BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c48670_g1_i1 len=254 path=[232:0-253]

Length=254
                                                                      Score     E

ref|XP_006578337.1|  PREDICTED: LOB domain-containing protein 36-...  53.5    9e-07   
emb|CBI24495.3|  unnamed protein product                              53.1    1e-06   
emb|CBI23280.3|  unnamed protein product                              52.4    1e-06   
ref|XP_002263136.3|  PREDICTED: LOB domain-containing protein 36      53.1    2e-06   Vitis vinifera
ref|XP_010662454.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  53.1    3e-06   
emb|CBI29565.3|  unnamed protein product                              51.2    7e-06   
ref|XP_006581558.1|  PREDICTED: LOB domain-containing protein 36-...  50.8    8e-06   
ref|NP_179946.1|  LOB domain-containing protein 10                    51.6    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003635533.2|  PREDICTED: LOB domain-containing protein 36-...  51.2    1e-05   
gb|KHN09146.1|  LOB domain-containing protein 36                      50.8    1e-05   
emb|CBI23279.3|  unnamed protein product                              51.6    1e-05   
ref|XP_002263109.2|  PREDICTED: LOB domain-containing protein 36-...  51.2    1e-05   Vitis vinifera
ref|XP_002880519.1|  LOB domain family protein                        50.8    2e-05   
ref|XP_007155957.1|  hypothetical protein PHAVU_003G246700g           50.8    2e-05   
ref|XP_010680494.1|  PREDICTED: LOB domain-containing protein 25-...  50.1    2e-05   
ref|XP_010417109.1|  PREDICTED: LOB domain-containing protein 10-...  50.8    2e-05   
ref|XP_010687953.1|  PREDICTED: LOB domain-containing protein 36-...  50.8    2e-05   
gb|EMT24456.1|  hypothetical protein F775_33210                       48.1    3e-05   
ref|XP_006296515.1|  hypothetical protein CARUB_v10025704mg           50.4    3e-05   
ref|XP_011039216.1|  PREDICTED: LOB domain-containing protein 36 ...  50.4    3e-05   
ref|XP_006360231.1|  PREDICTED: LOB domain-containing protein 36-...  50.4    3e-05   
gb|KHG26276.1|  LOB domain-containing 36 -like protein                50.4    3e-05   
gb|KEH33776.1|  LOB domain protein                                    50.4    3e-05   
ref|XP_006404852.1|  hypothetical protein EUTSA_v10000525mg           50.4    3e-05   
ref|XP_002866728.1|  hypothetical protein ARALYDRAFT_496913           50.4    3e-05   
ref|XP_004233943.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
gb|KHG29668.1|  LOB domain-containing 36 -like protein                50.4    3e-05   
ref|XP_010472359.1|  PREDICTED: LOB domain-containing protein 10-...  50.1    3e-05   
ref|XP_011039214.1|  PREDICTED: LOB domain-containing protein 36 ...  50.1    3e-05   
ref|XP_010464781.1|  PREDICTED: LOB domain-containing protein 36-...  50.4    3e-05   
ref|XP_009792980.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
ref|XP_009630099.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
ref|XP_011009273.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
gb|EMS45175.1|  hypothetical protein TRIUR3_06488                     48.5    3e-05   
ref|XP_009600699.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
ref|XP_010484574.1|  PREDICTED: LOB domain-containing protein 36      50.1    3e-05   
ref|XP_002307250.2|  LOB domain protein 28                            50.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009600700.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    3e-05   
ref|XP_002310159.2|  hypothetical protein POPTR_0007s11460g           50.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|NP_201488.1|  LOB domain-containing protein 36 (ASYMMETRIC LE...  50.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00455.1|  hypothetical protein                                 50.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941839.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_006393884.1|  hypothetical protein EUTSA_v10004535mg           50.1    4e-05   
ref|XP_010429315.1|  PREDICTED: LOB domain-containing protein 10      50.1    4e-05   
ref|XP_008457883.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_004148465.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_010444719.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_007047171.1|  ASYMMETRIC LEAVES 2-like 1                       50.1    4e-05   
ref|XP_006280835.1|  hypothetical protein CARUB_v10026811mg           50.1    4e-05   
ref|XP_006425834.1|  hypothetical protein CICLE_v10027275mg           50.1    4e-05   
ref|XP_004288064.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_009774046.1|  PREDICTED: LOB domain-containing protein 36-...  50.1    4e-05   
ref|XP_009103474.1|  PREDICTED: LOB domain-containing protein 36      50.1    4e-05   
ref|XP_009140479.1|  PREDICTED: LOB domain-containing protein 10      49.7    4e-05   
