  endo-1,3-beta-glucanase precursor                81.6    4e-17   
ref|XP_009794864.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  79.0    5e-17   
dbj|BAE53384.1|  beta-1,3-glucanase                                   81.6    5e-17   
ref|XP_009592823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  81.6    6e-17   
ref|XP_009790797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  81.3    7e-17   
dbj|BAE53383.1|  beta-1,3-glucanase                                   80.9    9e-17   
gb|ABK95326.1|  unknown                                               80.9    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002299791.2|  3-glucanase family protein                       80.9    9e-17   Populus trichocarpa [western balsam poplar]
sp|P52396.1|E13I_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  79.7    2e-16   Nicotiana tabacum [American tobacco]
ref|XP_008363318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  80.5    2e-16   
ref|XP_009775775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  79.7    3e-16   
gb|AAA34103.1|  PR2                                                   79.7    3e-16   Nicotiana tabacum [American tobacco]
sp|P23547.1|E13G_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  79.7    3e-16   Nicotiana tabacum [American tobacco]
ref|XP_011001638.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  79.0    4e-16   
ref|XP_011045404.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  79.0    5e-16   
gb|KHN05498.1|  Glucan endo-1,3-beta-glucosidase, basic vacuolar ...  79.0    5e-16   
ref|XP_007132239.1|  hypothetical protein PHAVU_011G077900g           79.0    5e-16   
ref|XP_008366411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  78.6    7e-16   
ref|XP_009587943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  78.6    8e-16   
ref|XP_010101247.1|  Glucan endo-1,3-beta-glucosidase                 78.2    9e-16   
gb|KHN05501.1|  Glucan endo-1,3-beta-glucosidase, acidic isoform ...  75.5    1e-15   
ref|XP_007211511.1|  hypothetical protein PRUPE_ppa007999mg           78.2    1e-15   
ref|XP_010101245.1|  Glucan endo-1,3-beta-glucosidase                 77.8    1e-15   
ref|XP_008373020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  77.4    2e-15   
ref|XP_008356363.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  77.4    2e-15   
ref|XP_010045033.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  77.4    2e-15   
ref|XP_009366077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  77.4    2e-15   
ref|XP_004962627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  77.0    3e-15   
ref|XP_009764461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  76.6    3e-15   
dbj|BAM28606.1|  beta-1,3-glucanase                                   76.6    3e-15   
ref|XP_003607319.1|  Endo-beta-1 3-glucanase                          76.3    4e-15   
ref|XP_006365629.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  75.9    7e-15   
ref|XP_004228512.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  75.9    9e-15   
gb|KDP22122.1|  hypothetical protein JCGZ_25953                       75.5    1e-14   
gb|KEH30624.1|  glucan endo-1,3-beta-glucosidase                      75.1    1e-14   
ref|NP_001234798.1|  glucan endo-1,3-beta-glucosidase A precursor     75.1    1e-14   
gb|EYU35916.1|  hypothetical protein MIMGU_mgv1a009371mg              75.1    1e-14   
gb|AAN78310.1|  acidic class II 1,3-beta-glucanase precursor          75.1    1e-14   Solanum tuberosum [potatoes]
gb|AAS79332.1|  beta 1-3 glucanase PR2                                74.3    1e-14   Malus domestica [apple tree]
ref|XP_011090470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  75.9    1e-14   
ref|XP_006365633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  74.7    1e-14   
ref|XP_007015136.1|  Glycosyl hydrolase superfamily protein, puta...  75.1    1e-14   
gb|AFP23132.1|  beta-1,3-glucanase                                    75.1    2e-14   
dbj|BAG34628.1|  beta-1,3-glucanase                                   74.7    2e-14   Lotus japonicus
ref|XP_006367558.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  75.1    2e-14   
ref|XP_010692567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  74.3    3e-14   
ref|XP_008227211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  73.9    3e-14   
ref|XP_007133418.1|  hypothetical protein PHAVU_011G177000g           73.9    4e-14   
emb|CAA08910.1|  glucan endo-1,3-beta-D-glucosidase                   73.9    4e-14   Solanum tuberosum [potatoes]
gb|AES89518.2|  glucan endo-1,3-beta-glucosidase                      74.3    5e-14   
pdb|3UR7|A  Chain A, Higher-density Crystal Structure Of Potato E...  73.2    5e-14   
gb|AAL30420.1|AF434173_1  glucanase                                   73.6    5e-14   Sambucus nigra
ref|XP_003607321.1|  Endo-beta-1 3-glucanase                          73.9    6e-14   
gb|AFK41254.1|  unknown                                               73.6    6e-14   
emb|CAE52322.1|  1,3-beta-D-glucan glucanohydrolase precursor         73.2    7e-14   Solanum tuberosum [potatoes]
gb|AAN78309.1|  acidic class II 1,3-beta-glucanase precursor          73.2    7e-14   Solanum tuberosum [potatoes]
ref|XP_010673693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  73.2    7e-14   
ref|XP_007015119.1|  Glycosyl hydrolase superfamily protein, puta...  73.2    9e-14   
gb|EMT00138.1|  Glucan endo-1,3-beta-glucosidase GIII                 70.5    2e-13   
ref|XP_006423938.1|  hypothetical protein CICLE_v10029843mg           72.0    2e-13   
ref|XP_006367559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  72.0    2e-13   
ref|XP_006446183.1|  hypothetical protein CICLE_v10017983mg           71.2    2e-13   
ref|NP_001266064.1|  glucan endo-1,3-beta-glucosidase-like precursor  71.6    3e-13   
ref|XP_006480384.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  72.0    3e-13   
ref|XP_004297245.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  71.6    3e-13   
gb|AAB05226.1|  beta 1-3 glucanase                                    69.7    3e-13   Nicotiana glutinosa
gb|AAO16642.1|  beta-1,3-glucanase                                    71.6    3e-13   Fragaria x ananassa
gb|KDO61190.1|  hypothetical protein CISIN_1g048190mg                 71.6    3e-13   
emb|CBI17186.3|  unnamed protein product                              71.2    3e-13   
ref|XP_006470762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  71.6    3e-13   
emb|CAE53273.1|  1,3-beta-glucan glucanohydrolase                     71.2    4e-13   Solanum tuberosum [potatoes]
gb|AAP12732.1|  putative beta-1,3-endoglucanase                       68.2    4e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ABD85024.1|  beta-1,3-glucanase                                    71.2    4e-13   Lilium hybrid division VII [oriental hybrid lilies]
ref|XP_007212652.1|  hypothetical protein PRUPE_ppa018225mg           71.2    4e-13   
ref|XP_003632274.2|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.9    4e-13   
ref|XP_006291444.1|  hypothetical protein CARUB_v10017580mg           70.9    5e-13   
ref|XP_008227227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.9    5e-13   
gb|KGN66505.1|  hypothetical protein Csa_1G616230                     67.4    5e-13   
gb|AAY34778.2|  beta-1,3-glucanase                                    69.7    5e-13   Panax ginseng [Asiatic ginseng]
emb|CAN71821.1|  hypothetical protein VITISV_027077                   70.9    5e-13   Vitis vinifera
ref|XP_003607316.1|  Glucan endo-1 3-beta-d-glucosidase               70.9    5e-13   
ref|XP_009589771.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  70.5    6e-13   
ref|XP_004291760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.9    7e-13   
ref|XP_006843457.1|  hypothetical protein AMTR_s00053p00181850        70.1    7e-13   
dbj|BAC66185.1|  beta-1,3-glucanase                                   70.9    7e-13   Fragaria x ananassa
dbj|BAC66141.1|  beta-1,3-glucanase                                   70.9    7e-13   Fragaria x ananassa
gb|AAF82289.1|  B-1,3-glucanase                                       68.9    7e-13   Castanea sativa
dbj|BAC66186.1|  beta-1,3-glucanase                                   70.5    7e-13   Fragaria x ananassa
ref|XP_002513528.1|  Lichenase precursor, putative                    70.5    7e-13   Ricinus communis
pdb|4GZI|A  Chain A, Active-site Mutant Of Potato Endo-1,3-beta-g...  70.1    7e-13   
gb|AAA34080.1|  prepro-beta-1,3-glucanase precursor                   69.3    8e-13   Nicotiana tabacum [American tobacco]
emb|CBI22897.3|  unnamed protein product                              69.3    9e-13   
ref|XP_004516619.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.1    1e-12   
ref|XP_010273330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  69.7    1e-12   
ref|XP_010673702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.1    1e-12   
ref|XP_010092377.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  71.2    1e-12   
ref|XP_008227224.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.5    1e-12   
ref|XP_004516618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  70.1    1e-12   
ref|XP_002278123.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      69.7    1e-12   Vitis vinifera
ref|XP_007226561.1|  hypothetical protein PRUPE_ppa024457mg           69.7    2e-12   
emb|CAC40755.1|  putative prepo-beta-,3-glucanase precursor           68.9    2e-12   Atropa belladonna [deadly nightshade]
ref|XP_009626317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    2e-12   
gb|AAA34082.1|  prepro-beta-1,3-glucanase precursor                   69.3    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_009760305.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    2e-12   
dbj|BAA31142.1|  beta-1,3-glucanase                                   66.6    2e-12   Cucumis sativus [cucumbers]
gb|AAA63541.1|  basic beta-1,3-glucanase                              69.7    2e-12   Nicotiana tabacum [American tobacco]
sp|P23546.1|E13E_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  69.7    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_008223323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.7    2e-12   
ref|XP_008811758.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  69.3    2e-12   
ref|XP_004251356.2|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    2e-12   
ref|XP_009626316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.7    2e-12   
ref|NP_001275613.1|  glucan endo-1,3-beta-glucosidase, acidic iso...  69.3    2e-12   
sp|P27666.1|E13F_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  69.7    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_003607315.1|  Glucan endo-1,3-beta-glucosidase                 69.3    2e-12   
sp|P15797.2|E13B_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...  69.7    2e-12   Nicotiana tabacum [American tobacco]
dbj|BAG30906.1|  beta-1,3-glucanase                                   67.0    2e-12   Capsicum chinense [bonnet pepper]
gb|EMS59988.1|  Glucan endo-1,3-beta-glucosidase GIII                 68.9    2e-12   
ref|XP_010907249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  69.3    2e-12   
emb|CAN71820.1|  hypothetical protein VITISV_027076                   67.8    2e-12   Vitis vinifera
gb|ACF93731.1|  basic beta-1,3-glucanase                              69.7    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_009760304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  69.3    2e-12   
ref|XP_010427595.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.9    2e-12   
ref|XP_010427596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.9    2e-12   
ref|XP_009414358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  68.9    2e-12   
gb|AAD28732.1|AF112965_1  beta-1,3-glucanase precursor                68.9    3e-12   Triticum aestivum [Canadian hard winter wheat]
sp|P52402.1|E133_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...  68.9    3e-12   Solanum tuberosum [potatoes]
gb|AAC19114.1|  1,3-beta-glucan glucanohydrolase                      69.3    3e-12   Solanum tuberosum [potatoes]
sp|P52400.1|E131_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...  68.9    3e-12   Solanum tuberosum [potatoes]
gb|AFU52655.1|  beta-1,3-glucanase 22                                 68.9    3e-12   
ref|XP_009391471.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  68.9    3e-12   
gb|AAR06588.1|  beta-1,3-glucanase                                    68.9    3e-12   Vitis riparia [frost grape]
gb|AIS22073.1|  beta-1,3 glucanase 4                                  68.9    3e-12   
gb|AHW57401.1|  beta-1,3 glucanase 4                                  68.9    3e-12   
gb|ABR13272.1|  putative beta-1,3-glucanase                           66.2    3e-12   Prunus dulcis [sweet almond]
ref|XP_009770429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  68.6    3e-12   
gb|AAM12898.1|AF494405_1  beta-1,3-glucanase                          65.9    4e-12   Malus domestica [apple tree]
ref|XP_010248217.1|  PREDICTED: lichenase-like                        68.2    4e-12   
dbj|BAJ90395.1|  predicted protein                                    68.6    4e-12   
emb|CBH32609.1|  glucan endo-1,3-beta-glucosidase GII precursor,p...  68.6    4e-12   
gb|AAX81590.1|  beta-1,3-glucanase                                    68.6    4e-12   Fragaria x ananassa
ref|XP_006365200.1|  PREDICTED: uncharacterized protein LOC102593111  69.7    4e-12   
sp|Q02126.1|E13C_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...  68.2    4e-12   Hordeum vulgare [barley]
gb|AAZ79656.1|  putative beta-1,3-glucanase                           67.4    4e-12   Fagus sylvatica
ref|XP_010279591.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  68.6    4e-12   
emb|CAB60154.1|  1,3 beta glucanase                                   65.9    5e-12   Vitis vinifera
gb|AAF44667.2|AF239617_1  beta-1,3-glucanase                          68.6    5e-12   Vitis vinifera
ref|XP_010938656.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  68.2    5e-12   
ref|XP_010063513.1|  PREDICTED: lichenase                             68.6    6e-12   
gb|AAL58887.1|  beta-1,3-glucanase                                    64.7    6e-12   Cucumis melo [Oriental melon]
gb|KHN03122.1|  Glucan endo-1,3-beta-glucosidase                      67.8    6e-12   
ref|XP_003607328.1|  Beta-1 3-glucanase                               68.2    6e-12   
gb|AAY88778.1|  beta-1,3-glucanase                                    67.8    6e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006430506.1|  hypothetical protein CICLE_v10012099mg           68.2    6e-12   
gb|AAL15886.1|AF417298_1  putative beta-1,3-glucanase                 65.9    6e-12   Castanea sativa
gb|AAY96422.1|  beta-1,3-glucanase                                    67.8    6e-12   Triticum aestivum [Canadian hard winter wheat]
gb|AEV41413.1|  beta-1,3-glucanase                                    68.2    6e-12   
gb|KHN03119.1|  Glucan endo-1,3-beta-glucosidase                      67.0    6e-12   
sp|P23431.1|E13B_NICPL  RecName: Full=Glucan endo-1,3-beta-glucos...  68.2    6e-12   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AHE76177.1|  beta-1,3-endoglucanase                                67.8    6e-12   
gb|ACI23384.1|  beta glucanase                                        66.2    7e-12   Isatis tinctoria [woad]
gb|AHE76176.1|  beta-1,3-endoglucanase                                67.4    7e-12   
emb|CDY34445.1|  BnaC01g21880D                                        67.8    7e-12   
gb|EMT32042.1|  Glucan endo-1,3-beta-glucosidase GII                  67.8    7e-12   
emb|CAA77085.1|  glucan endo-1,3-beta-D-glucosidase                   67.8    7e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006482037.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    7e-12   
ref|XP_010090226.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  67.4    7e-12   
ref|XP_008811754.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.8    8e-12   
ref|XP_008240769.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    8e-12   
emb|CAM82809.1|  pathogenesis-related protein 2                       65.9    8e-12   Malus domestica [apple tree]
ref|XP_008811756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.8    8e-12   
ref|XP_007015141.1|  Glucan endo-1,3-beta-glucosidase, acidic, pu...  67.8    8e-12   
sp|Q02437.1|E13D_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...  67.4    8e-12   Hordeum vulgare [barley]
ref|XP_008231643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    8e-12   
gb|KFK34961.1|  hypothetical protein AALP_AA5G216400                  67.4    8e-12   
gb|AAL30426.1|AF435089_1  beta-1,3-glucanase                          67.4    9e-12   Prunus persica
gb|AHJ78381.1|  beta-1,3-glucanase                                    65.9    9e-12   
ref|XP_006358202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    9e-12   
ref|NP_001274869.1|  glucan endo-1,3-beta-glucosidase, basic isof...  67.8    9e-12   
ref|XP_006284042.1|  hypothetical protein CARUB_v10005163mg           67.4    1e-11   
gb|EMS47932.1|  Glucan endo-1,3-beta-glucosidase GII                  67.8    1e-11   
ref|XP_002878140.1|  beta-1,3-glucanase 2                             67.4    1e-11   
gb|AAM12897.1|AF494404_1  beta-1,3-glucanase                          64.7    1e-11   Malus domestica [apple tree]
ref|XP_010263438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    1e-11   
emb|CDP20080.1|  unnamed protein product                              67.4    1e-11   
ref|XP_008443726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.4    1e-11   
emb|CAN66737.1|  hypothetical protein VITISV_024188                   67.4    1e-11   Vitis vinifera
ref|XP_002533898.1|  Glucan endo-1,3-beta-glucosidase, basic isof...  66.2    1e-11   Ricinus communis
dbj|BAK00288.1|  predicted protein                                    67.0    1e-11   
emb|CAJ58508.1|  glucan endo-1,3-beta-D-glucosidase                   65.9    1e-11   Secale cereale
sp|Q02438.2|E13E_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...  67.0    1e-11   Hordeum vulgare [barley]
pdb|1GHS|A  Chain A, The Three-Dimensional Structures Of Two Plan...  66.6    1e-11   
ref|NP_001267896.1|  class I beta-1,3-glucanase precursor             67.4    1e-11   
prf||1607157A  endo-1,3-beta-glucanase                                66.6    1e-11
gb|EMT07351.1|  Glucan endo-1,3-beta-glucosidase GIII                 67.4    1e-11   
gb|EMT12505.1|  Glucan endo-1,3-beta-glucosidase GV                   66.6    1e-11   
ref|XP_010232797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    1e-11   
ref|XP_003607322.1|  Endo-1 3-beta-glucanase                          67.4    1e-11   
ref|XP_010551091.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.4    1e-11   
ref|XP_010516340.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.0    1e-11   
gb|AAC14399.1|  beta-1,3-glucanase 2                                  67.0    1e-11   Hordeum vulgare [barley]
sp|P15737.1|E13B_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...  67.0    1e-11   Hordeum vulgare [barley]
ref|XP_004171028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    1e-11   
gb|AES89519.2|  glycoside hydrolase family 17 protein                 67.4    1e-11   
prf||1410344A  glucan endoglucosidase                                 67.0    1e-11
emb|CDP14183.1|  unnamed protein product                              67.0    1e-11   
gb|AAM75342.1|AF515785_1  beta-1,3-glucanase II                       67.0    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010921891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  67.0    1e-11   
ref|XP_006414372.1|  hypothetical protein EUTSA_v10025628mg           67.0    1e-11   
gb|AAA32939.1|  (1-3)-beta-glucanase                                  67.0    1e-11   Hordeum vulgare [barley]
emb|CDY06119.1|  BnaA09g36610D                                        67.0    1e-11   
ref|XP_003540349.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.6    1e-11   
ref|XP_002868146.1|  AT4g16260/dl4170c                                67.0    2e-11   
gb|AAF82288.1|  B-1,3-glucanase                                       65.1    2e-11   Castanea sativa
ref|NP_001234805.1|  glucan endo-1,3-beta-glucosidase B precursor     67.0    2e-11   
ref|XP_003548789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
ref|XP_009116429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.0    2e-11   
gb|ABK96486.1|  unknown                                               67.0    2e-11   Populus trichocarpa x Populus deltoides
ref|XP_004142554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
ref|NP_001045357.1|  Os01g0940800                                     66.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006599939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.8    2e-11   
ref|XP_010232796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  67.0    2e-11   
gb|EAY77172.1|  hypothetical protein OsI_05142                        66.6    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_002314934.2|  Glucan endo-1 family protein                     67.0    2e-11   Populus trichocarpa [western balsam poplar]
gb|ADW08743.1|  1,3-beta-D-glucanase GH17_44                          67.0    2e-11   
ref|XP_010449818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
gb|AHE76175.1|  beta-1,3-endoglucanase                                66.2    2e-11   
ref|XP_004232306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
ref|XP_010440186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
