BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4842_g1_i1 len=366 path=[1:0-365]

Length=366
                                                                      Score     E

ref|XP_010326583.1|  PREDICTED: rapid alkalinization factor             145   1e-41   
ref|XP_009775621.1|  PREDICTED: rapid alkalinization factor-like        143   6e-41   
ref|XP_009604381.1|  PREDICTED: rapid alkalinization factor-like        139   2e-39   
ref|XP_002263387.1|  PREDICTED: rapid alkalinization factor             137   8e-39   Vitis vinifera
ref|XP_006444286.1|  hypothetical protein CICLE_v10023750mg             135   5e-38   
ref|XP_010269500.1|  PREDICTED: rapid alkalinization factor-like        136   6e-38   
gb|KDP23480.1|  hypothetical protein JCGZ_23313                         135   6e-38   
ref|XP_007050868.1|  Ralf-like 33, putative                             134   1e-37   
ref|XP_002512426.1|  RALFL33, putative                                  134   3e-37   Ricinus communis
ref|XP_008235043.1|  PREDICTED: protein RALF-like 33                    133   5e-37   
ref|XP_006382486.1|  RALF-LIKE 23 family protein                        132   1e-36   
gb|AAO27366.1|  rapid alkalinization factor 1 precursor                 132   2e-36   Populus trichocarpa x Populus deltoides
ref|XP_006359396.1|  PREDICTED: rapid alkalinization factor-like        131   3e-36   
ref|XP_011023680.1|  PREDICTED: rapid alkalinization factor-like        131   4e-36   
ref|XP_007030995.1|  Rapid alkalinization factor 1, putative            130   8e-36   
ref|XP_006344656.1|  PREDICTED: rapid alkalinization factor-like        129   2e-35   
ref|XP_011036862.1|  PREDICTED: protein RALF-like 33                    129   2e-35   
ref|XP_008246447.1|  PREDICTED: rapid alkalinization factor             129   2e-35   
ref|XP_003626248.1|  hypothetical protein MTR_7g113080                  129   2e-35   
ref|XP_008370433.1|  PREDICTED: rapid alkalinization factor-like        129   2e-35   
gb|EYU46690.1|  hypothetical protein MIMGU_mgv1a016538mg                129   2e-35   
ref|XP_002531878.1|  RALFL33, putative                                  128   3e-35   Ricinus communis
ref|XP_007206150.1|  hypothetical protein PRUPE_ppa013461mg             128   4e-35   
emb|CBI26076.3|  unnamed protein product                                129   5e-35   
ref|XP_010313004.1|  PREDICTED: rapid alkalinization factor             128   5e-35   
gb|AAR00326.1|  rapid alkalinization factor 2                           127   8e-35   Solanum chacoense
emb|CAN83593.1|  hypothetical protein VITISV_037723                     127   9e-35   Vitis vinifera
ref|XP_002273386.1|  PREDICTED: protein RALF-like 33                    127   1e-34   Vitis vinifera
ref|XP_004290774.1|  PREDICTED: protein RALF-like 33-like isoform 1     126   2e-34   
ref|XP_010025230.1|  PREDICTED: rapid alkalinization factor-like        127   2e-34   
ref|XP_004495709.1|  PREDICTED: rapid alkalinization factor-like        126   2e-34   
ref|XP_007199089.1|  hypothetical protein PRUPE_ppa020353mg             125   2e-34   
ref|XP_004172589.1|  PREDICTED: protein RALF-like 33-like               126   3e-34   
ref|XP_008454184.1|  PREDICTED: protein RALF-like 33                    125   4e-34   
ref|XP_011082482.1|  PREDICTED: rapid alkalinization factor-like        125   5e-34   
ref|XP_004494597.1|  PREDICTED: protein RALF-like 33-like               125   8e-34   
ref|XP_009376626.1|  PREDICTED: protein RALF-like 33                    124   1e-33   
gb|AAS13437.1|  rapid alkalinization factor preproprotein               124   2e-33   Nicotiana attenuata