emb|CDY01457.1|  BnaA07g12300D                                        50.1    4e-05   
emb|CDY12784.1|  BnaC07g16490D                                        50.1    5e-05   
ref|XP_007203679.1|  hypothetical protein PRUPE_ppa026393mg           49.7    5e-05   
ref|XP_008241536.1|  PREDICTED: LOB domain-containing protein 36      49.7    5e-05   
ref|XP_008665134.1|  PREDICTED: LOB domain-containing protein 36-...  49.3    6e-05   
ref|XP_004500020.1|  PREDICTED: LOB domain-containing protein 36-...  48.9    7e-05   
ref|XP_004511965.1|  PREDICTED: LOB domain-containing protein 36-...  49.3    7e-05   
ref|XP_006338222.1|  PREDICTED: LOB domain-containing protein 36-...  49.3    7e-05   
ref|NP_001168375.1|  putative LOB domain-containing family protein    49.3    7e-05   Zea mays [maize]
ref|XP_008792769.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    7e-05   
ref|XP_002522325.1|  Protein ASYMMETRIC LEAVES2, putative             49.3    7e-05   Ricinus communis
ref|XP_010531219.1|  PREDICTED: LOB domain-containing protein 10-...  48.9    8e-05   
ref|XP_008371755.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    8e-05   
ref|XP_002466819.1|  hypothetical protein SORBIDRAFT_01g014650        48.9    8e-05   Sorghum bicolor [broomcorn]
dbj|BAJ99337.1|  predicted protein                                    48.9    9e-05   
ref|XP_004232054.1|  PREDICTED: LOB domain-containing protein 36-...  48.9    9e-05   
ref|XP_009377477.1|  PREDICTED: LOB domain-containing protein 36-...  48.5    9e-05   
gb|KHN36206.1|  LOB domain-containing protein 36                      47.0    1e-04   
ref|XP_003599327.1|  LOB domain-containing protein                    47.0    1e-04   
ref|XP_003525697.1|  PREDICTED: LOB domain-containing protein 36-...  48.1    2e-04   
emb|CBI23281.3|  unnamed protein product                              47.4    2e-04   
ref|XP_001754227.1|  predicted protein                                45.8    2e-04   
emb|CDY52150.1|  BnaA02g34590D                                        48.1    2e-04   
gb|EYU44367.1|  hypothetical protein MIMGU_mgv1a009012mg              48.1    2e-04   
ref|XP_010070501.1|  PREDICTED: LOB domain-containing protein 36-...  47.8    2e-04   
ref|XP_010255134.1|  PREDICTED: LOB domain-containing protein 36      47.8    2e-04   
ref|XP_010263734.1|  PREDICTED: LOB domain-containing protein 6-like  47.8    2e-04   
ref|XP_009366786.1|  PREDICTED: LOB domain-containing protein 36-...  47.8    2e-04   
ref|XP_009419060.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    2e-04   
ref|XP_011099212.1|  PREDICTED: LOB domain-containing protein 36      47.8    2e-04   
gb|KDP31887.1|  hypothetical protein JCGZ_12348                       47.8    2e-04   
ref|XP_003611797.1|  LOB domain-containing protein                    47.8    3e-04   
gb|KEH34867.1|  LOB domain protein                                    46.6    3e-04   
emb|CDP02469.1|  unnamed protein product                              47.4    3e-04   
gb|KDP31889.1|  hypothetical protein JCGZ_12350                       47.4    3e-04   
ref|XP_006573622.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    3e-04   
ref|XP_010905635.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    3e-04   
ref|XP_010086870.1|  hypothetical protein L484_005283                 47.0    3e-04   
ref|XP_002263845.2|  PREDICTED: LOB domain-containing protein 36-...  47.4    3e-04   Vitis vinifera
ref|XP_003538822.1|  PREDICTED: LOB domain-containing protein 36-...  47.4    3e-04   
ref|XP_011015884.1|  PREDICTED: LOB domain-containing protein 6-like  46.6    4e-04   
gb|KDP31888.1|  hypothetical protein JCGZ_12349                       47.0    4e-04   
gb|EPS57704.1|  hypothetical protein M569_17113                       47.0    4e-04   
ref|XP_004515644.1|  PREDICTED: LOB domain-containing protein 36-...  46.2    4e-04   
ref|XP_004515643.1|  PREDICTED: LOB domain-containing protein 36-...  46.2    5e-04   
ref|XP_006663147.1|  PREDICTED: LOB domain-containing protein 12-...  45.1    5e-04   
gb|EPS63200.1|  hypothetical protein M569_11588                       46.2    5e-04   
ref|XP_002875394.1|  LOB domain-containing protein 25                 45.1    5e-04   
ref|XP_002977789.1|  hypothetical protein SELMODRAFT_59179            44.7    5e-04   
ref|XP_006664271.1|  PREDICTED: LOB domain-containing protein 12-...  45.1    6e-04   
ref|XP_010026421.1|  PREDICTED: LOB domain-containing protein 36-...  46.2    7e-04   
ref|XP_007136211.1|  hypothetical protein PHAVU_009G027700g           45.8    7e-04   
ref|XP_009388947.1|  PREDICTED: LOB domain-containing protein 4       45.1    8e-04   
ref|XP_006344072.1|  PREDICTED: LOB domain-containing protein 12-...  43.9    9e-04   
ref|XP_010109898.1|  hypothetical protein L484_013233                 46.2    0.001   