gb|AAD10383.1|  beta-1,3-glucanase precursor                          66.6    2e-11   Oryza sativa [red rice]
gb|ACD45060.1|  beta-1,3-glucanase                                    66.6    2e-11   Vitis riparia [frost grape]
ref|XP_011010204.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  67.0    2e-11   
ref|XP_002277446.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      66.6    2e-11   Vitis vinifera
ref|XP_009146295.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    2e-11   
ref|XP_010525511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.2    2e-11   
emb|CAJ58511.1|  glucan endo-1,3-beta-D-glucosidase                   65.5    3e-11   Secale cereale
emb|CDY32230.1|  BnaA01g17540D                                        66.2    3e-11   
ref|XP_007015137.1|  Glycosyl hydrolase superfamily protein, puta...  66.2    3e-11   
ref|XP_010654324.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.5    3e-11   
gb|EMT21042.1|  Glucan endo-1,3-beta-glucosidase GII                  65.9    3e-11   
ref|XP_004505799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.2    3e-11   
ref|XP_004154643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    3e-11   
ref|XP_004139045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.6    3e-11   
ref|XP_009349227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  66.2    3e-11   
emb|CAJ58513.1|  glucan endo-1,3-beta-D-glucosidase precursor         65.9    3e-11   Secale cereale
ref|XP_010248263.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    3e-11   
gb|ACZ74626.1|  beta-1,3-glucanase form RRII Gln 3                    66.2    3e-11   Hevea brasiliensis [jebe]
gb|AFJ97275.1|  beta-1,3-glucanase                                    66.2    3e-11   
gb|ABG49448.1|  beta-1,3-glucanase                                    66.2    3e-11   Hevea brasiliensis [jebe]
gb|ABJ74161.1|  beta-1,3-glucanase                                    65.9    3e-11   Hevea brasiliensis [jebe]
ref|XP_009363234.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.9    3e-11   
gb|AFJ97274.1|  beta-1,3-glucanase                                    66.2    3e-11   
emb|CDP14179.1|  unnamed protein product                              65.9    3e-11   
emb|CAJ58510.1|  glucan endo-1,3-beta-D-glucosidase                   65.9    3e-11   Secale cereale
gb|ABN09653.1|  beta-1,3-glucanase                                    66.2    4e-11   Hevea brasiliensis [jebe]
emb|CAJ58509.1|  glucan endo-1,3-beta-D-glucosidase                   65.9    4e-11   Secale cereale
gb|AAQ90286.1|  beta-1,3-glucanase, basic                             65.9    4e-11   Coffea arabica x Coffea canephora
emb|CAJ58507.1|  glucan endo-1,3-beta-D-glucosidase                   65.9    4e-11   Secale cereale
sp|P52407.2|E13B_HEVBR  RecName: Full=Glucan endo-1,3-beta-glucos...  66.2    4e-11   Hevea brasiliensis [jebe]
ref|XP_007035767.1|  Glycosyl hydrolase superfamily protein           66.6    4e-11   
ref|XP_004505796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  66.2    4e-11   
gb|AAP87281.1|  beta-1,3-glucanase                                    66.2    4e-11   Hevea brasiliensis [jebe]
gb|AGG39585.1|  beta-1,3-glucanase                                    65.5    4e-11   
gb|ABN09654.1|  beta-1,3-glucanase                                    66.2    4e-11   
gb|AAA87456.1|  beta-1,3-glucanase                                    66.2    4e-11   
sp|P52395.1|E13B_SOYBN  RecName: Full=Glucan endo-1,3-beta-glucos...  64.7    4e-11   
gb|AAX81589.1|  beta-1,3-glucanase                                    65.5    4e-11   
ref|XP_010653912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.9    4e-11   
dbj|BAF95876.1|  beta 1-3 glucanase                                   65.9    4e-11   
gb|KGN65972.1|  hypothetical protein Csa_1G555080                     66.6    5e-11   
ref|XP_010673697.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    5e-11   
gb|KEH37153.1|  glucan endo-1,3-beta-glucosidase                      65.5    5e-11   
ref|XP_010434858.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.5    5e-11   
gb|EAZ14802.1|  hypothetical protein OsJ_04729                        64.3    5e-11   
ref|XP_010279592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.9    5e-11   
ref|XP_010673701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    5e-11   
gb|EMS66867.1|  Glucan endo-1,3-beta-glucosidase GV                   66.2    5e-11   
ref|XP_010232805.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  65.5    5e-11   
ref|XP_003594774.1|  Glucan endo-1,3-beta-glucosidase                 65.5    5e-11   
ref|XP_010036311.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.5    5e-11   
gb|ABD32327.1|  Glycoside hydrolase, family 17                        65.5    5e-11   
ref|XP_010673690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    6e-11   
ref|XP_004505795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    6e-11   
gb|EMS55419.1|  Glucan endo-1,3-beta-glucosidase GIV                  63.9    6e-11   
ref|XP_010673696.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    6e-11   
dbj|BAD93486.1|  pollen allergen CJP38                                65.5    6e-11   
ref|XP_004505798.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    6e-11   
ref|XP_010921866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.5    6e-11   
ref|XP_002314939.2|  hypothetical protein POPTR_0010s15320g           65.1    6e-11   
gb|AAD04296.1|  basic extracellular beta-1,3-glucanase precursor      63.2    6e-11   
ref|XP_010921890.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  65.1    6e-11   
dbj|BAD88015.1|  putative beta 1,3-glucanase                          63.9    6e-11   
ref|XP_004173972.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.1    7e-11   
dbj|BAJ99108.1|  predicted protein                                    65.1    7e-11   
ref|XP_002459079.1|  hypothetical protein SORBIDRAFT_03g045510        65.1    8e-11   
dbj|BAK05898.1|  predicted protein                                    65.1    8e-11   
gb|EMS59989.1|  Glucan endo-1,3-beta-glucosidase GII                  64.3    8e-11   
gb|AAN60315.1|  unknown                                               64.7    8e-11   
gb|EAY77211.1|  hypothetical protein OsI_05182                        66.2    9e-11   
gb|AAA32755.1|  beta-1,3-glucanase 2                                  64.3    9e-11   
emb|CDP14184.1|  unnamed protein product                              64.7    9e-11   
ref|XP_003594771.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  64.7    9e-11   
emb|CDO98259.1|  unnamed protein product                              64.7    9e-11   
ref|XP_008392341.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    9e-11   
ref|XP_006645312.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  65.9    9e-11   
ref|XP_008459107.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    9e-11   
ref|XP_008800262.1|  PREDICTED: glucan endo-1,3-beta-glucosidase      64.7    9e-11   
ref|XP_004135753.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    1e-10   
ref|XP_008351633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    1e-10   
gb|ABD32329.1|  Glycoside hydrolase, family 17                        65.1    1e-10   
gb|ABK58141.1|  beta-1,3-glucanase                                    64.3    1e-10   
ref|XP_008360676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.7    1e-10   
emb|CDX76045.1|  BnaA04g03090D                                        63.9    1e-10   
ref|NP_193361.4|  putative beta-1,3-endoglucanase                     64.7    1e-10   
gb|EAZ14813.1|  hypothetical protein OsJ_04740                        64.3    1e-10   
gb|AIR93912.1|  glucanase                                             65.5    1e-10   
emb|CDP20081.1|  unnamed protein product                              63.9    1e-10   
gb|AAF34761.1|AF227953_1  basic beta-1,3-glucanase                    64.7    1e-10   
emb|CDY06122.1|  BnaA09g36580D                                        64.7    1e-10   
gb|AGW45300.1|  beta-1,3-glucanase                                    64.7    1e-10   
ref|XP_008674559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  64.3    1e-10   
ref|NP_191285.1|  beta 1,3-glucanase 2                                64.3    1e-10   
emb|CDM83512.1|  unnamed protein product                              64.3    1e-10   
gb|ACD45061.1|  beta-1,3-glucanase                                    64.3    1e-10   
gb|AFA26674.1|  beta-1,3-glucanase                                    63.9    1e-10   
gb|ADW08742.1|  1,3-beta-D-glucanase GH17_39                          64.3    1e-10   
gb|AAM63339.1|  beta-1,3-glucanase 2 (BG2) (PR-2)                     64.3    1e-10   
ref|XP_009139044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  64.3    1e-10   
gb|EAY77205.1|  hypothetical protein OsI_05174                        64.3    1e-10   
ref|NP_001045359.1|  Os01g0941400                                     64.3    1e-10   
ref|XP_002277193.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  64.3    1e-10   
gb|ABK23947.1|  unknown                                               64.3    1e-10   
gb|ADG56569.1|  beta-1,3-glucanase                                    64.3    1e-10   
gb|EMT22138.1|  Glucan endo-1,3-beta-glucosidase GIV                  64.3    1e-10   
gb|EMT07352.1|  hypothetical protein F775_52085                       64.7    1e-10   
emb|CDX72058.1|  BnaC08g28160D                                        63.5    2e-10   
ref|XP_008450480.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  62.4    2e-10   
gb|ADR71671.1|  beta-1,3-glucanase                                    64.3    2e-10   
pdb|4HPG|A  Chain A, Crystal Structure Of A Glycosylated Beta-1,3...  63.9    2e-10   
ref|XP_010097796.1|  Glucan endo-1,3-beta-glucosidase, basic vacu...  64.3    2e-10   
gb|ABN09655.1|  beta-1,3-glucanase                                    64.3    2e-10   
gb|ABN03966.1|  beta-1,3-glucanase                                    64.3    2e-10   
ref|XP_010090235.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  63.9    2e-10   
gb|ACY91851.1|  beta-1,3-glucanase form RRII Gln 2                    64.3    2e-10   
dbj|BAO09557.1|  beta-1,3-glucanase                                   63.9    2e-10   
ref|NP_001045371.2|  Os01g0944500                                     62.4    2e-10   
emb|CAJ58514.1|  glucan endo-1,3-beta-D-glucosidase precursor         63.5    2e-10   
ref|XP_010092376.1|  Glucan endo-1,3-beta-glucosidase, basic isoform  62.8    2e-10   
emb|CAJ58512.1|  glucan endo-1,3-beta-D-glucosidase                   63.2    2e-10   
ref|XP_003537741.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.9    2e-10   
gb|AAD10381.1|  beta-1,3-glucanase precursor                          63.5    2e-10   
emb|CAC40810.1|  Glu1 protein                                         63.5    2e-10   
ref|XP_010921893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.9    2e-10   
gb|KHN05500.1|  Glucan endo-1,3-beta-glucosidase                      63.5    2e-10   
gb|ABB04446.1|  pathogenesis-related protein 6                        63.5    2e-10   
gb|ABB04451.1|  pathogenesis-related protein 6                        63.5    2e-10   
ref|NP_001045356.1|  Os01g0940700                                     62.8    2e-10   
gb|ABB04444.1|  pathogenesis-related protein 6                        63.5    2e-10   
gb|ACJ62686.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62655.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62644.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62625.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ABB04445.1|  pathogenesis-related protein 6                        63.5    2e-10   
gb|ACJ62680.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62657.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ABA33845.1|  pathogenesis-related protein 6                        63.5    2e-10   
ref|XP_010273331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.9    2e-10   
gb|ABB04450.1|  pathogenesis-related protein 6                        63.5    2e-10   
ref|XP_010273332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.9    2e-10   
gb|AAO85268.1|  glucan endo-1,3-beta-D-glucosidase                    63.5    2e-10   
gb|ACJ62628.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62624.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ABA33843.1|  pathogenesis-related protein 6                        63.5    2e-10   
tpg|DAA55874.1|  TPA: putative O-Glycosyl hydrolase superfamily p...  63.5    2e-10   
ref|XP_010232806.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  62.0    2e-10   
gb|ABA33838.1|  pathogenesis-related protein 6                        63.5    2e-10   
dbj|BAB63852.1|  putative beta 1,3-glucanase                          62.4    2e-10   
gb|ACJ62668.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ACJ62688.1|  beta 1,3 glucanase                                    63.5    2e-10   
gb|ABA33840.1|  pathogenesis-related protein 6                        63.5    2e-10   
emb|CDX72059.1|  BnaC08g28150D                                        63.5    2e-10   
gb|KFK36125.1|  hypothetical protein AALP_AA4G081000                  63.5    2e-10   
gb|EAY90914.1|  hypothetical protein OsI_12531                        63.9    2e-10   
ref|XP_002456922.1|  hypothetical protein SORBIDRAFT_03g045630        63.5    2e-10   
gb|ACJ84752.1|  unknown                                               63.5    3e-10   
ref|XP_004295093.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  63.5    3e-10   
emb|CDX72057.1|  BnaC08g28170D                                        63.5    3e-10   
ref|XP_011083775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  63.5    3e-10   
gb|ACJ62631.1|  beta 1,3 glucanase                                    63.5    3e-10   
ref|NP_001268153.1|  beta 1-3 glucanase precursor                     63.5    3e-10   
ref|XP_009106160.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.5    3e-10   
gb|AAG24921.1|AF311749_1  beta-1,3-glucanase                          63.2    3e-10   
gb|AAV64847.1|  beta-1,3-glucanase                                    61.6    3e-10   
emb|CAA92278.1|  1,3-beta-glucanase                                   63.2    3e-10   
ref|XP_008811757.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.2    3e-10   
emb|CAB38443.1|  beta-1,3-glucanase                                   63.2    3e-10   
ref|XP_009767610.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  63.2    3e-10   
ref|XP_010277204.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  63.2    3e-10   
ref|NP_001045363.1|  Os01g0942300                                     61.2    4e-10   
gb|KDP26100.1|  hypothetical protein JCGZ_21133                       63.2    4e-10   
ref|XP_011039449.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  63.2    4e-10   
gb|AAD10382.1|  beta-1,3-glucanase precursor                          63.2    4e-10   
ref|XP_011013086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  63.2    4e-10   
ref|XP_006353388.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  63.2    4e-10   
ref|XP_009106159.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.5    4e-10   
gb|KHN03123.1|  Glucan endo-1,3-beta-glucosidase                      62.8    4e-10   
ref|XP_009116431.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  63.2    4e-10   
gb|KDP26103.1|  hypothetical protein JCGZ_21136                       63.2    4e-10   
dbj|BAA77783.1|  beta 1,3-glucanase                                   62.8    4e-10   
ref|XP_006599943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  63.2    4e-10   
ref|XP_006843459.1|  hypothetical protein AMTR_s00053p00184360        61.6    4e-10   
ref|XP_009350958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.8    4e-10   
emb|CBI30054.3|  unnamed protein product                              62.8    5e-10   
gb|EMT22139.1|  Glucan endo-1,3-beta-glucosidase GIV                  63.2    5e-10   
ref|XP_010907250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  62.8    5e-10   
ref|XP_010653914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.8    5e-10   
ref|XP_010516338.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.8    5e-10   
emb|CDM83513.1|  unnamed protein product                              62.8    5e-10   
emb|CAD29732.2|  beta-1,3-glucanase                                   60.5    5e-10   
ref|XP_010673694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  62.8    5e-10   
gb|EMT00750.1|  Glucan endo-1,3-beta-glucosidase GII                  62.4    5e-10   
emb|CDX88937.1|  BnaA04g02490D                                        62.8    5e-10   
ref|XP_002878139.1|  beta-1,3-glucanase 3                             62.4    6e-10   
ref|XP_009399970.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  62.4    6e-10   
gb|ADM78602.1|  glycosyl hydrolase-like protein                       60.5    6e-10   
gb|ADM78576.1|  glycosyl hydrolase-like protein                       60.5    6e-10   
gb|AEQ01058.1|  putative endo-beta-1,3-glucanase                      62.8    6e-10   
gb|ABB04449.1|  truncated pathogenesis-related protein 6              62.4    6e-10   
gb|AAQ57194.1|  beta-1,3-endoglucanase                                59.7    6e-10   
ref|XP_002441397.1|  hypothetical protein SORBIDRAFT_09g025890        62.4    6e-10   
gb|ADE77425.1|  unknown                                               60.8    7e-10   
gb|ACJ62674.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62652.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62646.1|  beta 1,3 glucanase                                    62.4    7e-10   
ref|XP_011084419.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  60.8    7e-10   
gb|ACJ62645.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62662.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62694.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ABB04442.1|  pathogenesis-related protein 6                        62.4    7e-10   
gb|ABB04447.1|  pathogenesis-related protein 6                        62.4    7e-10   
ref|XP_006365201.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.4    7e-10   
ref|XP_002964073.1|  hypothetical protein SELMODRAFT_34417            62.4    7e-10   
gb|ACJ62636.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62630.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62629.1|  beta 1,3 glucanase                                    62.4    7e-10   
ref|XP_002975448.1|  hypothetical protein SELMODRAFT_103323           62.4    7e-10   
ref|XP_010504652.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.4    7e-10   
gb|ACJ62696.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62691.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62633.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ABB04452.1|  pathogenesis-related protein 6                        62.4    7e-10   
gb|ACJ62663.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62661.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62685.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62673.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62647.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ABB04443.1|  pathogenesis-related protein 6                        62.4    7e-10   
ref|XP_010938735.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  60.8    7e-10   
gb|ABB04448.1|  pathogenesis-related protein 6                        62.4    7e-10   
gb|ABB04441.1|  pathogenesis-related protein 6                        62.4    7e-10   
ref|XP_006843462.1|  hypothetical protein AMTR_s00053p00185420        62.0    7e-10   
gb|ACJ62638.1|  beta 1,3 glucanase                                    62.4    7e-10   
ref|XP_002277173.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.4    7e-10   
gb|ACJ62639.1|  beta 1,3 glucanase                                    62.4    7e-10   
gb|ACJ62690.1|  beta 1,3 glucanase                                    62.4    8e-10   
gb|ACJ62642.1|  beta 1,3 glucanase                                    62.4    8e-10   
gb|ACJ62632.1|  beta 1,3 glucanase                                    62.4    8e-10   
ref|XP_008450392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  60.5    8e-10   
ref|XP_011083774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.4    8e-10   
ref|XP_010232812.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  62.4    8e-10   
ref|XP_009139042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  62.4    8e-10   
ref|XP_008240766.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.4    9e-10   
ref|XP_008240767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...  62.0    9e-10   
gb|ABM74067.1|  beta-1,3-glucanase 1                                  62.0    9e-10   
gb|EMS68075.1|  Glucan endo-1,3-beta-glucosidase GII                  61.6    9e-10   
gb|KDP26099.1|  hypothetical protein JCGZ_21132                       61.6    1e-09   
ref|XP_008811763.1|  PREDICTED: putative glucan endo-1,3-beta-glu...  62.0    1e-09   
ref|XP_004971233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  62.0    1e-09   
ref|XP_002984097.1|  hypothetical protein SELMODRAFT_234441           62.0    1e-09   
ref|XP_007028619.1|  Glucan endo-1,3-beta-glucosidase, putative       62.0    1e-09   
gb|KFK34963.1|  hypothetical protein AALP_AA5G216700                  62.8    1e-09   
emb|CAI64809.1|  putative glucan endo-1,3-beta-D-glucosidase          61.6    1e-09   
ref|XP_002961410.1|  hypothetical protein SELMODRAFT_403265           61.6    1e-09   
gb|ABK25991.1|  unknown                                               61.6    1e-09   