ref|XP_002319521.1|  RALF-LIKE 23 family protein                        124   3e-33   Populus trichocarpa [western balsam poplar]
gb|AAO27367.1|  rapid alkalinization factor 2 precursor                 123   4e-33   Populus trichocarpa x Populus deltoides
ref|XP_008359858.1|  PREDICTED: rapid alkalinization factor-like        122   8e-33   
emb|CDP03512.1|  unnamed protein product                                122   9e-33   
ref|XP_002283709.1|  PREDICTED: protein RALF-like 33                    122   1e-32   Vitis vinifera
ref|XP_009342123.1|  PREDICTED: protein RALF-like 33                    120   3e-32   
ref|XP_010038196.1|  PREDICTED: rapid alkalinization factor-like        120   4e-32   
ref|XP_007144948.1|  hypothetical protein PHAVU_007G197000g             120   4e-32   
ref|XP_010259629.1|  PREDICTED: rapid alkalinization factor             120   4e-32   
ref|XP_011087422.1|  PREDICTED: rapid alkalinization factor             120   4e-32   
ref|XP_010474880.1|  PREDICTED: protein RALF-like 1                     120   6e-32   
ref|XP_008368985.1|  PREDICTED: rapid alkalinization factor-like        120   7e-32   
gb|ABK96369.1|  unknown                                                 119   2e-31   Populus trichocarpa x Populus deltoides
ref|XP_002321018.2|  hypothetical protein POPTR_0014s12630g             119   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010921813.1|  PREDICTED: protein RALF-like 33                    119   2e-31   
ref|XP_003536069.1|  PREDICTED: protein RALF-like 1-like                118   2e-31   
ref|XP_006389381.1|  hypothetical protein POPTR_0026s00240g             118   2e-31   
gb|KFK42648.1|  rapid alkalinization factor 1                           119   2e-31   
ref|NP_567476.1|  protein ralf-like 33                                  117   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABS72341.1|  rapid alkalinization factor precursor                   118   5e-31   Litchi chinensis [litchi]
ref|XP_004302396.1|  PREDICTED: protein RALF-like 33-like isoform 2     117   6e-31   
ref|XP_009778264.1|  PREDICTED: rapid alkalinization factor             117   6e-31   
ref|XP_009629090.1|  PREDICTED: rapid alkalinization factor             117   7e-31   
ref|XP_004302395.1|  PREDICTED: protein RALF-like 33-like isoform 1     117   8e-31   
ref|XP_010457289.1|  PREDICTED: protein RALF-like 1                     117   1e-30   
ref|XP_010691694.1|  PREDICTED: protein RALF-like 33                    117   1e-30   
ref|XP_011092082.1|  PREDICTED: rapid alkalinization factor-like        116   1e-30   
ref|XP_008386646.1|  PREDICTED: rapid alkalinization factor-like        116   1e-30   
gb|KHN16104.1|  hypothetical protein glysoja_012080                     115   2e-30   
ref|XP_003529566.1|  PREDICTED: rapid alkalinization factor 23-like     116   2e-30   
gb|KDP28133.1|  hypothetical protein JCGZ_13904                         116   3e-30   
ref|XP_009412092.1|  PREDICTED: protein RALF-like 33                    115   4e-30   
ref|XP_011033568.1|  PREDICTED: protein RALF-like 1                     115   6e-30   
emb|CDY15442.1|  BnaA08g27260D                                          115   6e-30   
ref|XP_009119598.1|  PREDICTED: protein RALF-like 1                     115   6e-30   
ref|XP_010105661.1|  hypothetical protein L484_010825                   115   6e-30   
gb|KFK39006.1|  hypothetical protein AALP_AA3G188700                    115   7e-30   
ref|XP_006606531.1|  PREDICTED: protein RALF-like 1-like                114   7e-30   