>ref|XP_006578337.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Glycine 
max]
 ref|XP_006578338.1| PREDICTED: LOB domain-containing protein 36-like isoform X2 [Glycine 
max]
Length=212

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK+QRRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKIQRRKCTQECVFAP  26



>emb|CBI24495.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKLQRRKCTQEC++AP
Sbjct  1    MSSSNSPCAACKLQRRKCTQECIYAP  26



>emb|CBI23280.3| unnamed protein product [Vitis vinifera]
Length=141

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKLQRRKCTQEC++AP
Sbjct  1    MSSSNSPCAACKLQRRKCTQECIYAP  26



>ref|XP_002263136.3| PREDICTED: LOB domain-containing protein 36 [Vitis vinifera]
Length=245

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKLQRRKCTQEC++AP
Sbjct  1    MSSSNSPCAACKLQRRKCTQECIYAP  26



>ref|XP_010662454.1| PREDICTED: protein LATERAL ORGAN BOUNDARIES-like [Vitis vinifera]
Length=287

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKLQRRKCTQEC++AP
Sbjct  1    MSSSNSPCAACKLQRRKCTQECIYAP  26



>emb|CBI29565.3| unnamed protein product [Vitis vinifera]
Length=223

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQECVFAP  26



>ref|XP_006581558.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Glycine 
max]
 ref|XP_006581559.1| PREDICTED: LOB domain-containing protein 36-like isoform X2 [Glycine 
max]
Length=215

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK+QRRKCTQECVFAP
Sbjct  3    SSSNSPCAACKIQRRKCTQECVFAP  27



>ref|NP_179946.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 ref|NP_001154530.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 sp|O64836.1|LBD10_ARATH RecName: Full=LOB domain-containing protein 10; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 2; Short=AS2-like protein 
2 [Arabidopsis thaliana]
 gb|AAC17095.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14865.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH10546.1| ASYMMETRIC LEAVES2-like 2 protein [Arabidopsis thaliana]
 gb|AEC07476.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 gb|AEC07477.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
Length=311

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_003635533.2| PREDICTED: LOB domain-containing protein 36-like, partial [Vitis 
vinifera]
Length=263

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQECVFAP  26



>gb|KHN09146.1| LOB domain-containing protein 36 [Glycine soja]
Length=238

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK+QRRKCTQECVFAP
Sbjct  3    SSSNSPCAACKIQRRKCTQECVFAP  27



>emb|CBI23279.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQECVFAP  26



>ref|XP_002263109.2| PREDICTED: LOB domain-containing protein 36-like [Vitis vinifera]
Length=292

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQECVFAP  26



>ref|XP_002880519.1| LOB domain family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56778.1| LOB domain family protein [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_007155957.1| hypothetical protein PHAVU_003G246700g [Phaseolus vulgaris]
 gb|ESW27951.1| hypothetical protein PHAVU_003G246700g [Phaseolus vulgaris]
Length=273

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSS ++PCAACKL RRKCTQECVFAP
Sbjct  1    MSSMNSPCAACKLLRRKCTQECVFAP  26



>ref|XP_010680494.1| PREDICTED: LOB domain-containing protein 25-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=215

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010417109.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417110.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417111.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417112.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
Length=308