>sp|P52397.1|E13J_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
PR-O; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
AltName: Full=PR-37, partial [Nicotiana tabacum]
 gb|AAA34102.1| PR0, partial [Nicotiana tabacum]
Length=160

 Score = 85.1 bits (209),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  60   LDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAG  113



>pir||E38257 glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), acidic  (clone 
cI32) - common tobacco (cv. Samsun NN) (fragment)
Length=162

 Score = 85.1 bits (209),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  62   LDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAG  115



>sp|P52398.1|E13K_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL161; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAA34053.1| beta-1,3-glucanase [Nicotiana tabacum]
Length=331

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  223  LDSMYFAVEKAGGPNVEIIVSESGWPSEGSSAATIENAQTYYRNLINHVKSGAG  276



>gb|AAD33880.1|AF141653_1 beta-1,3-glucanase [Nicotiana tabacum]
Length=351

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGPNVEIIVSESGWPSEGSSAATIENAQTYYRNLINHVKSGAG  296



>ref|XP_009801409.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL161 
[Nicotiana sylvestris]
Length=351

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGPNVEIIVSESGWPSEGSSAATIENAQTYYRNLINHVKSGAG  296



>ref|XP_009596559.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=351

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNL+ HVKG AG
Sbjct  247  LDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAG  300



>sp|P23432.1|E13C_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38302.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
 emb|CAA57255.1| (1-)-beta-glucanase [Nicotiana tabacum]
Length=351

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNL+ HVKG AG
Sbjct  247  LDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAG  300



>sp|P23433.1|E13D_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38303.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
Length=351

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNL+ HVKG AG
Sbjct  247  LDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAG  300



>sp|P52399.1|E13L_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL153; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAD33881.1|AF141654_1 beta-1,3-glucanase [Nicotiana tabacum]
 gb|AAA34079.1| GL153 [Nicotiana tabacum]
Length=356

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAG  296



>ref|XP_009607576.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL153 
[Nicotiana tomentosiformis]
Length=356

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAG  296



>ref|XP_009796657.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana sylvestris]
Length=351

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNL+ HVKG AG
Sbjct  247  LDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAG  300



>ref|XP_009619948.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana tomentosiformis]
Length=343

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGGPN+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGPNVEIIVSESGWPSEGNSAATIENAQTYYRNLIDHVKRGAG  296



>pir||D38257 glucan endo-1,3-beta-D-glucosidase (EC 3.2.1.39), acidic  (clone 
cI30) - common tobacco (cv. Samsun NN) (fragment)
Length=162

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  62   LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYRNLINHVKSGAG  115



>ref|XP_009374912.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=335

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++KAG PNI IVVSESGWPS+GG  ATAQNAAT+Y+NLI+HV  N G
Sbjct  235  LDAQYSALEKAGAPNIEIVVSESGWPSEGGNQATAQNAATFYQNLISHVTSNTG  288



>ref|XP_009780913.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Nicotiana sylvestris]
Length=343

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYYRNLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYRNLINHVKSGAG  296



>gb|KHN05499.1| Glucan endo-1,3-beta-glucosidase, acidic isoform GL153 [Glycine 
soja]
Length=340

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K G PN+ +VVSESGWPS+GG  AT QNA TYYRNLI H KG
Sbjct  242  LDSLYAALEKVGAPNVKVVVSESGWPSEGGVGATVQNAGTYYRNLINHAKG  292