gb|KFK32572.1|  hypothetical protein AALP_AA6G260700                    115   8e-30   
ref|XP_009136714.1|  PREDICTED: protein RALF-like 33                    114   9e-30   
emb|CDX99974.1|  BnaC09g03270D                                          114   9e-30   
ref|XP_002516916.1|  RALFL33, putative                                  114   1e-29   Ricinus communis
emb|CDX89932.1|  BnaA10g01500D                                          114   1e-29   
emb|CDX86697.1|  BnaC08g00060D                                          114   2e-29   
ref|XP_010097623.1|  hypothetical protein L484_001106                   115   2e-29   
gb|EYU42176.1|  hypothetical protein MIMGU_mgv1a016421mg                114   2e-29   
ref|XP_009111745.1|  PREDICTED: protein RALF-like 22                    113   3e-29   
ref|XP_003550267.1|  PREDICTED: rapid alkalinization factor 23-like     113   3e-29   
ref|XP_010434917.1|  PREDICTED: protein RALF-like 33                    112   4e-29   
ref|XP_010043059.1|  PREDICTED: rapid alkalinization factor             112   5e-29   
ref|XP_010481344.1|  PREDICTED: protein RALF-like 1                     112   7e-29   
ref|XP_007035581.1|  Rapid alkalinization factor 1, putative            112   8e-29   
ref|XP_002870208.1|  hypothetical protein ARALYDRAFT_493304             112   8e-29   
ref|XP_009111178.1|  PREDICTED: protein RALF-like 1                     112   9e-29   
ref|XP_007154282.1|  hypothetical protein PHAVU_003G105300g             112   1e-28   
ref|XP_006414444.1|  hypothetical protein EUTSA_v10026579mg             112   1e-28   
emb|CDY18130.1|  BnaC05g01530D                                          112   1e-28   
gb|AES91867.2|  RALF                                                    112   1e-28   
ref|NP_171789.1|  rapid alkalinization factor 1                         111   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349507.1|  PREDICTED: rapid alkalinization factor-like        110   3e-28   
ref|XP_010522782.1|  PREDICTED: protein RALF-like 1                     110   3e-28   
ref|XP_010069952.1|  PREDICTED: rapid alkalinization factor-like        110   4e-28   
ref|XP_006285957.1|  hypothetical protein CARUB_v10007476mg             110   4e-28   
ref|XP_010090810.1|  hypothetical protein L484_009088                   110   5e-28   
ref|XP_010914425.1|  PREDICTED: protein RALF-like 33                    110   5e-28   
ref|XP_008789920.1|  PREDICTED: protein RALF-like 33                    110   5e-28   
ref|XP_008786719.1|  PREDICTED: protein RALF-like 33                    110   5e-28   
gb|KHN31786.1|  hypothetical protein glysoja_050399                     108   5e-28   
gb|KHN20242.1|  hypothetical protein glysoja_023805                     108   6e-28   
ref|XP_003609670.1|  Rapid alkalinization factor                        110   6e-28   
ref|XP_002892134.1|  hypothetical protein ARALYDRAFT_470261             109   7e-28   
ref|XP_003521558.1|  PREDICTED: rapid alkalinization factor-like        109   7e-28   
ref|XP_009802961.1|  PREDICTED: rapid alkalinization factor-like        109   8e-28   
emb|CDY09740.1|  BnaC07g33210D                                          108   1e-27   
gb|EPS59172.1|  rapid alkalinization factor 2                           108   1e-27   
ref|XP_008800838.1|  PREDICTED: rapid alkalinization factor-like        108   1e-27   
ref|XP_009381039.1|  PREDICTED: rapid alkalinization factor-like        108   1e-27   
gb|EYU42214.1|  hypothetical protein MIMGU_mgv1a016660mg                108   1e-27   
ref|XP_008775576.1|  PREDICTED: protein RALF-like 33                    108   2e-27   