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_010687953.1| PREDICTED: LOB domain-containing protein 36-like [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>gb|EMT24456.1| hypothetical protein F775_33210 [Aegilops tauschii]
Length=79

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>ref|XP_006296515.1| hypothetical protein CARUB_v10025704mg [Capsella rubella]
 gb|EOA29413.1| hypothetical protein CARUB_v10025704mg [Capsella rubella]
Length=309

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_011039216.1| PREDICTED: LOB domain-containing protein 36 isoform X2 [Populus 
euphratica]
Length=280

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_006360231.1| PREDICTED: LOB domain-containing protein 36-like [Solanum tuberosum]
Length=287

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>gb|KHG26276.1| LOB domain-containing 36 -like protein [Gossypium arboreum]
Length=307

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>gb|KEH33776.1| LOB domain protein [Medicago truncatula]
Length=291

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQEC FAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECDFAP  26



>ref|XP_006404852.1| hypothetical protein EUTSA_v10000525mg [Eutrema salsugineum]
 gb|ESQ46305.1| hypothetical protein EUTSA_v10000525mg [Eutrema salsugineum]
Length=310

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_002866728.1| hypothetical protein ARALYDRAFT_496913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42987.1| hypothetical protein ARALYDRAFT_496913 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_004233943.1| PREDICTED: LOB domain-containing protein 36-like [Solanum lycopersicum]
Length=291

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>gb|KHG29668.1| LOB domain-containing 36 -like protein [Gossypium arboreum]
Length=321

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010472359.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010472360.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010472361.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
Length=308

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_011039214.1| PREDICTED: LOB domain-containing protein 36 isoform X1 [Populus 
euphratica]
 ref|XP_011039215.1| PREDICTED: LOB domain-containing protein 36 isoform X1 [Populus 
euphratica]
Length=285

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010464781.1| PREDICTED: LOB domain-containing protein 36-like [Camelina sativa]
Length=327

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009792980.1| PREDICTED: LOB domain-containing protein 36-like [Nicotiana sylvestris]
Length=310

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009630099.1| PREDICTED: LOB domain-containing protein 36-like [Nicotiana tomentosiformis]
 ref|XP_009630101.1| PREDICTED: LOB domain-containing protein 36-like [Nicotiana tomentosiformis]
 ref|XP_009630102.1| PREDICTED: LOB domain-containing protein 36-like [Nicotiana tomentosiformis]
Length=312

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_011009273.1| PREDICTED: LOB domain-containing protein 36-like [Populus euphratica]
 ref|XP_011009274.1| PREDICTED: LOB domain-containing protein 36-like [Populus euphratica]
 ref|XP_011009275.1| PREDICTED: LOB domain-containing protein 36-like [Populus euphratica]
 ref|XP_011009276.1| PREDICTED: LOB domain-containing protein 36-like [Populus euphratica]
Length=295

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>gb|EMS45175.1| hypothetical protein TRIUR3_06488 [Triticum urartu]
Length=162

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>ref|XP_009600699.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Nicotiana 
tomentosiformis]
Length=304

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010484574.1| PREDICTED: LOB domain-containing protein 36 [Camelina sativa]
 ref|XP_010484575.1| PREDICTED: LOB domain-containing protein 36 [Camelina sativa]
Length=320

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_002307250.2| LOB domain protein 28 [Populus trichocarpa]
 gb|EEE94246.2| LOB domain protein 28 [Populus trichocarpa]
Length=295

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009600700.1| PREDICTED: LOB domain-containing protein 36-like isoform X2 [Nicotiana 
tomentosiformis]
Length=300

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_002310159.2| hypothetical protein POPTR_0007s11460g [Populus trichocarpa]
 gb|EEE90609.2| hypothetical protein POPTR_0007s11460g [Populus trichocarpa]
Length=287

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|NP_201488.1| LOB domain-containing protein 36 (ASYMMETRIC LEAVES 2-like protein 
1) [Arabidopsis thaliana]
 sp|Q9FKZ3.1|LBD36_ARATH RecName: Full=LOB domain-containing protein 36; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 1; Short=AS2-like protein 
1 [Arabidopsis thaliana]
 dbj|BAB08629.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD12422.1| ASYMMETRIC LEAVES2-like gene 1 protein [Arabidopsis thaliana]
 gb|ACH90465.1| At5g66870 [Arabidopsis thaliana]
 dbj|BAH10545.1| ASYMMETRIC LEAVES2-like 1 protein [Arabidopsis thaliana]
 gb|AED98273.1| LOB domain-containing protein 36 (ASYMMETRIC LEAVES 2-like protein 
1) [Arabidopsis thaliana]
Length=313