>gb|ACU20860.1| unknown [Glycine max]
Length=340

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K G PN+ +VVSESGWPS+GG  AT QNA TYYRNLI H KG
Sbjct  242  LDSLYAALEKVGAPNVKVVVSESGWPSEGGVGATVQNAGTYYRNLINHAKG  292



>ref|NP_001237271.1| endo-1,3-beta-glucanase precursor [Glycine max]
 gb|AAR26001.1| endo-1,3-beta-glucanase [Glycine max]
Length=340

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K G PN+ +VVSESGWPS+GG  AT QNA TYYRNLI H KG
Sbjct  242  LDSLYAALEKVGAPNVKVVVSESGWPSEGGVGATVQNAGTYYRNLINHAKG  292



>ref|XP_009794864.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-O-like, 
partial [Nicotiana sylvestris]
Length=116

 Score = 79.0 bits (193),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y A++KAGG N+PIVVSESGWPSDGG  A+  NA TYY NLI+HVK  AG
Sbjct  17   LDATYYAIEKAGGENLPIVVSESGWPSDGGDGASIDNAGTYYTNLISHVKSGAG  70



>dbj|BAE53384.1| beta-1,3-glucanase [Sesbania rostrata]
Length=339

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K G PN+ +VVSESGWPS+GG  AT QNA TYYRNLI H KG
Sbjct  241  LDSLYAALEKVGAPNVKVVVSESGWPSEGGTGATVQNAGTYYRNLIRHAKG  291



>ref|XP_009592823.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=345

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y AV+KAGG N+ IVV+ESGWPSDGGF A+ +NA TYYRNLI+HVK  AG
Sbjct  240  LDATYYAVEKAGGDNVQIVVAESGWPSDGGFGASMENAGTYYRNLISHVKLGAG  293



>ref|XP_009790797.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=340

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y AV+KAGG N+ IVV+ESGWPSDGGF A+ +NA TYYRNLI+HVK  AG
Sbjct  240  LDATYYAVEKAGGDNVQIVVAESGWPSDGGFGASMKNAGTYYRNLISHVKLGAG  293



>dbj|BAE53383.1| beta-1,3-glucanase [Sesbania rostrata]
Length=343

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++KAG  N+ +VVSESGWPSDGG AA   NA TYYRNLI HVKG
Sbjct  245  LDSLYAALEKAGASNVNVVVSESGWPSDGGVAANVDNAGTYYRNLINHVKG  295



>gb|ABK95326.1| unknown [Populus trichocarpa]
Length=338

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++KAG P++ IVVSESGWPS+GG AATA NA T+YRNLI HVK
Sbjct  241  LDSLYAALEKAGAPDLNIVVSESGWPSEGGTAATADNAGTFYRNLINHVK  290



>ref|XP_002299791.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE84596.2| 3-glucanase family protein [Populus trichocarpa]
Length=338

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++KAG P++ IVVSESGWPS+GG AATA NA T+YRNLI HVK
Sbjct  241  LDSLYAALEKAGAPDLNIVVSESGWPSEGGTAATADNAGTFYRNLINHVK  290



>sp|P52396.1|E13I_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
PR-N; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
partial [Nicotiana tabacum]
 gb|AAA34105.1| PRN, partial [Nicotiana tabacum]
Length=275

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  175  LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAG  228



>ref|XP_008363318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++KAG PNI IVVSESGWPS+GG  ATAQNAAT+Y+NLI+HV    G
Sbjct  248  LDAQYSALEKAGAPNIEIVVSESGWPSEGGNQATAQNAATFYQNLISHVTSTTG  301



>ref|XP_009775775.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana sylvestris]
Length=343

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAG  296



>gb|AAA34103.1| PR2 [Nicotiana tabacum]
Length=343

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAG  296



>sp|P23547.1|E13G_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GI9; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
AltName: Full=PR-2B; AltName: Full=PR-36; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAA63542.1| acidic beta-1,3-glucanase [Nicotiana tabacum]
Length=343

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY AV+KAGG N+ I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  243  LDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAG  296



>ref|XP_011001638.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++KAG PN+ IVVSESGWPS+GG AAT  NA T+YRNLI H K
Sbjct  241  LDSLYAALEKAGAPNLNIVVSESGWPSEGGTAATVDNAGTFYRNLINHAK  290



>ref|XP_011045404.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++KAG PN+ IVVSESGWPS+GG AAT  NA T+YRNLI H K
Sbjct  241  LDSLYAALEKAGAPNLNIVVSESGWPSEGGTAATVDNAGTFYRNLINHAK  290



>gb|KHN05498.1| Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform [Glycine 
soja]
Length=345

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGG-FAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K G PN+ +VVSESGWPS+GG  AAT QNA TYYRNLI+H KG
Sbjct  236  LDSVYAALEKVGAPNVTVVVSESGWPSEGGAVAATVQNAGTYYRNLISHAKG  287



>ref|XP_007132239.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
 gb|ESW04233.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
Length=332

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++K G  N+ +VVSESGWPS GG  AT QNA TYYRNLI HVKG
Sbjct  234  VDSLYAALEKVGASNVKVVVSESGWPSQGGVGATVQNAGTYYRNLIKHVKG  284



>ref|XP_008366411.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWPS+GG  AT QNAAT+Y+NLI HV    G
Sbjct  248  LDAQYAALEKAGAPNVEIVVSESGWPSEGGNQATPQNAATFYQNLIKHVTSTTG  301



>ref|XP_009587943.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=340

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y AV+KAGG N+PIV+SESGWPSDGG  A+  NA TYY NLI+HVK  AG
Sbjct  237  LDATYYAVEKAGGENLPIVISESGWPSDGGDGASIDNAGTYYSNLISHVKSGAG  290



>ref|XP_010101247.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88171.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=341

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++K   P++ IVVSESGWPS+G  AAT  NA TYYRNLIAHVKG
Sbjct  244  LDALYAALEKVNAPDVKIVVSESGWPSEGDSAATTNNAGTYYRNLIAHVKG  294



>gb|KHN05501.1| Glucan endo-1,3-beta-glucosidase, acidic isoform PR-O [Glycine 
soja]
Length=111

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAAV+K G PN+ IVVSESGWPS+GG  A+ +NA TYY NLI HV    G
Sbjct  2    LDSIYAAVEKVGAPNLKIVVSESGWPSEGGDGASIENARTYYSNLIDHVSSGNG  55



>ref|XP_007211511.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
 gb|EMJ12710.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
Length=349

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++KA  PN+ IVVSESGWPS+G  AAT QNA T+Y+NLI HVKG  G
Sbjct  249  LDAQYSALEKANAPNVEIVVSESGWPSEGSDAATTQNAQTFYQNLINHVKGTTG  302



>ref|XP_010101245.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88169.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=326

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++K   P++ IVVSESGWPS+G  AAT  NA TYYRNLIAHVKG
Sbjct  229  LDALYAALEKVKAPDVKIVVSESGWPSEGDSAATTNNAGTYYRNLIAHVKG  279



>ref|XP_008373020.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWPS+GG  AT QNAAT+Y+NLI HV    G
Sbjct  247  LDAQYAALEKAGAPNMEIVVSESGWPSEGGDQATPQNAATFYQNLINHVTSTTG  300



>ref|XP_008356363.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWPS+GG  AT QNAAT+Y+NLI HV    G
Sbjct  247  LDAQYAALEKAGAPNMEIVVSESGWPSEGGDQATPQNAATFYQNLINHVTSTTG  300



>ref|XP_010045033.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=339

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +DS+Y+A++KAGG ++PIVVSESGWPS+GG AA+ +NA TYY NLI+HVK
Sbjct  242  VDSLYSALEKAGGSSLPIVVSESGWPSEGGTAASPENAGTYYANLISHVK  291



>ref|XP_009366077.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=348

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWPS+GG  AT +NAAT+Y+NLI HV    G
Sbjct  248  LDAQYAALEKAGAPNVEIVVSESGWPSEGGNQATPENAATFYQNLIKHVTSTTG  301



>ref|XP_004962627.1| PREDICTED: glucan endo-1,3-beta-glucosidase GII-like [Setaria 
italica]
Length=331

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  160  DSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            D+MY A++K GG N+PIVVSESGWPSDGGF A+ QNA TY +NLI HV
Sbjct  234  DAMYTAMEKVGGSNVPIVVSESGWPSDGGFGASVQNAQTYNQNLIHHV  281



>ref|XP_009764461.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y AV+KAGG N+PIVVSESGWPSDGG  A+  NA  YY NLI+HVK  AG
Sbjct  236  LDATYYAVEKAGGENLPIVVSESGWPSDGGDGASIDNAGIYYTNLISHVKSGAG  289



>dbj|BAM28606.1| beta-1,3-glucanase [Nepenthes alata]
Length=340

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAAV + G PN+ +VVSESGWPSDGG AAT  NA+TY +NLI HVKG
Sbjct  243  VDSVYAAVARVGAPNLAVVVSESGWPSDGGTAATVDNASTYIKNLINHVKG  293



>ref|XP_003607319.1| Endo-beta-1 3-glucanase [Medicago truncatula]
 gb|AES89516.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K GG ++ IVVSESGWPSDGG +A+  NA+TYY+NLI HVK
Sbjct  232  LDSVYAALEKVGGTDVKIVVSESGWPSDGGDSASTDNASTYYQNLINHVK  281



>ref|XP_006365629.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=348

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS Y A++KAGGPN+ IVVSE+GWPS+G  +AT +NA  YYRNL+ HVK   G
Sbjct  244  LDSTYFAIEKAGGPNVEIVVSETGWPSNGHPSATLENAQIYYRNLVNHVKSGVG  297



>ref|XP_004228512.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=348

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y A++KAGGPN+ IVVSE+GWPS G  +AT +NA  YYRNL+ HVK   G
Sbjct  244  LDSIYFALEKAGGPNVEIVVSETGWPSKGHPSATLENAQIYYRNLVNHVKSGVG  297



>gb|KDP22122.1| hypothetical protein JCGZ_25953 [Jatropha curcas]
Length=333

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+GG ++ IVVSESGWPS+GG AAT  NA TYY+NLI+HVK
Sbjct  236  LDSVYAALEKSGGGSLQIVVSESGWPSEGGDAATPDNAGTYYKNLISHVK  285



>gb|KEH30624.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=331

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K GG N+ IVVSESGWPS GG  A+A NA TYY NLI HVKG
Sbjct  233  LDSIYAALEKVGGSNVKIVVSESGWPSQGGTGASAGNAGTYYGNLIKHVKG  283



>ref|NP_001234798.1| glucan endo-1,3-beta-glucosidase A precursor [Solanum lycopersicum]
 sp|Q01412.1|E13A_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase A; AltName: Full=(1->3)-beta-glucan 
endohydrolase A; Short=(1->3)-beta-glucanase 
A; AltName: Full=Acidic beta-1,3-glucanase; AltName: 
Full=Beta-1,3-endoglucanase A; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03617.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=336

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  +AT +NA TYY NLI HVKG AG
Sbjct  236  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPSATLENAMTYYTNLINHVKGGAG  289



>gb|EYU35916.1| hypothetical protein MIMGU_mgv1a009371mg [Erythranthe guttata]
Length=344

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D+MY+A +KAGG ++ IVVSESGWPSDGG AAT +NA  YYRNLI HV
Sbjct  243  VDAMYSATEKAGGGSVEIVVSESGWPSDGGVAATVENAGVYYRNLIGHV  291



>gb|AAN78310.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=326

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  +AT +NA TYY NLI HVKG AG
Sbjct  226  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPSATLENARTYYTNLINHVKGGAG  279



>gb|AAS79332.1| beta 1-3 glucanase PR2 [Malus domestica]
Length=245

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWPS+GG  AT QNAAT+ +NLI HV    G
Sbjct  168  LDAQYAALEKAGAPNMEIVVSESGWPSEGGDQATPQNAATFCQNLINHVTSTTG  221



>ref|XP_011090470.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=404

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D +Y+A++KAGG ++ +VVSESGWPSDGG AAT +NA TYYRNLI HVK
Sbjct  220  VDGVYSALEKAGGGDVEVVVSESGWPSDGGVAATRENAETYYRNLIDHVK  269



>ref|XP_006365633.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like, partial [Solanum 
tuberosum]
Length=316

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  +AT +NA TYY NLI HVKG AG
Sbjct  216  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPSATLENARTYYTNLINHVKGGAG  269



>ref|XP_007015136.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32755.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=347

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+Y+A++K G  N+ IVVSESGWPS GG AAT +NA+TYY+NLI HVK
Sbjct  249  LDSLYSALEKIGAANLEIVVSESGWPSAGGTAATVENASTYYKNLIKHVK  298



>gb|AFP23132.1| beta-1,3-glucanase [Pyrus pyrifolia]
Length=348

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAG PN+ IVVSESGWP +GG  AT +NAAT+Y+NLI HV    G
Sbjct  248  LDAQYAALEKAGAPNVEIVVSESGWPFEGGNQATPENAATFYQNLIKHVTSTTG  301



>dbj|BAG34628.1| beta-1,3-glucanase [Lotus japonicus]
Length=330

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD +YAA++KAG P++ +VVSESGWPS GG AA  QNA +YY+NLI HVKG
Sbjct  232  LDGVYAALEKAGTPDMKVVVSESGWPSAGGDAANVQNAESYYKNLIQHVKG  282



>ref|XP_006367558.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like [Solanum tuberosum]
Length=352

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDSMY A +K GG NI I+VSESGWPS+G  A T +NA TYY NLI HVKG  G
Sbjct  252  LDSMYFATEKLGGQNIEIIVSESGWPSEGHPAITLENAQTYYTNLINHVKGGVG  305



>ref|XP_010692567.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=341

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++YAA+ +AG PN  IVVSESGWPS+GG AAT+ NA TYYRNLI HV 
Sbjct  243  LDAVYAALGRAGAPNTAIVVSESGWPSEGGNAATSDNAGTYYRNLIGHVS  292



>ref|XP_008227211.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=336

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++KA  P++ IVVSESGWPS+G   AT QNA T+Y+NLI HVKG  G
Sbjct  236  LDAQYSALEKANAPDVEIVVSESGWPSEGDDVATPQNAQTFYQNLINHVKGTTG  289