ref|XP_006419584.1|  hypothetical protein CICLE_v10006201mg             109   2e-27   
ref|NP_001235444.1|  uncharacterized protein LOC100500513 precursor     108   2e-27   
ref|XP_009351497.1|  PREDICTED: rapid alkalinization factor-like        108   2e-27   
ref|XP_010931639.1|  PREDICTED: protein RALF-like 33                    108   2e-27   
ref|XP_009418953.1|  PREDICTED: protein RALF-like 33                    108   2e-27   
gb|AFK33323.1|  unknown                                                 108   3e-27   
ref|XP_006288916.1|  hypothetical protein CARUB_v10002279mg             108   3e-27   
ref|XP_007147024.1|  hypothetical protein PHAVU_006G089900g             107   5e-27   
ref|XP_010931638.1|  PREDICTED: rapid alkalinization factor-like        107   5e-27   
ref|XP_010098288.1|  hypothetical protein L484_023536                   107   7e-27   
ref|XP_004508218.1|  PREDICTED: rapid alkalinization factor 23-like     107   7e-27   
gb|KGN44918.1|  hypothetical protein Csa_7G396340                       107   8e-27   
ref|XP_008451660.1|  PREDICTED: rapid alkalinization factor-like        107   8e-27   
ref|XP_008339535.1|  PREDICTED: rapid alkalinization factor-like        107   9e-27   
ref|XP_006304742.1|  hypothetical protein CARUB_v10012118mg             107   1e-26   
ref|XP_008358766.1|  PREDICTED: rapid alkalinization factor-like        106   1e-26   
ref|XP_003521695.2|  PREDICTED: protein RALF-like 1-like isoform 1      108   1e-26   
ref|XP_009384171.1|  PREDICTED: protein RALF-like 33                    106   1e-26   
ref|XP_006299574.1|  hypothetical protein CARUB_v10015749mg             106   2e-26   
ref|XP_008353053.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...    107   3e-26   
ref|XP_004152366.1|  PREDICTED: protein RALF-like 33-like               105   3e-26   
gb|KHN15225.1|  hypothetical protein glysoja_042499                     105   3e-26   
gb|KDP27792.1|  hypothetical protein JCGZ_18872                         105   4e-26   
ref|XP_009393214.1|  PREDICTED: rapid alkalinization factor-like        105   5e-26   
ref|XP_002883013.1|  hypothetical protein ARALYDRAFT_897975             105   6e-26   
emb|CDY19732.1|  BnaA09g03850D                                          104   6e-26   
ref|XP_003554646.1|  PREDICTED: protein RALF-like 1-like                105   7e-26   
ref|XP_004143090.1|  PREDICTED: protein RALF-like 33-like               104   8e-26   
ref|XP_008458453.1|  PREDICTED: protein RALF-like 33                    104   9e-26   
ref|XP_009351500.1|  PREDICTED: protein RALF-like 33                    103   1e-25   
ref|XP_006406825.1|  hypothetical protein EUTSA_v10021739mg             103   2e-25   
emb|CDX92081.1|  BnaA05g23260D                                          103   2e-25   
ref|XP_010487517.1|  PREDICTED: rapid alkalinization factor 23-like     103   3e-25   
ref|XP_010465683.1|  PREDICTED: rapid alkalinization factor 23-like     103   3e-25   
ref|XP_006840509.1|  hypothetical protein AMTR_s00045p00202280          102   4e-25   
ref|XP_010493984.1|  PREDICTED: protein RALF-like 22                    102   5e-25   
ref|XP_009349509.1|  PREDICTED: protein RALF-like 33                    102   6e-25   
gb|EPS64947.1|  rapid alkalinization factor 2                           101   8e-25   
ref|XP_006279280.1|  hypothetical protein CARUB_v10016532mg             100   9e-25   
ref|XP_006433408.1|  hypothetical protein CICLE_v10002897mg             101   1e-24   
gb|KHN03976.1|  hypothetical protein glysoja_022662                     100   1e-24   
ref|XP_009146075.1|  PREDICTED: rapid alkalinization factor 23-like     101   1e-24   