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>dbj|BAF00455.1| hypothetical protein [Arabidopsis thaliana]
Length=313

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010941839.1| PREDICTED: LOB domain-containing protein 36-like [Elaeis guineensis]
Length=316

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKLQRRKC Q CVFAP
Sbjct  1    MSSSNSPCAACKLQRRKCAQGCVFAP  26



>ref|XP_006393884.1| hypothetical protein EUTSA_v10004535mg [Eutrema salsugineum]
 gb|ESQ31170.1| hypothetical protein EUTSA_v10004535mg [Eutrema salsugineum]
Length=338

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010429315.1| PREDICTED: LOB domain-containing protein 10 [Camelina sativa]
Length=308

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_008457883.1| PREDICTED: LOB domain-containing protein 36-like [Cucumis melo]
 ref|XP_008457884.1| PREDICTED: LOB domain-containing protein 36-like [Cucumis melo]
Length=310

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_004148465.1| PREDICTED: LOB domain-containing protein 36-like [Cucumis sativus]
 ref|XP_004171822.1| PREDICTED: LOB domain-containing protein 36-like [Cucumis sativus]
 gb|KGN62069.1| hypothetical protein Csa_2G295940 [Cucumis sativus]
Length=309

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_010444719.1| PREDICTED: LOB domain-containing protein 36-like [Camelina sativa]
Length=322

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_007047171.1| ASYMMETRIC LEAVES 2-like 1 [Theobroma cacao]
 gb|EOX91328.1| ASYMMETRIC LEAVES 2-like 1 [Theobroma cacao]
Length=317

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_006280835.1| hypothetical protein CARUB_v10026811mg [Capsella rubella]
 gb|EOA13733.1| hypothetical protein CARUB_v10026811mg [Capsella rubella]
Length=313

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_006425834.1| hypothetical protein CICLE_v10027275mg [Citrus clementina]
 ref|XP_006466646.1| PREDICTED: LOB domain-containing protein 36-like [Citrus sinensis]
 gb|ESR39074.1| hypothetical protein CICLE_v10027275mg [Citrus clementina]
 gb|KDO37062.1| hypothetical protein CISIN_1g039589mg [Citrus sinensis]
Length=296

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_004288064.1| PREDICTED: LOB domain-containing protein 36-like [Fragaria vesca 
subsp. vesca]
Length=306

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009774046.1| PREDICTED: LOB domain-containing protein 36-like [Nicotiana sylvestris]
Length=307

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009103474.1| PREDICTED: LOB domain-containing protein 36 [Brassica rapa]
 ref|XP_009103475.1| PREDICTED: LOB domain-containing protein 36 [Brassica rapa]
Length=338

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009140479.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140480.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140481.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140482.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 emb|CDX89590.1| BnaC04g36090D [Brassica napus]
 emb|CDX68120.1| BnaA07g21600D [Brassica napus]
Length=308

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>emb|CDY01457.1| BnaA07g12300D [Brassica napus]
Length=338

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>emb|CDY12784.1| BnaC07g16490D [Brassica napus]
Length=336

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SSS+PCAACK  RRKCTQECVFAP
Sbjct  1    MASSSSPCAACKFLRRKCTQECVFAP  26



>ref|XP_007203679.1| hypothetical protein PRUPE_ppa026393mg [Prunus persica]
 gb|EMJ04878.1| hypothetical protein PRUPE_ppa026393mg [Prunus persica]
Length=312

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_008241536.1| PREDICTED: LOB domain-containing protein 36 [Prunus mume]
 ref|XP_008241537.1| PREDICTED: LOB domain-containing protein 36 [Prunus mume]
 ref|XP_008241538.1| PREDICTED: LOB domain-containing protein 36 [Prunus mume]
Length=312

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_008665134.1| PREDICTED: LOB domain-containing protein 36-like [Zea mays]
 tpg|DAA50439.1| TPA: putative LOB domain-containing family protein [Zea mays]
 gb|AIB04648.1| LOB transcription factor, partial [Zea mays]
Length=281

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>ref|XP_004500020.1| PREDICTED: LOB domain-containing protein 36-like [Cicer arietinum]
Length=272

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  R+KCTQEC FAP
Sbjct  1    MSSSNSPCAACKFLRQKCTQECYFAP  26