>ref|XP_007133418.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
 gb|ESW05412.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
Length=337

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS YAA++K G  ++ IVVSESGWPS GG AA+ QNAATYY NLI+H KG  G
Sbjct  237  LDSTYAALEKMGASDVKIVVSESGWPSAGGDAASTQNAATYYANLISHAKGGNG  290



>emb|CAA08910.1| glucan endo-1,3-beta-D-glucosidase [Solanum tuberosum]
Length=347

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  +AT +NA TYY NLI HVKG  G
Sbjct  236  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPSATLENARTYYTNLINHVKGGTG  289



>gb|AES89518.2| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=421

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K GG N+ IVVSESGWPS GG +A+  NAATYY NLI H+K
Sbjct  306  LDSVYAALEKVGGSNVKIVVSESGWPSKGGDSASIDNAATYYSNLINHIK  355



>pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR7|B Chain B, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|A Chain A, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|B Chain B, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Length=323

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  215  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPAATLKNARTYYTNLINHVKRGAG  268



>gb|AAL30420.1|AF434173_1 glucanase [Sambucus nigra]
Length=340

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ YAA++KAGGPN+ IVVSESGWP+ G   AT  NA TY  NLI HVKG +G
Sbjct  241  LDAHYAALEKAGGPNVEIVVSESGWPTQGHPVATIDNAKTYNNNLIRHVKGRSG  294



>ref|XP_003607321.1| Endo-beta-1 3-glucanase [Medicago truncatula]
Length=398

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K GG N+ IVVSESGWPS GG +A+  NAATYY NLI H+K
Sbjct  283  LDSVYAALEKVGGSNVKIVVSESGWPSKGGDSASIDNAATYYSNLINHIK  332



>gb|AFK41254.1| unknown [Lotus japonicus]
Length=343

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD +YAA++KAG P + +VVSESGWPS GG AA  QNA +YY+NLI HVKG
Sbjct  245  LDGVYAALEKAGAPYMKVVVSESGWPSAGGDAANVQNAESYYKNLIQHVKG  295



>emb|CAE52322.1| 1,3-beta-D-glucan glucanohydrolase precursor [Solanum tuberosum]
Length=338

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  238  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPAATLKNARTYYTNLINHVKRGAG  291



>gb|AAN78309.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=337

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VSESGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  237  VDSMYFATEKLGGQNIEIIVSESGWPSEGHPAATLKNARTYYTNLINHVKRGAG  290



>ref|XP_010673693.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
 emb|CAA53545.1| glucan endo-1,3-beta-D-glucosidase [Beta vulgaris subsp. vulgaris]
Length=336

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D++YAA+ KAG PN+PIVVSESGWPS GG AA+  NA TYY+ LI HVK
Sbjct  238  VDTVYAALAKAGAPNVPIVVSESGWPSAGGNAASFSNAGTYYKGLIGHVK  287



>ref|XP_007015119.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32738.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=352

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG  N+ +VVSE+GWPSDGG AAT +NA+TYY+NLI H++
Sbjct  254  LDAFYSAIEKAGFSNMEVVVSETGWPSDGGTAATIENASTYYQNLINHIQ  303



>gb|EMT00138.1| Glucan endo-1,3-beta-glucosidase GIII [Aegilops tauschii]
Length=157

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DS+YAA++KAG P + +V+SESGWPSD GF ATAQNA TY + LI HV
Sbjct  61   VDSIYAALEKAGKPGVKVVISESGWPSDEGFGATAQNARTYNQGLINHV  109



>ref|XP_006423938.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|ESR37178.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|KDO56353.1| hypothetical protein CISIN_1g048613mg [Citrus sinensis]
Length=336

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD++Y+A++KAG P++ +VVSE+GWPS+GG AAT  NA TYY+N+I HV
Sbjct  239  LDALYSALEKAGAPDVEVVVSETGWPSEGGDAATVDNANTYYKNMINHV  287



>ref|XP_006367559.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=346

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS Y A++KAGGPN+ IVVSE+ WPS+G  +A  +NA  YYRNL+ HVK   G
Sbjct  242  LDSTYFAIEKAGGPNVEIVVSETSWPSNGHPSAMPENAQIYYRNLVNHVKSGVG  295



>ref|XP_006446183.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
 gb|ESR59423.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
Length=316

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD++Y+A++KAG P++ +VVSE+GWPS+GG AAT  NA+TYY+N+I HV
Sbjct  219  LDALYSALEKAGVPDLEVVVSETGWPSEGGEAATVDNASTYYKNVINHV  267



>ref|NP_001266064.1| glucan endo-1,3-beta-glucosidase-like precursor [Cicer arietinum]
 emb|CAA10167.1| glucan endo-1,3-beta-d-glucosidase [Cicer arietinum]
Length=331

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAA++K GG N+ IVVSESGWPS GG  A+  NA TYY NLI H KG
Sbjct  233  LDSIYAALEKVGGSNVKIVVSESGWPSQGGTGASVGNAQTYYGNLIKHAKG  283



>ref|XP_006480384.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=378

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD++Y+A++KAG P++ +VVSE+GWPS+GG AAT  NA TYY+N+I HV
Sbjct  281  LDALYSALEKAGAPDVEVVVSETGWPSEGGDAATVDNANTYYKNMINHV  329



>ref|XP_004297245.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+GG AAT  NA TYY  LI HVK
Sbjct  237  LDTHYSALEKAGAPNMAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK  286



>gb|AAB05226.1| beta 1-3 glucanase, partial [Nicotiana glutinosa]
Length=171

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  54   LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  103



>gb|AAO16642.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=347

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+GG AAT  NA TYY  LI HVK
Sbjct  249  LDTHYSALEKAGAPNMAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK  298



>gb|KDO61190.1| hypothetical protein CISIN_1g048190mg [Citrus sinensis]
Length=336

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD++Y+A++KAG P++ +VVSE+GWPS+GG AAT  NA+TYY+N+I HV
Sbjct  239  LDALYSALEKAGVPDLEVVVSETGWPSEGGEAATVDNASTYYKNVINHV  287



>emb|CBI17186.3| unnamed protein product [Vitis vinifera]
Length=325

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D+ YAA++KAGG  + IV+SESGWPSDGG AAT +NA TYY NL+ HV
Sbjct  232  VDAFYAALEKAGGTALDIVISESGWPSDGGVAATMENAKTYYTNLVYHV  280



>ref|XP_006470762.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=347

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD++Y+A++KAG P++ +VVSE+GWPS+GG AAT  NA+TYY+N+I HV
Sbjct  250  LDALYSALEKAGVPDLEVVVSETGWPSEGGEAATVDNASTYYKNVINHV  298



>emb|CAE53273.1| 1,3-beta-glucan glucanohydrolase [Solanum tuberosum]
Length=338

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDSMY A++K G  NI I+VSESGWPS G  AAT +NA TYY NLI HVKG
Sbjct  238  LDSMYFAMEKLGAQNIEIIVSESGWPSVGHPAATLENARTYYTNLINHVKG  288



>gb|AAP12732.1| putative beta-1,3-endoglucanase [Triticum aestivum]
Length=89

 Score = 68.2 bits (165),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  7    VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  57



>gb|ABD85024.1| beta-1,3-glucanase [Lilium hybrid division VII]
Length=337

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++Y+A++ AGGPN+P+VVSESGWPS GG AAT  NA TY  NLI HV
Sbjct  240  VDALYSALESAGGPNVPVVVSESGWPSAGGTAATVSNAQTYNSNLINHV  288



>ref|XP_007212652.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
 gb|EMJ13851.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
Length=337

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++Y+A++KAGG ++ IVVSE+GWPS+GG  AT +NA+TYY+NLI  VKG
Sbjct  218  VDALYSALEKAGGSSVEIVVSETGWPSEGGEGATVENASTYYKNLIDSVKG  268



>ref|XP_003632274.2| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Vitis vinifera]
Length=331

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D+ YAA++KAGG  + IV+SESGWPSDGG AAT +NA TYY NL+ HV
Sbjct  238  VDAFYAALEKAGGTALDIVISESGWPSDGGVAATMENAKTYYTNLVYHV  286



>ref|XP_006291444.1| hypothetical protein CARUB_v10017580mg [Capsella rubella]
 gb|EOA24342.1| hypothetical protein CARUB_v10017580mg [Capsella rubella]
Length=340

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K GG ++ IVVSESGWP++GGF A+ +NA TY  NLI HVK
Sbjct  243  LDSVYAALEKLGGGSMDIVVSESGWPTEGGFGASVENAKTYVNNLIQHVK  292



>ref|XP_008227227.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=343

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++KA   N+ IVVSESGWPS GG AAT +NA T+Y+NLI HV G +G
Sbjct  235  LDAQYSALEKANASNVEIVVSESGWPSKGGDAATPKNAQTFYQNLINHVTGTSG  288



>gb|KGN66505.1| hypothetical protein Csa_1G616230 [Cucumis sativus]
Length=74

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D++Y A++K GG  + IV+SESGWPS GG  AT +NA TYYRNLI+ V+
Sbjct  2    VDALYVALEKLGGAKVSIVISESGWPSGGGNGATIENAGTYYRNLISFVR  51



>gb|AAY34778.2| beta-1,3-glucanase [Panax ginseng]
Length=264

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGF-AATAQNAATYYRNLIAHVKGNAG  2
            +D  Y+A++KAGGPN+ +VVSESGWPS GG   A+ +NA TYY+NLI HV+G  G
Sbjct  163  VDVQYSALEKAGGPNVEVVVSESGWPSAGGINDASVENAQTYYQNLINHVRGGNG  217



>emb|CAN71821.1| hypothetical protein VITISV_027077 [Vitis vinifera]
Length=335

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D+ YAA++KAGG  + IV+SESGWPSDGG AAT +NA TYY NL+ HV
Sbjct  241  VDAFYAALEKAGGTALDIVISESGWPSDGGVAATMENAKTYYTNLVYHV  289



>ref|XP_003607316.1| Glucan endo-1 3-beta-d-glucosidase [Medicago truncatula]
 gb|AES89513.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K G   + IVVSESGWPS GG +A+  NAATYYRNLI HV+
Sbjct  232  LDSVYAALEKVGASGVKIVVSESGWPSAGGDSASTDNAATYYRNLINHVR  281



>ref|XP_009589771.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=335

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y A++K GG NI IVV+ESGWPSDGGF A+ +NA TYY NL  HVK   G
Sbjct  235  LDAQYYALEKVGGNNIEIVVAESGWPSDGGFGASMENAGTYYINLNNHVKSGGG  288



>ref|XP_004291760.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=346

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+G  AAT  NA TYY NLI HVK
Sbjct  248  LDTHYSALEKAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK  297



>ref|XP_006843457.1| hypothetical protein AMTR_s00053p00181850 [Amborella trichopoda]
 gb|ERN05132.1| hypothetical protein AMTR_s00053p00181850 [Amborella trichopoda]
Length=293

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAH  20
            +DS+Y A++KAG   +PIVVSESGWPSDGGFAAT +NA TY  NL+ H
Sbjct  197  VDSVYFAMEKAGSGGVPIVVSESGWPSDGGFAATKENAQTYNSNLVRH  244



>dbj|BAC66185.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+G  AAT  NA TYY NLI HVK
Sbjct  248  LDTHYSALEKAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK  297



>dbj|BAC66141.1| beta-1,3-glucanase [Fragaria x ananassa]
 dbj|BAC66184.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+G  AAT  NA TYY NLI HVK
Sbjct  248  LDTHYSALEKAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK  297



>gb|AAF82289.1| B-1,3-glucanase [Castanea sativa]
Length=159

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNA  5
            +D++Y+A++K  G ++ IVVSESGWPS GG   T +NA TYYRNLI HVKG A
Sbjct  91   MDALYSALEKRNGGSLKIVVSESGWPSAGGDVETIENAGTYYRNLINHVKGGA  143



>dbj|BAC66186.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG PN+ IVVSESGWPS+G  AAT  NA TYY NLI HVK
Sbjct  248  LDTHYSALEKAGAPNMVIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK  297



>ref|XP_002513528.1| Lichenase precursor, putative [Ricinus communis]
 gb|EEF48931.1| Lichenase precursor, putative [Ricinus communis]
Length=343

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++KAG  ++ IVVSESGWPS+G  AATAQNA TYY NLI HV
Sbjct  246  MDALYAALEKAGAADMQIVVSESGWPSEGSGAATAQNAGTYYSNLINHV  294



>pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose
 pdb|4GZJ|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose And Laminaratetrose
Length=323

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            +DSMY A +K GG NI I+VS SGWPS+G  AAT +NA TYY NLI HVK  AG
Sbjct  215  VDSMYFATEKLGGQNIEIIVSASGWPSEGHPAATLKNARTYYTNLINHVKRGAG  268



>gb|AAA34080.1| prepro-beta-1,3-glucanase precursor, partial [Nicotiana tabacum]
Length=276

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  158  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  207



>emb|CBI22897.3| unnamed protein product [Vitis vinifera]
Length=254

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ +V+SESGWPS GGF  T  NA TY  NLI HVKG
Sbjct  135  LDALYSALERAGGASLEVVLSESGWPSAGGFGTTVDNARTYNSNLIRHVKG  185



>ref|XP_004516619.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like, partial [Cicer 
arietinum]
Length=343

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            L ++Y+A++K GG N+ +VVSESGWPSDGG AAT +NA  YY NLI HV
Sbjct  238  LGALYSALEKVGGANLEVVVSESGWPSDGGVAATVENAQAYYSNLIKHV  286



>ref|XP_010273330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=316

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS YAAV+KAGGP++ IVVSESGWP+ G  AAT  NA TY   LI HVKG
Sbjct  221  LDSFYAAVEKAGGPSVKIVVSESGWPNAGESAATTANAQTYLNGLIRHVKG  271



>ref|XP_010673702.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=340

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDG-GFAATAQNAATYYRNLIAHV  17
            +DS+YAA+ KAG PN  +VVSE+GWPSDG G AAT  NA TYYRNLI HV
Sbjct  240  VDSVYAALGKAGAPNTAVVVSETGWPSDGDGDAATVDNAGTYYRNLINHV  289