ref|XP_009385018.1|  PREDICTED: protein RALF-like 33                    101   1e-24   
ref|XP_010938417.1|  PREDICTED: protein RALF-like 33                    101   1e-24   
emb|CDY43109.1|  BnaC05g36680D                                          101   1e-24   
ref|XP_009135493.1|  PREDICTED: rapid alkalinization factor 23-like     101   2e-24   
emb|CBI39521.3|  unnamed protein product                                101   2e-24   
emb|CDX75886.1|  BnaC03g39690D                                          101   2e-24   
ref|XP_003625906.1|  RALF                                               100   2e-24   
ref|XP_002442268.1|  hypothetical protein SORBIDRAFT_08g017280          100   4e-24   Sorghum bicolor [broomcorn]
ref|XP_004494362.1|  PREDICTED: rapid alkalinization factor-like      99.8    5e-24   
gb|KFK44989.1|  hypothetical protein AALP_AA1G329500                  99.4    6e-24   
ref|XP_007227502.1|  hypothetical protein PRUPE_ppa013419mg           99.0    1e-23   
ref|XP_010037445.1|  PREDICTED: rapid alkalinization factor           99.4    1e-23   
ref|XP_009781864.1|  PREDICTED: rapid alkalinization factor-like      98.2    2e-23   
ref|XP_009615222.1|  PREDICTED: rapid alkalinization factor-like      97.8    4e-23   
ref|XP_008246129.1|  PREDICTED: rapid alkalinization factor-like      97.8    4e-23   
ref|XP_006394946.1|  hypothetical protein EUTSA_v10005147mg           97.4    5e-23   
ref|XP_007140560.1|  hypothetical protein PHAVU_008G122900g           96.7    6e-23   
ref|XP_010524867.1|  PREDICTED: protein RALF-like 22                  97.1    7e-23   
ref|XP_009402519.1|  PREDICTED: rapid alkalinization factor-like      96.7    8e-23   
ref|XP_010504445.1|  PREDICTED: rapid alkalinization factor 23-like   96.7    1e-22   
ref|XP_008360280.1|  PREDICTED: protein RALF-like 33                  96.3    2e-22   
gb|KHN20413.1|  hypothetical protein glysoja_039711                   94.7    2e-22   
gb|ABK22709.1|  unknown                                               95.5    2e-22   Picea sitchensis
ref|XP_006356972.1|  PREDICTED: rapid alkalinization factor-like      95.9    2e-22   
ref|NP_566555.1|  rapid alkalinization factor 23                      94.7    7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008390661.1|  PREDICTED: rapid alkalinization factor-like      94.4    9e-22   
ref|XP_009352252.1|  PREDICTED: protein RALF-like 33                  94.0    1e-21   
ref|XP_004229189.1|  PREDICTED: rapid alkalinization factor-like      94.0    1e-21   
ref|XP_004962821.1|  PREDICTED: rapid alkalinization factor-like      93.2    2e-21   
ref|XP_010038087.1|  PREDICTED: rapid alkalinization factor-like      92.8    3e-21   
ref|XP_006418288.1|  hypothetical protein EUTSA_v10009124mg           92.4    4e-21   
dbj|BAK00812.1|  predicted protein                                    92.4    5e-21   
ref|XP_008340810.1|  PREDICTED: protein RALF-like 33                  89.7    1e-20   
ref|XP_002874355.1|  hypothetical protein ARALYDRAFT_910810           90.5    2e-20   
gb|ACN40381.1|  unknown                                               90.9    2e-20   Picea sitchensis
ref|XP_010548947.1|  PREDICTED: rapid alkalinization factor 23-like   90.9    2e-20   
ref|NP_001150599.1|  LOC100284232 precursor                           90.1    2e-20   Zea mays [maize]
gb|KHN02967.1|  hypothetical protein glysoja_009833                   88.6    3e-20   
ref|XP_009383793.1|  PREDICTED: rapid alkalinization factor-like      89.7    4e-20   
gb|ABK25798.1|  unknown                                               89.7    5e-20   Picea sitchensis