>ref|XP_004511965.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Cicer 
arietinum]
Length=298

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK QRRKCTQECVFAP
Sbjct  3    SSSNSPCAACKAQRRKCTQECVFAP  27



>ref|XP_006338222.1| PREDICTED: LOB domain-containing protein 36-like [Solanum tuberosum]
Length=313

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSS+++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSTNSPCAACKFLRRKCTQECVFAP  26



>ref|NP_001168375.1| putative LOB domain-containing family protein [Zea mays]
 ref|XP_008643991.1| PREDICTED: putative LOB domain-containing family protein isoform 
X1 [Zea mays]
 gb|ACN28006.1| unknown [Zea mays]
 gb|AFW68222.1| putative LOB domain-containing family protein [Zea mays]
 gb|AIB05215.1| LOB transcription factor, partial [Zea mays]
Length=299

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>ref|XP_008792769.1| PREDICTED: LOB domain-containing protein 36-like, partial [Phoenix 
dactylifera]
Length=134

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQGCVFAP  26



>ref|XP_002522325.1| Protein ASYMMETRIC LEAVES2, putative [Ricinus communis]
 gb|EEF40009.1| Protein ASYMMETRIC LEAVES2, putative [Ricinus communis]
Length=310

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MS+  +PCAACKLQRRKCTQ+CVFAP
Sbjct  1    MSTPISPCAACKLQRRKCTQDCVFAP  26



>ref|XP_010531219.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531220.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531221.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531222.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531223.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531224.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
Length=295

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            +STPCAACKL RRKCTQECVFAP
Sbjct  2    ASTPCAACKLLRRKCTQECVFAP  24



>ref|XP_008371755.1| PREDICTED: LOB domain-containing protein 36-like [Malus domestica]
Length=161

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            S++ +PCAACK QRRKCTQECVFAP
Sbjct  3    SNTHSPCAACKFQRRKCTQECVFAP  27



>ref|XP_002466819.1| hypothetical protein SORBIDRAFT_01g014650 [Sorghum bicolor]
 gb|EER93817.1| hypothetical protein SORBIDRAFT_01g014650 [Sorghum bicolor]
Length=297

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>dbj|BAJ99337.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACKL RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKLLRRKCTQGCVFAP  26



>ref|XP_004232054.1| PREDICTED: LOB domain-containing protein 36-like [Solanum lycopersicum]
 ref|XP_010316156.1| PREDICTED: LOB domain-containing protein 36-like [Solanum lycopersicum]
Length=311

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSS+++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSTNSPCAACKFLRRKCTQECVFAP  26



>ref|XP_009377477.1| PREDICTED: LOB domain-containing protein 36-like [Pyrus x bretschneideri]
Length=248

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            S++ +PCAACK QRRKCTQECVFAP
Sbjct  3    SNTHSPCAACKFQRRKCTQECVFAP  27



>gb|KHN36206.1| LOB domain-containing protein 36 [Glycine soja]
Length=159

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_003599327.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES69578.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=177

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M S S+PCA+CKL RR+CTQEC+FAP
Sbjct  1    MGSGSSPCASCKLLRRRCTQECIFAP  26



>ref|XP_003525697.1| PREDICTED: LOB domain-containing protein 36-like [Glycine max]
Length=276

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCA CKL RRKCTQECVFAP
Sbjct  3    SSSNSPCAGCKLLRRKCTQECVFAP  27



>emb|CBI23281.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK++R+KCTQECV AP
Sbjct  1    MSSSNSPCAACKIRRQKCTQECVLAP  26



>ref|XP_001754227.1| predicted protein [Physcomitrella patens]
 gb|EDQ81128.1| predicted protein [Physcomitrella patens]
Length=113

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSSS PCAACK  RRKCT+ECVFAP
Sbjct  3    SSSSFPCAACKFLRRKCTEECVFAP  27



>emb|CDY52150.1| BnaA02g34590D [Brassica napus]
Length=316

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            S+SS+PCAACK  RRKCTQECVFAP
Sbjct  4    STSSSPCAACKFLRRKCTQECVFAP  28



>gb|EYU44367.1| hypothetical protein MIMGU_mgv1a009012mg [Erythranthe guttata]
Length=355

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKCLRRKCTQECVFAP  26



>ref|XP_010070501.1| PREDICTED: LOB domain-containing protein 36-like [Eucalyptus 
grandis]
 ref|XP_010070502.1| PREDICTED: LOB domain-containing protein 36-like [Eucalyptus 
grandis]
Length=304