>ref|XP_010092377.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
 gb|EXB51053.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
Length=558

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A++KAGG ++ IVVSE+GWPSDGG  AT +NA TY  NL+ HVKG
Sbjct  462  LDALYSALEKAGGGSLEIVVSETGWPSDGGTEATLENARTYNSNLVRHVKG  512



>ref|XP_008227224.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=386

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++Y+A++KAGG ++ IVVSE+GWPS GG  AT +NA+TYY+NLI  VKG
Sbjct  250  VDALYSALEKAGGSSVEIVVSETGWPSQGGEGATVENASTYYKNLIDSVKG  300



>ref|XP_004516618.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=376

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            L ++Y+A++K GG N+ +VVSESGWPSDGG AAT +NA  YY NLI HV
Sbjct  238  LGALYSALEKVGGANLEVVVSESGWPSDGGVAATVENAQAYYSNLIKHV  286



>ref|XP_002278123.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 sp|A7PQW3.2|E13B_VITVI RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Vitis 
vinifera]
Length=344

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -1

Query  139  QKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +KAGG N+ IVVSESGWPS+GG AAT  NA TYY+NLI HVKG
Sbjct  255  EKAGGSNLKIVVSESGWPSEGGTAATVDNARTYYKNLINHVKG  297



>ref|XP_007226561.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
 gb|EMJ27760.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
Length=335

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++Y+AV++AGG ++ +VVSESGWPS G F A+  NA TYY NLI HVK
Sbjct  222  LDALYSAVERAGGGSLEVVVSESGWPSAGAFGASTDNARTYYSNLIRHVK  271



>emb|CAC40755.1| putative prepo-beta-,3-glucanase precursor [Atropa belladonna]
Length=282

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+ ++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  170  LDSVYAAMHRSGGGSVGIVVSESGWPSAGAFGATTDNAATYLRNLIQHAK  219



>ref|XP_009626317.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
GLB isoform X2 [Nicotiana tomentosiformis]
Length=330

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  212  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  261



>gb|AAA34082.1| prepro-beta-1,3-glucanase precursor, partial [Nicotiana tabacum]
Length=329

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  211  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  260



>ref|XP_009760305.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
isoform X2 [Nicotiana sylvestris]
Length=330

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  212  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  261



>dbj|BAA31142.1| beta-1,3-glucanase [Cucumis sativus]
Length=94

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++Y+A++K GG ++ +VVSE+GWP++GG AAT  NA TY  NLI HVK
Sbjct  18   LDTVYSALEKNGGGSLEVVVSETGWPTEGGEAATVDNARTYNNNLIQHVK  67



>gb|AAA63541.1| basic beta-1,3-glucanase [Nicotiana tabacum]
Length=359

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  241  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  290



>sp|P23546.1|E13E_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform GGIB50; AltName: Full=(1->3)-beta-glucan endohydrolase; 
Short=(1->3)-beta-glucanase; AltName: Full=Beta-1,3-endoglucanase, 
basic; AltName: Full=Glucanase GLA; Flags: Precursor 
[Nicotiana tabacum]
Length=370

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  301



>ref|XP_008223323.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Prunus mume]
Length=369

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++Y+AV++AGG ++ +VVSESGWPS G F A+  NA TYY NLI HVK
Sbjct  256  LDALYSAVERAGGGSLEVVVSESGWPSAGAFGASTDNARTYYSNLIRHVK  305



>ref|XP_008811758.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Phoenix 
dactylifera]
Length=341

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++Y A++K GG N+PIVVSESGWPS  GF AT  NA TY +NLI HV
Sbjct  244  MDALYVALEKLGGSNVPIVVSESGWPSADGFGATVDNARTYNQNLINHV  292



>ref|XP_004251356.2| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N 
[Solanum lycopersicum]
Length=339

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -1

Query  163  LDSMYAAVQKA-GGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y A+ KA G  NI IVVSESGWPS+GG  AT +NAAT+Y  LI H K N G
Sbjct  239  LDSVYYAIDKAIGENNIEIVVSESGWPSEGGLGATVENAATFYTKLIEHAKSNNG  293



>ref|XP_009626316.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
GLB isoform X1 [Nicotiana tomentosiformis]
Length=370

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  301



>ref|NP_001275613.1| glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like precursor 
[Solanum tuberosum]
 gb|AFU52661.1| beta-1,3-glucanase 28 [Solanum tuberosum]
Length=345

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DSMY A++K+G PN+ IVVSE+GWPS G  AAT  NA TYY NLI HV+ 
Sbjct  247  VDSMYYALEKSGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNLIDHVRN  297



>sp|P27666.1|E13F_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform GLB; AltName: Full=(1->3)-beta-glucan endohydrolase; 
Short=(1->3)-beta-glucanase; AltName: Full=Beta-1,3-endoglucanase, 
basic; AltName: Full=Glucanase GLB; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAA63540.1| glucan-1,3-beta-glucosidase [Nicotiana tabacum]
Length=370

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  301



>ref|XP_003607315.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89512.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K G   + IVVSESGWPS  G +A+  NAATYYRNLI HVK
Sbjct  232  LDSVYAALEKVGASGVKIVVSESGWPSAAGDSASTDNAATYYRNLINHVK  281



>sp|P15797.2|E13B_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
basic; Flags: Precursor [Nicotiana tabacum]
Length=371

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  253  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  302



>dbj|BAG30906.1| beta-1,3-glucanase [Capsicum chinense]
Length=133

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+ ++GG ++ IVVSESGWPS G F AT  NAATY R LI HV+
Sbjct  69   LDSVYAALDRSGGGSVGIVVSESGWPSAGAFGATTDNAATYLRGLIQHVR  118



>gb|EMS59988.1| Glucan endo-1,3-beta-glucosidase GIII [Triticum urartu]
Length=305

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++KAG P++ +V+SESGWPS GG  ATAQNA  Y + LI HV+G
Sbjct  209  VDSIYAALEKAGKPDVKVVISESGWPSAGGVGATAQNARAYNQGLINHVRG  259



>ref|XP_010907249.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++K GG N+ IVVSESGWPS GG+AAT  NA TY +NLI HV
Sbjct  242  VDAVYAALEKVGGSNVTIVVSESGWPSAGGYAATINNAKTYNQNLINHV  290



>emb|CAN71820.1| hypothetical protein VITISV_027076 [Vitis vinifera]
Length=198

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  142  VQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +++ GG N+ IVVSESGWPS+GG AAT  NA TYY+NLI HVKG
Sbjct  108  LKRTGGSNLKIVVSESGWPSEGGTAATVDNARTYYKNLINHVKG  151



>gb|ACF93731.1| basic beta-1,3-glucanase [Nicotiana tabacum]
Length=370

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  301



>ref|XP_009760304.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
GGIB50 isoform X1 [Nicotiana sylvestris]
 emb|CAA37669.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
 gb|AAA63539.1| glucan beta-1,3-glucanase [Nicotiana tabacum]
Length=370

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRNLIQHAK  301



>ref|XP_010427595.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform-like 
[Camelina sativa]
Length=341

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+G  ++ +VVSESGWP++GGF A+ +NA TY  NLI HVK
Sbjct  244  LDSVYAALEKSGAGSMEVVVSESGWPTEGGFEASVENAKTYVNNLIQHVK  293



>ref|XP_010427596.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform-like 
[Camelina sativa]
Length=341

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+G  ++ +VVSESGWP++GGF A+ +NA TY  NLI HVK
Sbjct  244  LDSVYAALEKSGAGSMEVVVSESGWPTEGGFEASVENAKTYVNNLIQHVK  293



>ref|XP_009414358.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=335

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            LD+ YAA++K GG ++ +VV+ESGWPSDGGFAA   NA TY +NLI HV
Sbjct  239  LDATYAAMEKVGGKDVAVVVTESGWPSDGGFAANISNAHTYIQNLIDHV  287



>gb|AAD28732.1|AF112965_1 beta-1,3-glucanase precursor [Triticum aestivum]
Length=334

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++KAG P++ +V+SESGWPS GG  ATAQNA  Y + LI HV+G
Sbjct  238  VDSIYAALEKAGKPDVKVVISESGWPSAGGVGATAQNARAYNQGLINHVRG  288



>sp|P52402.1|E133_SOLTU RecName: Full=Glucan endo-1,3-beta-glucosidase, basic isoform 
3; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: 
Precursor, partial [Solanum tuberosum]
 gb|AAA19111.1| 1,3-beta-D-glucan glucanohydrolase; endo-1,3-beta-D-glucanase; 
1,3-beta-glucanase (basic, class I), partial [Solanum tuberosum]
Length=328

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  209  LDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK  258



>gb|AAC19114.1| 1,3-beta-glucan glucanohydrolase [Solanum tuberosum]
Length=363

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  244  LDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK  293



>sp|P52400.1|E131_SOLTU RecName: Full=Glucan endo-1,3-beta-glucosidase, basic isoform 
1; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: 
Precursor, partial [Solanum tuberosum]
 gb|AAA88794.1| 1,3-beta-D-glucan glucanohydrolase; endo-1,3-beta-D-glucanase; 
1,3-beta-glucanase (basic, class I), partial [Solanum tuberosum]
Length=337

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  218  LDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK  267



>gb|AFU52655.1| beta-1,3-glucanase 22 [Solanum tuberosum]
Length=363

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSESGWPS G F AT  NAATY RNLI H K
Sbjct  244  LDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK  293



>ref|XP_009391471.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=340

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++K GG N+ IVVSESGWPS G FAAT +NA TY +NLI HV
Sbjct  243  VDAVYAAMEKVGGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV  291



>gb|AAR06588.1| beta-1,3-glucanase [Vitis riparia]
Length=344

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  136  KAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            KAGG N+ IVVSESGWPS+GG AAT  NA TYY+NLI HVKG
Sbjct  256  KAGGSNLKIVVSESGWPSEGGTAATVDNARTYYKNLINHVKG  297



>gb|AIS22073.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++K GG N+ IVVSESGWPS G FAAT +NA TY +NLI HV
Sbjct  243  VDAVYAAMEKVGGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV  291



>gb|AHW57401.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++K GG N+ IVVSESGWPS G FAAT +NA TY +NLI HV
Sbjct  243  VDAVYAAMEKVGGSNVAIVVSESGWPSAGDFAATIENAKTYNQNLIRHV  291



>gb|ABR13272.1| putative beta-1,3-glucanase [Prunus dulcis]
Length=112

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IV+SESGWPS GG A T  NA T+  NLI HVKG
Sbjct  15   LDAVYAALEKAGGGSLEIVISESGWPSAGGTATTIDNARTFNANLIQHVKG  65



>ref|XP_009770429.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y A++KA G NI IVV+ESGWPSDGGF A+ +NA TYY NL  HVK
Sbjct  235  LDAQYYALEKADGNNIEIVVAESGWPSDGGFGASMENARTYYINLNNHVK  284



>gb|AAM12898.1|AF494405_1 beta-1,3-glucanase [Malus domestica]
Length=106

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA+ K GG ++ IVVSESGWP+ GG A T  NA TY  NLI HVKG
Sbjct  26   LDAVYAALDKVGGGSLEIVVSESGWPTAGGTATTVDNARTYNSNLIQHVKG  76



>ref|XP_010248217.1| PREDICTED: lichenase-like, partial [Nelumbo nucifera]
Length=309

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDSMYAAV+KAGG ++ IVVSESGWP+ G  AAT  NA TY   LI HVKG
Sbjct  252  LDSMYAAVEKAGGGSVKIVVSESGWPNAGESAATTPNAQTYLNGLIRHVKG  302



>dbj|BAJ90395.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DS+YAA++KAG P + +V+SESGWPSD GF ATAQNA  Y + LI HV
Sbjct  239  VDSIYAALEKAGTPGVKVVISESGWPSDQGFGATAQNARAYNQGLINHV  287



>emb|CBH32609.1| glucan endo-1,3-beta-glucosidase GII precursor,putative, expressed 
[Triticum aestivum]
Length=331

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DS+YAA++KAG P + +V+SESGWPSD GF ATAQNA  Y + LI HV
Sbjct  235  VDSIYAALEKAGKPGVKVVISESGWPSDEGFGATAQNARAYNQGLINHV  283



>gb|AAX81590.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD+ Y+A++KAG  N+ IVVSESGWPS+G  AAT  NA TYY NLI+HVK
Sbjct  248  LDTHYSALEKAGASNMAIVVSESGWPSEGSDAATNGNAGTYYSNLISHVK  297



>ref|XP_006365200.1| PREDICTED: uncharacterized protein LOC102593111 [Solanum tuberosum]
Length=671

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = -1

Query  163  LDSMYAAVQKA-GGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+Y A+ KA G  N+ IVVSESGWPSDGG  A+ +NAATYY+NL+ H K   G
Sbjct  571  LDSVYYAIDKAIGENNVEIVVSESGWPSDGGVGASVENAATYYKNLMDHAKSTKG  625



>sp|Q02126.1|E13C_HORVU RecName: Full=Glucan endo-1,3-beta-glucosidase GIII; AltName: 
Full=(1->3)-beta-glucan endohydrolase GIII; AltName: Full=(1->3)-beta-glucanase 
isoenzyme GIII; AltName: Full=Beta-1,3-endoglucanase 
GIII; Flags: Precursor [Hordeum vulgare]
 emb|CAA47473.1| glucan endo-1,3-beta-glucosidase [Hordeum vulgare]
Length=330

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DS+YAA++KAG P + +V+SESGWPSD GF ATAQNA  Y + LI HV
Sbjct  234  VDSIYAALEKAGTPGVKVVISESGWPSDQGFGATAQNARAYNQGLINHV  282



>gb|AAZ79656.1| putative beta-1,3-glucanase [Fagus sylvatica]
Length=262

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IV+SESGWPS GG A T  N  TY  NL+ HVKG
Sbjct  191  LDAVYAALEKAGGRSLVIVISESGWPSTGGTATTLDNERTYITNLVQHVKG  241



>ref|XP_010279591.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=348

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDSMYAAV+KAGG ++ IVVSESGWP+ G  AAT  NA TY   LI HVKG
Sbjct  250  LDSMYAAVEKAGGGSVKIVVSESGWPNAGESAATTPNAQTYLNGLIQHVKG  300