gb|KDO71638.1|  hypothetical protein CISIN_1g032876mg                 89.0    1e-19   
ref|XP_010449887.1|  PREDICTED: protein RALF-like 33                  88.6    1e-19   
gb|EAY83408.1|  hypothetical protein OsI_38624                        88.6    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001066957.1|  Os12g0541700                                     88.2    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459740.1|  hypothetical protein SORBIDRAFT_02g009700        88.2    2e-19   Sorghum bicolor [broomcorn]
gb|AGT16384.1|  hypothetical protein SHCRBa_052_I12_R_250             88.2    6e-19   
gb|AGT16335.1|  hypothetical protein SHCRBa_256_D11_F_160             89.4    7e-19   
gb|EPS62616.1|  hypothetical protein M569_12176                       86.3    8e-19   
ref|XP_003575694.1|  PREDICTED: rapid alkalinization factor-like      86.3    1e-18   
ref|XP_010524533.1|  PREDICTED: rapid alkalinization factor 23-like   86.3    1e-18   
ref|XP_010546717.1|  PREDICTED: protein RALF-like 22                  85.9    1e-18   
ref|XP_002280202.1|  PREDICTED: protein RALF-like 19                  85.9    2e-18   Vitis vinifera
gb|AGT16104.1|  hypothetical protein SHCRBa_134_J05_F_340             85.9    2e-18   
ref|XP_002882418.1|  hypothetical protein ARALYDRAFT_477838           85.5    2e-18   
ref|XP_010440247.1|  PREDICTED: protein RALF-like 33                  84.7    4e-18   
ref|NP_566253.1|  protein RALF-like 22                                84.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002457590.1|  hypothetical protein SORBIDRAFT_03g009900        84.3    7e-18   Sorghum bicolor [broomcorn]
ref|XP_006408069.1|  hypothetical protein EUTSA_v10021783mg           84.0    7e-18   
ref|XP_010272745.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  82.0    1e-17   
ref|XP_010550987.1|  PREDICTED: protein RALF-like 22                  83.2    1e-17   
ref|XP_010247579.1|  PREDICTED: protein RALF-like 24                  83.6    1e-17   
emb|CDY40711.1|  BnaC03g34270D                                        82.8    1e-17   
ref|NP_001150875.1|  RALF precursor                                   83.2    2e-17   Zea mays [maize]
ref|XP_009124021.1|  PREDICTED: protein RALF-like 22                  82.8    2e-17   
gb|EPS72954.1|  rapid alkalinization factor                           82.4    2e-17   
gb|EPS64652.1|  rapid alkalinization factor                           81.3    2e-17   
gb|KFK31007.1|  hypothetical protein AALP_AA6G056400                  82.0    3e-17   
emb|CDO99525.1|  unnamed protein product                              82.4    3e-17   
gb|KFK37938.1|  hypothetical protein AALP_AA3G049600                  82.0    3e-17   
ref|XP_010485998.1|  PREDICTED: protein RALF-like 22                  82.4    3e-17   
ref|XP_010428004.1|  PREDICTED: protein RALF-like 22                  82.4    3e-17   
ref|XP_010464074.1|  PREDICTED: protein RALF-like 22                  82.0    4e-17   
emb|CDY18799.1|  BnaAnng02640D                                        81.6    4e-17   
ref|NP_001042630.1|  Os01g0257100                                     82.0    4e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73360.1|  hypothetical protein OsI_01239                        81.6    5e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_003566535.1|  PREDICTED: rapid alkalinization factor-like      81.6    6e-17   
emb|CDY18779.1|  BnaAnng02440D                                        81.3    6e-17   
ref|XP_006298819.1|  hypothetical protein CARUB_v10014925mg           81.3    7e-17   