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKCLRRKCTQECVFAP  26



>ref|XP_010255134.1| PREDICTED: LOB domain-containing protein 36 [Nelumbo nucifera]
Length=301

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_010263734.1| PREDICTED: LOB domain-containing protein 6-like [Nelumbo nucifera]
Length=306

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_009366786.1| PREDICTED: LOB domain-containing protein 36-like [Pyrus x bretschneideri]
 ref|XP_009366787.1| PREDICTED: LOB domain-containing protein 36-like [Pyrus x bretschneideri]
 ref|XP_009366788.1| PREDICTED: LOB domain-containing protein 36-like [Pyrus x bretschneideri]
Length=293

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_009419060.1| PREDICTED: LOB domain-containing protein 36-like [Musa acuminata 
subsp. malaccensis]
Length=278

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  162  RREK*MSSSSTPCAACKLQRRKCTQECVFAP  254
            R E+   SSS+PCAACKL RRKCT EC+FAP
Sbjct  17   REERRAMSSSSPCAACKLLRRKCTPECIFAP  47



>ref|XP_011099212.1| PREDICTED: LOB domain-containing protein 36 [Sesamum indicum]
Length=338

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKCLRRKCTQECVFAP  26



>gb|KDP31887.1| hypothetical protein JCGZ_12348 [Jatropha curcas]
Length=304

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_003611797.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES94755.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=318

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>gb|KEH34867.1| LOB domain protein [Medicago truncatula]
Length=202

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 26/27 (96%), Gaps = 1/27 (4%)
 Frame = +3

Query  177  MSS-SSTPCAACKLQRRKCTQECVFAP  254
            MSS +S+PCAACK+QRRKCT+EC+FAP
Sbjct  2    MSSCNSSPCAACKIQRRKCTKECIFAP  28



>emb|CDP02469.1| unnamed protein product [Coffea canephora]
Length=292

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQECVFAP
Sbjct  1    MSSSNSPCAACKCLRRKCTQECVFAP  26



>gb|KDP31889.1| hypothetical protein JCGZ_12350 [Jatropha curcas]
Length=293

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSS ++PCAACK +R+KCTQECVFAP
Sbjct  1    MSSPNSPCAACKFRRQKCTQECVFAP  26



>ref|XP_006573622.1| PREDICTED: LOB domain-containing protein 36-like [Glycine max]
Length=304

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_010905635.1| PREDICTED: LOB domain-containing protein 36-like [Elaeis guineensis]
 ref|XP_010905636.1| PREDICTED: LOB domain-containing protein 36-like [Elaeis guineensis]
Length=308

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCTQ CVFAP
Sbjct  1    MSSSNSPCAACKFLRRKCTQGCVFAP  26



>ref|XP_010086870.1| hypothetical protein L484_005283 [Morus notabilis]
 gb|EXB24354.1| hypothetical protein L484_005283 [Morus notabilis]
Length=252

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS +PCAACK  RRKCTQECVFAP
Sbjct  4    SSSHSPCAACKFLRRKCTQECVFAP  28



>ref|XP_002263845.2| PREDICTED: LOB domain-containing protein 36-like [Vitis vinifera]
Length=307

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK++R+KCTQECV AP
Sbjct  9    MSSSNSPCAACKIRRQKCTQECVLAP  34



>ref|XP_003538822.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Glycine 
max]
 ref|XP_006590661.1| PREDICTED: LOB domain-containing protein 36-like isoform X2 [Glycine 
max]
 ref|XP_006590662.1| PREDICTED: LOB domain-containing protein 36-like isoform X3 [Glycine 
max]
 gb|KHN42061.1| LOB domain-containing protein 36 [Glycine soja]
Length=308

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            SSS++PCAACK  RRKCTQECVFAP
Sbjct  3    SSSNSPCAACKFLRRKCTQECVFAP  27



>ref|XP_011015884.1| PREDICTED: LOB domain-containing protein 6-like [Populus euphratica]
Length=220

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  162  RREK*MSSSSTPCAACKLQRRKCTQECVFAP  254
            RR K  SSS++PCAACK  RRKC  ECVFAP
Sbjct  3    RRWKMASSSNSPCAACKFLRRKCQPECVFAP  33



>gb|KDP31888.1| hypothetical protein JCGZ_12349 [Jatropha curcas]
Length=294

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MS+ ++PCAACK  RRKCTQECVFAP
Sbjct  1    MSTPNSPCAACKFLRRKCTQECVFAP  26