>emb|CAB60154.1| 1,3 beta glucanase [Vitis vinifera]
Length=122

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ IVVSESGWPS GG   T  NA TY  NLI HVKG
Sbjct  26   LDAVYSALERAGGSSLKIVVSESGWPSAGGTQTTVDNARTYNSNLIQHVKG  76



>gb|AAF44667.2|AF239617_1 beta-1,3-glucanase [Vitis vinifera]
Length=360

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ +V+SESGWPS GGF  T  NA TY  NLI HVKG
Sbjct  241  LDALYSALERAGGASLEVVLSESGWPSAGGFGTTVDNARTYNSNLIRHVKG  291



>ref|XP_010938656.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=341

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D++Y+A++K GG N+ +VVSE+GWPSDGG AA+  NA TY +NLI HV+
Sbjct  241  VDAVYSALEKEGGSNMEVVVSETGWPSDGGLAASVDNARTYNQNLIKHVR  290



>ref|XP_010063513.1| PREDICTED: lichenase [Eucalyptus grandis]
Length=369

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG  + +VVSESGWPS G FAAT  NA TY  NLI HVKG
Sbjct  253  LDALYSALERAGGAALRVVVSESGWPSAGAFAATVDNARTYNGNLIKHVKG  303



>gb|AAL58887.1| beta-1,3-glucanase [Cucumis melo]
Length=74

 Score = 64.7 bits (156),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D++Y+A++K GG ++ IVVSE+GWP+DGG AAT  NA TY  NLI  VK
Sbjct  5    VDTVYSALEKNGGGSLEIVVSETGWPTDGGEAATVDNARTYTNNLIQRVK  54



>gb|KHN03122.1| Glucan endo-1,3-beta-glucosidase, partial [Glycine soja]
Length=316

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAA++K G PN+ IVVSESGWPS GG  A  +NA  YY NLI+H    +G
Sbjct  221  LDSIYAALEKIGAPNLEIVVSESGWPSAGGDGALVENAHAYYYNLISHANSGSG  274



>ref|XP_003607328.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AES89525.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=361

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            L ++YAA++K GG N+ +VVSESGWPSDGG AA+ +NA  Y+ NLI HV
Sbjct  237  LGALYAALEKIGGANLEVVVSESGWPSDGGVAASIENAQIYHENLIKHV  285



>gb|AAY88778.1| beta-1,3-glucanase [Triticum aestivum]
Length=334

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  288



>ref|XP_006430506.1| hypothetical protein CICLE_v10012099mg [Citrus clementina]
 gb|ESR43746.1| hypothetical protein CICLE_v10012099mg [Citrus clementina]
 gb|KDO53666.1| hypothetical protein CISIN_1g019014mg [Citrus sinensis]
Length=347

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IVVSESGWP+ GG AA+  NA TY  NLI HVKG
Sbjct  249  LDAVYAALEKAGGGSLRIVVSESGWPTAGGTAASVDNARTYNSNLIQHVKG  299



>gb|AAL15886.1|AF417298_1 putative beta-1,3-glucanase [Castanea sativa]
Length=129

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A++KAGG ++ IV+SESGWPS GG A T  N  TY  NL+ HVKG
Sbjct  32   LDTLYSALEKAGGGSLVIVISESGWPSAGGTATTLDNERTYITNLVQHVKG  82



>gb|AAY96422.1| beta-1,3-glucanase [Triticum aestivum]
 gb|AEO27889.1| beta-1,3-glucanase [Triticum aestivum]
Length=334

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  288



>gb|AEV41413.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=373

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ +VVSESGWPS G FAAT  N  TY  NLI HVKG
Sbjct  254  LDALYSALERAGGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG  304



>gb|KHN03119.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=274

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAA++K G PN+ IVVSESGWPS GG  A   NA  YY NL+ H  G  G
Sbjct  179  LDSIYAALEKIGAPNLEIVVSESGWPSAGGDGALVDNARIYYYNLLNHANGEIG  232



>sp|P23431.1|E13B_NICPL RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
basic; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAA38540.1| precusor b-1,3-glucanse [Nicotiana plumbaginifolia]
Length=365

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY +NLI H K
Sbjct  252  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLKNLIQHAK  301



>gb|AHE76177.1| beta-1,3-endoglucanase, partial [Triticum aestivum]
Length=314

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  218  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  268



>gb|ACI23384.1| beta glucanase [Isatis tinctoria]
Length=164

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+GG ++ IVVSESGWP++GG   + +NA TY  NLI HVK
Sbjct  111  LDSVYAALEKSGGGSLEIVVSESGWPTEGGPGTSVENAKTYVNNLIQHVK  160



>gb|AHE76176.1| beta-1,3-endoglucanase, partial [Triticum aestivum]
Length=314

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  218  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  268



>emb|CDY34445.1| BnaC01g21880D [Brassica napus]
Length=346

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AAT  NA  YY NL A V+ N G
Sbjct  238  LDVVYSAVERSGGGSLPVVVSESGWPSNGGNAATFDNARAYYTNLAARVRENKG  291



>gb|EMT32042.1| Glucan endo-1,3-beta-glucosidase GII [Aegilops tauschii]
Length=334

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  288



>emb|CAA77085.1| glucan endo-1,3-beta-D-glucosidase [Triticum aestivum]
Length=335

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  288



>ref|XP_006482037.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Citrus sinensis]
Length=347

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IVVSESGWP+ GG AA+  NA TY  NLI HVKG
Sbjct  249  LDAVYAALEKAGGGSLRIVVSESGWPTAGGTAASVDNARTYNSNLIQHVKG  299



>ref|XP_010090226.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
 gb|EXB39095.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
Length=305

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A++KAGG ++ +VVSE+GWPS GG A +  NA TY RNLI HVKG
Sbjct  208  LDAVYSALEKAGGGSLEVVVSETGWPSAGGTATSFDNARTYVRNLIPHVKG  258



>ref|XP_008811754.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=340

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +D++Y+A++K  G NIP+VVSESGWPS GG AAT  NA TY +NLI HV+
Sbjct  242  VDAIYSALEKMEGSNIPVVVSESGWPSAGGTAATMDNAKTYNQNLINHVR  291



>ref|XP_008240769.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=343

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IV+SESGWPS GG A T  NA TY  NLI HVKG
Sbjct  246  LDAVYAALEKAGGGSLEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG  296



>emb|CAM82809.1| pathogenesis-related protein 2 [Malus domestica]
Length=176

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA+ K GG ++ IVVSESGWP+ GG A T  NA TY  NLI HVKG
Sbjct  124  LDAVYAALDKVGGGSLDIVVSESGWPTAGGTATTVDNARTYNSNLIQHVKG  174



>ref|XP_008811756.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=340

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++KAGG N+ IVVSESGWPS GG AAT  NA TY +NLI HV
Sbjct  243  VDAVYAALEKAGGSNVVIVVSESGWPSAGGTAATISNAKTYNQNLINHV  291



>ref|XP_007015141.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
 gb|EOY32760.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
Length=345

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DS+Y+A++K  G N+ IVVSESGWPS+GG AA   NA  YYRNLI HV
Sbjct  248  VDSLYSALEKTEGANVNIVVSESGWPSEGGNAANVDNAGKYYRNLINHV  296



>sp|Q02437.1|E13D_HORVU RecName: Full=Glucan endo-1,3-beta-glucosidase GIV; AltName: 
Full=(1->3)-beta-glucan endohydrolase GIV; AltName: Full=(1->3)-beta-glucanase 
isoenzyme GIV; AltName: Full=Beta-1,3-endoglucanase 
GIV [Hordeum vulgare]
 gb|AAA32961.1| glucan endo-1,3-beta-glucosidase, partial [Hordeum vulgare]
Length=327

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D+MYAA++KAG P++ +VVSESGWPS GGFAAT +NA  Y + LI HV
Sbjct  212  VDAMYAALEKAGAPSVRVVVSESGWPSAGGFAATPENARAYNQGLIDHV  260



>ref|XP_008231643.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Prunus mume]
Length=341

 Score = 67.8 bits (164),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IV+SESGWPS GG A T  NA TY  NLI HVKG
Sbjct  244  LDAVYAALEKAGGGSLEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG  294



>gb|KFK34961.1| hypothetical protein AALP_AA5G216400 [Arabis alpina]
Length=329

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNA  5
            LDS+YAA++K+GG ++ IVVSESGWP++GG   + +NA TY  NLI HVK  +
Sbjct  232  LDSVYAALEKSGGESLEIVVSESGWPTEGGPGTSVENARTYVNNLIQHVKNGS  284



>gb|AAL30426.1|AF435089_1 beta-1,3-glucanase [Prunus persica]
Length=343

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++KAGG ++ IV+SESGWPS GG A T  NA TY  NLI HVKG
Sbjct  246  LDAVYAALEKAGGGSLEIVISESGWPSAGGTATTIDNARTYNANLIQHVKG  296



>gb|AHJ78381.1| beta-1,3-glucanase, partial [Cydonia oblonga]
Length=195

 Score = 65.9 bits (159),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD+ YAA+ K GG ++ IV+SE+GWP+ GG AAT  NA TY  NLI HVKG
Sbjct  128  LDAFYAALDKVGGGSLEIVISETGWPTAGGTAATVDNARTYNSNLIQHVKG  178



>ref|XP_006358202.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform 2-like 
[Solanum tuberosum]
Length=363

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSESGWPS G F AT  NA TY RNLI H K
Sbjct  244  LDSVYAAMERTGGGSVGIVVSESGWPSAGAFGATQDNAETYLRNLIQHAK  293



>ref|NP_001274869.1| glucan endo-1,3-beta-glucosidase, basic isoform 2 precursor [Solanum 
tuberosum]
 sp|P52401.1|E132_SOLTU RecName: Full=Glucan endo-1,3-beta-glucosidase, basic isoform 
2; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: 
Precursor [Solanum tuberosum]
 gb|AAA18928.1| 1,3-beta-D-glucan glucanohydrolase; endo-1,3-beta-D-glucanase; 
1,3-beta-glucanase (basic, class I) [Solanum tuberosum]
Length=363

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+++ GG ++ IVVSE GWPS G F AT  NAATY RNLI H K
Sbjct  244  LDSVYAAMERTGGGSVGIVVSECGWPSAGAFGATQDNAATYLRNLIQHAK  293



>ref|XP_006284042.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
 gb|EOA16940.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
Length=346

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG +IP+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  238  LDVVYSAVERSGGGSIPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  291



>gb|EMS47932.1| Glucan endo-1,3-beta-glucosidase GII [Triticum urartu]
Length=354

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV G
Sbjct  258  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHVGG  308



>ref|XP_002878140.1| beta-1,3-glucanase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54399.1| beta-1,3-glucanase 2 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+GG ++ IVVSESGWP++GG   + +NA TY  NLI HVK
Sbjct  241  LDSVYAALEKSGGGSLEIVVSESGWPTEGGVGTSVENAKTYVNNLIQHVK  290



>gb|AAM12897.1|AF494404_1 beta-1,3-glucanase [Malus domestica]
Length=106

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA+ K GG ++ IV+SESGWP+ GG A T  NA TY  NL+ HVKG
Sbjct  26   LDAVYAALDKVGGGSLEIVISESGWPTAGGTATTVDNARTYNSNLVQHVKG  76



>ref|XP_010263438.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=151

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+YAAV+K GG ++ IVVSE+GWPS G   AT  NA TY + LI HVKG
Sbjct  61   LDSVYAAVEKVGGSSVRIVVSETGWPSAGDPVATIANAQTYLKRLIQHVKG  111



>emb|CDP20080.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGG-FAATAQNAATYYRNLIAHVKGNAG  2
            LD+ Y+A++K GG N+ IVVSE+GWPSDG   AA++ NA TYYRN+I+HVK   G
Sbjct  238  LDAHYSALEKEGGSNVDIVVSETGWPSDGNPPAASSGNAGTYYRNVISHVKSGQG  292



>ref|XP_008443726.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Cucumis melo]
Length=339

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++YAA++K GG N+ IV+SESGWPS GG AA+  NA TY  NLI HVK
Sbjct  241  LDAVYAALEKVGGGNLEIVISESGWPSAGGTAASIDNARTYINNLIQHVK  290



>emb|CAN66737.1| hypothetical protein VITISV_024188 [Vitis vinifera]
Length=340

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ +V SESGWPS GGF  T  NA TY  NLI HVKG
Sbjct  221  LDALYSALERAGGASLEVVXSESGWPSAGGFGTTVDNARTYNSNLIRHVKG  271



>ref|XP_002533898.1| Glucan endo-1,3-beta-glucosidase, basic isoform precursor, putative 
[Ricinus communis]
 gb|EEF28488.1| Glucan endo-1,3-beta-glucosidase, basic isoform precursor, putative 
[Ricinus communis]
Length=257

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++YAA++K+GG ++ IVVSESGWP+ GG A +  NA TY  NLI HVK
Sbjct  160  LDAVYAALEKSGGSSLEIVVSESGWPTAGGTATSVDNARTYINNLIQHVK  209



>dbj|BAK00288.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +DS+YAA++KAG PN+ +VVSESGWPS GGF A+ +NA  Y + LI H++
Sbjct  218  VDSIYAALEKAGTPNVRVVVSESGWPSAGGFGASVENARNYNQGLIDHIR  267



>emb|CAJ58508.1| glucan endo-1,3-beta-D-glucosidase [Secale cereale]
Length=200

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +V+SESGWPS GGFAA+  NA TY + LI HV G
Sbjct  104  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASPDNARTYNQGLINHVGG  154



>sp|Q02438.2|E13E_HORVU RecName: Full=Glucan endo-1,3-beta-glucosidase GV; AltName: Full=(1->3)-beta-glucan 
endohydrolase GV; AltName: Full=(1->3)-beta-glucanase 
isoenzyme GV; AltName: Full=Beta-1,3-endoglucanase 
GV [Hordeum vulgare]
 gb|AAA21564.1| glucan endo-1,3-beta-glucosidase [Hordeum vulgare subsp. vulgare]
Length=316

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +DS+YAA++KAG PN+ +VVSESGWPS GGF A+ +NA  Y + LI H++
Sbjct  218  VDSIYAALEKAGTPNVRVVVSESGWPSAGGFGASVENARNYNQGLIDHIR  267



>pdb|1GHS|A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan 
Endohydrolases With Distinct Substrate Specificities
 pdb|1GHS|B Chain B, The Three-Dimensional Structures Of Two Plant Beta-Glucan 
Endohydrolases With Distinct Substrate Specificities
Length=306

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  210  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  260



>ref|NP_001267896.1| class I beta-1,3-glucanase precursor [Vitis vinifera]
 gb|ABB82365.1| class I beta-1,3-glucanase [Vitis vinifera]
 gb|ADG35963.1| chitinase [Vitis hybrid cultivar]
Length=360

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+ +AGG ++ +VVSESGWPS GGF  T  NA TY  NLI HVKG
Sbjct  241  LDALYSALGRAGGASLEVVVSESGWPSAGGFGTTVDNARTYNSNLIRHVKG  291



>prf||1607157A endo-1,3-beta-glucanase
Length=306

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  210  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  260



>gb|EMT07351.1| Glucan endo-1,3-beta-glucosidase GIII [Aegilops tauschii]
Length=378

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++ A  P + +VVSESGWPSDGGF ATAQNA  Y + LI HV G
Sbjct  282  VDSIYAALEDAETPGVKVVVSESGWPSDGGFGATAQNARAYNQGLINHVGG  332



>gb|EMT12505.1| Glucan endo-1,3-beta-glucosidase GV [Aegilops tauschii]
Length=295

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            +DS+YAA++KAG PN+ +VVSESGWPS GGF A+  NA +Y + LI H++
Sbjct  197  VDSIYAALEKAGTPNVRVVVSESGWPSAGGFGASVDNARSYNQGLIDHIR  246



>ref|XP_010232797.1| PREDICTED: glucan endo-1,3-beta-glucosidase GIII-like isoform 
X2 [Brachypodium distachyon]
Length=340

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++ AG P + +VVSESGWPS GGFAATA+NA  Y + LI HV G
Sbjct  244  VDSIYAALEDAGTPGVGVVVSESGWPSAGGFAATAENARRYNQGLIGHVGG  294



>ref|XP_003607322.1| Endo-1 3-beta-glucanase [Medicago truncatula]
Length=373

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAH  20
            LDS+YAA++K GG ++ IVVSESGWPS GG  AT +NA TYY NLI H
Sbjct  271  LDSVYAALEKVGGSSVKIVVSESGWPSAGGDVATIENARTYYSNLINH  318



>ref|XP_010551091.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Tarenaya hassleriana]
Length=359

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD++Y+A++++GG ++P+V+SESGWPS GGFAAT  NA  +  NL A V+ N G
Sbjct  236  LDALYSAIERSGGGSLPVVISESGWPSGGGFAATLDNARAFCTNLAARVRDNRG  289



>ref|XP_010516340.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform-like 
[Camelina sativa]
Length=340

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++K+GG ++ +VVSESGWP++GG  A+ +NA TY  NLI HVK
Sbjct  243  LDSVYAALEKSGGGSMEVVVSESGWPTEGGDGASVENAKTYVNNLIQHVK  292



>gb|AAC14399.1| beta-1,3-glucanase 2 [Hordeum vulgare]
Length=334

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  288



>sp|P15737.1|E13B_HORVU RecName: Full=Glucan endo-1,3-beta-glucosidase GII; AltName: 
Full=(1->3)-beta-glucan endohydrolase GII; AltName: Full=(1->3)-beta-glucanase 
isoenzyme GII; AltName: Full=Beta-1,3-endoglucanase 
GII; Flags: Precursor [Hordeum vulgare]
 gb|AAA32958.1| 1,3-beta glucan endohydrolase precursor [Hordeum vulgare]
Length=334

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  288



>ref|XP_004171028.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like, 
partial [Cucumis sativus]
Length=312

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++YAA++K GG N+ IV+SESGWPS GG A +  NA TY  NLI HVK
Sbjct  215  LDALYAALEKVGGGNLEIVISESGWPSAGGTATSINNARTYINNLIQHVK  264



>gb|AES89519.2| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=391

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAA++K GG ++ IVVSESGWPS GG  AT +NA TYY NLI H     G
Sbjct  289  LDSVYAALEKVGGSSVKIVVSESGWPSAGGDVATIENARTYYSNLINHANSGNG  342



>prf||1410344A glucan endoglucosidase
Length=359

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA++++GG ++ IVVSESGWPS G F AT  NAATY R LI H K
Sbjct  241  LDSVYAALERSGGASVGIVVSESGWPSAGAFGATYDNAATYLRXLIXHAK  290



>emb|CDP14183.1| unnamed protein product [Coffea canephora]
Length=343

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATA-QNAATYYRNLIAHVKGNAG  2
            LD+ Y+A+++AGG ++ IVVSE+GWPSDGG  AT+  NA TY  NLI HV GN+G
Sbjct  244  LDATYSALERAGGQSVEIVVSETGWPSDGGGQATSIDNARTYNTNLIGHVNGNSG  298



>gb|AAM75342.1|AF515785_1 beta-1,3-glucanase II [Hordeum vulgare subsp. vulgare]
 gb|AAL88447.2| beta-1,3-glucanase [Hordeum vulgare subsp. vulgare]
Length=334

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  288



>ref|XP_010921891.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++K GG N+ IVVSESGWPS GG AAT  NA TY +NLI HV
Sbjct  242  VDAIYAALEKVGGSNVAIVVSESGWPSAGGTAATINNAKTYNQNLINHV  290



>ref|XP_006414372.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
 gb|ESQ55825.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
Length=345

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  237  LDVIYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  290



>gb|AAA32939.1| (1-3)-beta-glucanase [Hordeum vulgare]
Length=334

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +D++YAA++KAG P + +VVSESGWPS GGFAA+A NA TY + LI HV G
Sbjct  238  VDAVYAALEKAGAPAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGG  288



>emb|CDY06119.1| BnaA09g36610D [Brassica napus]
Length=340

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++K+GG ++ IVVSESGWP++GG   + +NA TY  NLI HVKG
Sbjct  242  LDAVYAALEKSGGGSLEIVVSESGWPTEGGAGTSVENAMTYVNNLIQHVKG  292



>ref|XP_003540349.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
 gb|KHN20625.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=326

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAH  20
            LDS+YAA++K G  N+ IVVSESGWPS+GG  A+  NA TYY NLI H
Sbjct  226  LDSIYAALEKVGASNLQIVVSESGWPSEGGAGASIDNAGTYYANLIRH  273



>ref|XP_002868146.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44405.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  235  LDVIYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  288



>gb|AAF82288.1| B-1,3-glucanase [Castanea sativa]
Length=162

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A++KAGG ++ IV+SESGWPS GG A T  N  TY  NL+ HVKG
Sbjct  94   LDTVYSALEKAGGGSLVIVISESGWPSAGGTATTLDNERTYITNLVQHVKG  144



>ref|NP_001234805.1| glucan endo-1,3-beta-glucosidase B precursor [Solanum lycopersicum]
 ref|XP_004229005.1| PREDICTED: glucan endo-1,3-beta-glucosidase B [Solanum lycopersicum]
 sp|Q01413.1|E13B_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase B; AltName: Full=(1->3)-beta-glucan 
endohydrolase B; Short=(1->3)-beta-glucanase 
B; AltName: Full=Basic beta-1,3-glucanase; AltName: Full=Beta-1,3-endoglucanase 
B; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03618.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=360

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LDS+YAA+ + GG ++ IVVSESGWPS G F AT +NA TY RNLI H K
Sbjct  244  LDSVYAAMDRTGGGSVGIVVSESGWPSAGAFGATHENAQTYLRNLIQHAK  293



>ref|XP_003548789.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=331

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAA++K G PN+ IVVSESGWPS GG  A  +NA  YY NLI H    +G
Sbjct  236  LDSIYAALEKIGAPNLEIVVSESGWPSAGGDGALVENAHAYYYNLINHANSGSG  289



>ref|XP_009116429.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform-like 
[Brassica rapa]
Length=342

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++YAA++K+GG ++ IVVSESGWP++GG   + +NA TY  NLI HVKG
Sbjct  244  LDAVYAALEKSGGGSLEIVVSESGWPTEGGAGTSVENAMTYVNNLIQHVKG  294



>gb|ABK96486.1| unknown [Populus trichocarpa x Populus deltoides]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPN-IPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+Y+A+++ GG N + +VVSESGWPS GGF  T+ NA TY  NLI HVKG
Sbjct  253  LDSLYSALERLGGGNTLDVVVSESGWPSAGGFGTTSDNAGTYLSNLIRHVKG  304



>ref|XP_004142554.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Cucumis sativus]
 gb|KGN66700.1| hypothetical protein Csa_1G660200 [Cucumis sativus]
Length=336

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVK  14
            LD++YAA++K GG N+ IV+SESGWPS GG A +  NA TY  NLI HVK
Sbjct  239  LDALYAALEKVGGGNLEIVISESGWPSAGGTATSINNARTYINNLIQHVK  288



>ref|NP_001045357.1| Os01g0940800 [Oryza sativa Japonica Group]
 dbj|BAB85419.1| putative beta-1,3-glucanase precursor [Oryza sativa Japonica 
Group]
 dbj|BAF07271.1| Os01g0940800 [Oryza sativa Japonica Group]
 dbj|BAG90824.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63912.1| hypothetical protein OsJ_18737 [Oryza sativa Japonica Group]
Length=332

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++ AG P++ +VVSE+GWPS GGF A+  NA TY + LI+HV+G
Sbjct  234  VDSVYAALEDAGAPDVGVVVSETGWPSAGGFGASVSNAQTYNQKLISHVQG  284



>ref|XP_006599939.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=587

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LDS+YAA++K G PN+ IVVSESGWPS GG  A   NA  YY NL+ H  G  G
Sbjct  492  LDSIYAALEKIGAPNLEIVVSESGWPSAGGDGALVDNARIYYYNLLNHANGEIG  545



>ref|XP_010232796.1| PREDICTED: glucan endo-1,3-beta-glucosidase GIII-like isoform 
X1 [Brachypodium distachyon]
Length=357

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++ AG P + +VVSESGWPS GGFAATA+NA  Y + LI HV G
Sbjct  261  VDSIYAALEDAGTPGVGVVVSESGWPSAGGFAATAENARRYNQGLIGHVGG  311



>gb|EAY77172.1| hypothetical protein OsI_05142 [Oryza sativa Indica Group]
Length=332

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS YAA++ AG P++ +VVSE+GWPS GGF A+  NA TY + LI+HV+G
Sbjct  234  VDSFYAALEDAGAPDVGVVVSETGWPSAGGFGASVSNAQTYNQKLISHVQG  284



>ref|XP_002314934.2| Glucan endo-1 family protein [Populus trichocarpa]
 gb|EEF01105.2| Glucan endo-1 family protein [Populus trichocarpa]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPN-IPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+Y+A+++ GG N + +VVSESGWPS GGF  T+ NA TY  NLI HVKG
Sbjct  253  LDSLYSALERLGGGNTLDVVVSESGWPSAGGFGTTSDNAGTYLSNLIRHVKG  304



>gb|ADW08743.1| 1,3-beta-D-glucanase GH17_44 [Populus tremula x Populus tremuloides]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPN-IPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+Y+A+++ GG N + +VVSESGWPS GGF  T+ NA TY  NLI HVKG
Sbjct  253  LDSLYSALERLGGGNTLDVVVSESGWPSAGGFGTTSDNAGTYLSNLIRHVKG  304



>ref|XP_010449818.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=346

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  238  LDVVYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  291



>gb|AHE76175.1| beta-1,3-endoglucanase, partial [Triticum turgidum]
Length=314

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +D++YAA++KAG P + +V+SESGWPS GGFAA+A NA TY + LI HV
Sbjct  218  VDAVYAALEKAGAPGVKVVISESGWPSAGGFAASADNARTYNQGLINHV  266



>ref|XP_004232306.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Solanum lycopersicum]
Length=345

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHV  17
            +DSMY A++K+G PN+ IVVSE+GWPS G  AAT  NA TYY N+I HV
Sbjct  247  VDSMYYALEKSGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNVINHV  295



>ref|XP_010440186.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=346

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  238  LDVVYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  291



>gb|AAD10383.1| beta-1,3-glucanase precursor [Oryza sativa Japonica Group]
Length=332

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            +DS+YAA++ AG P++ +VVSE+GWPS GGF A+  NA TY + LI+HV+G
Sbjct  234  VDSVYAALEDAGAPDVGVVVSETGWPSAGGFGASVSNAQTYNQKLISHVQG  284



>gb|ACD45060.1| beta-1,3-glucanase [Vitis riparia]
Length=345

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A++KAGG ++ +V+SESGWPS GG A T  NA TY  NLI HVKG
Sbjct  248  LDAVYSALEKAGGGSLQVVISESGWPSAGGTATTVDNAKTYNSNLIQHVKG  298



>ref|XP_011010204.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Populus euphratica]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPN-IPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LDS+Y+A+++ GG N + +VVSESGWPS GGF  T+ NA TY  NLI HVKG
Sbjct  253  LDSLYSALERLGGGNTLDVVVSESGWPSAGGFGTTSDNAGTYLSNLIRHVKG  304



>ref|XP_002277446.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=340

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKG  11
            LD++Y+A+++AGG ++ IVVSESGWPS GG   T  NA TY  NLI HVKG
Sbjct  243  LDAVYSALERAGGSSLKIVVSESGWPSAGGTQTTVDNARTYNSNLIQHVKG  293



>ref|XP_009146295.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Brassica rapa]
Length=357

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LDSMYAAVQKAGGPNIPIVVSESGWPSDGGFAATAQNAATYYRNLIAHVKGNAG  2
            LD +Y+AV+++GG ++P+VVSESGWPS+GG AA+  NA  YY NL A V+ N G
Sbjct  238  LDVVYSAVERSGGGSLPVVVSESGWPSNGGNAASFDNARAYYTNLAARVRENRG  291



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618