>gb|EPS57704.1| hypothetical protein M569_17113, partial [Genlisea aurea]
Length=256

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+SS++PCAACK  RRKCTQECVFAP
Sbjct  1    MTSSNSPCAACKCLRRKCTQECVFAP  26



>ref|XP_004515644.1| PREDICTED: LOB domain-containing protein 36-like isoform X2 [Cicer 
arietinum]
Length=221

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M   +TPCAACK+QRRKCT+ECVFAP
Sbjct  1    MVPWNTPCAACKIQRRKCTEECVFAP  26



>ref|XP_004515643.1| PREDICTED: LOB domain-containing protein 36-like isoform X1 [Cicer 
arietinum]
Length=221

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M   +TPCAACK+QRRKCT+ECVFAP
Sbjct  1    MVPWNTPCAACKIQRRKCTEECVFAP  26



>ref|XP_006663147.1| PREDICTED: LOB domain-containing protein 12-like [Oryza brachyantha]
Length=157

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+ S TPCA+CKL RR+CT ECVFAP
Sbjct  1    MAGSGTPCASCKLLRRRCTSECVFAP  26



>gb|EPS63200.1| hypothetical protein M569_11588, partial [Genlisea aurea]
Length=242

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSSS++PCAACK  RRKCT ECVFAP
Sbjct  1    MSSSNSPCAACKCLRRKCTHECVFAP  26



>ref|XP_002875394.1| LOB domain-containing protein 25 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51653.1| LOB domain-containing protein 25 [Arabidopsis lyrata subsp. lyrata]
Length=157

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  156  GERREK*MSSSSTPCAACKLQRRKCTQECVFAP  254
            G+ +EK  + +++PCAACK  RRKCT +CVFAP
Sbjct  24   GDIQEKMSNYTNSPCAACKFLRRKCTSDCVFAP  56



>ref|XP_002977789.1| hypothetical protein SELMODRAFT_59179, partial [Selaginella moellendorffii]
 gb|EFJ21127.1| hypothetical protein SELMODRAFT_59179, partial [Selaginella moellendorffii]
Length=116

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  186  SSTPCAACKLQRRKCTQECVFAP  254
            SS+PCAACKL RRKCT+ECVFAP
Sbjct  1    SSSPCAACKLLRRKCTRECVFAP  23



>ref|XP_006664271.1| PREDICTED: LOB domain-containing protein 12-like [Oryza brachyantha]
Length=157

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M+ S TPCA+CKL RR+CT ECVFAP
Sbjct  1    MAGSGTPCASCKLLRRRCTSECVFAP  26



>ref|XP_010026421.1| PREDICTED: LOB domain-containing protein 36-like [Eucalyptus 
grandis]
Length=294

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            MSS S+PCAACK QRRKCT ECVFAP
Sbjct  1    MSSLSSPCAACKCQRRKCTPECVFAP  26



>ref|XP_007136211.1| hypothetical protein PHAVU_009G027700g [Phaseolus vulgaris]
 gb|ESW08205.1| hypothetical protein PHAVU_009G027700g [Phaseolus vulgaris]
Length=214

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  195  PCAACKLQRRKCTQECVFAP  254
            PCAACK+QRRKCTQECVFAP
Sbjct  11   PCAACKIQRRKCTQECVFAP  30



>ref|XP_009388947.1| PREDICTED: LOB domain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=174

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  180  SSSSTPCAACKLQRRKCTQECVFAP  254
            +S+ +PCAACKL RR+CTQECVFAP
Sbjct  8    NSTVSPCAACKLLRRRCTQECVFAP  32



>ref|XP_006344072.1| PREDICTED: LOB domain-containing protein 12-like, partial [Solanum 
tuberosum]
Length=115

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  177  MSSSSTPCAACKLQRRKCTQECVFAP  254
            M  SS+PCA+CKL RR+CT++C+FAP
Sbjct  1    MGGSSSPCASCKLLRRRCTKDCIFAP  26



>ref|XP_010109898.1| hypothetical protein L484_013233 [Morus notabilis]
 gb|EXC24867.1| hypothetical protein L484_013233 [Morus notabilis]
Length=319

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/20 (95%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +3

Query  195  PCAACKLQRRKCTQECVFAP  254
            PCAACK+QRRKCTQECVFAP
Sbjct  9    PCAACKIQRRKCTQECVFAP  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509187792286