ref|XP_009134826.1|  PREDICTED: protein RALF-like 22                  81.3    7e-17   
ref|XP_004967815.1|  PREDICTED: protein RALF-like 22-like             81.6    8e-17   
emb|CDJ26443.1|  unnamed protein product                              80.9    1e-16   
ref|XP_009147231.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  80.5    1e-16   
ref|XP_009373554.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  81.3    2e-16   
dbj|BAK04479.1|  predicted protein                                    80.5    2e-16   
ref|NP_001043013.1|  Os01g0358100                                     79.3    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_850219.1|  protein RALF-like 19                                79.0    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549330.1|  PREDICTED: protein RALF-like 19                  79.0    5e-16   
ref|XP_002879470.1|  hypothetical protein ARALYDRAFT_902453           79.0    5e-16   
ref|XP_004502245.1|  PREDICTED: protein RALF-like 24-like             79.3    5e-16   
ref|XP_006410523.1|  hypothetical protein EUTSA_v10017458mg           78.6    7e-16   
ref|XP_010526512.1|  PREDICTED: protein RALF-like 4                   78.2    8e-16   
ref|XP_010675511.1|  PREDICTED: protein RALF-like 19                  78.2    1e-15   
ref|NP_001150840.1|  rapid alkalinization factor 1 precursor          78.2    1e-15   Zea mays [maize]
ref|XP_010644182.1|  PREDICTED: protein RALF-like 19                  77.8    2e-15   
ref|XP_003538529.1|  PREDICTED: protein RALF-like 24-like             77.4    2e-15   
dbj|BAD94374.1|  hypothetical protein                                 76.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143830.1|  PREDICTED: protein RALF-like 19                  76.6    4e-15   
emb|CDY27943.1|  BnaCnng05280D                                        76.6    4e-15   
ref|NP_001151898.1|  LOC100285535 precursor                           77.0    4e-15   Zea mays [maize]
ref|XP_003601688.1|  Rapid alkalinization factor preproprotein        77.0    4e-15   
ref|XP_007025592.1|  Ralf-like 4, putative                            76.3    5e-15   
ref|NP_001241215.1|  uncharacterized protein LOC100793523 precursor   76.3    5e-15   
ref|XP_010469431.1|  PREDICTED: protein RALF-like 19                  76.3    5e-15   
ref|XP_002457819.1|  hypothetical protein SORBIDRAFT_03g014360        76.3    6e-15   Sorghum bicolor [broomcorn]
ref|XP_003567676.1|  PREDICTED: rapid alkalinization factor 23-like   75.9    7e-15   
ref|XP_009387647.1|  PREDICTED: protein RALF-like 19                  75.9    7e-15   
ref|XP_010509833.1|  PREDICTED: protein RALF-like 19                  75.5    8e-15   
gb|AFW84036.1|  hypothetical protein ZEAMMB73_711036                  75.5    1e-14   
ref|XP_008657869.1|  PREDICTED: rapid alkalinization factor-like      75.5    1e-14   
emb|CAN78122.1|  hypothetical protein VITISV_041547                   73.9    1e-14   Vitis vinifera
ref|XP_002867453.1|  hypothetical protein ARALYDRAFT_913686           75.1    1e-14   
gb|AGT16955.1|  hypothetical protein SHCRBa_149_L20_R_90              75.1    1e-14   
emb|CDO98876.1|  unnamed protein product                              75.5    2e-14   
ref|XP_004968724.1|  PREDICTED: rapid alkalinization factor-like      74.7    2e-14   
ref|NP_001043012.1|  Os01g0357900                                     74.7    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645884.1|  PREDICTED: rapid alkalinization factor-like      74.3    3e-14   
ref|XP_010413812.1|  PREDICTED: protein RALF-like 19                  73.6    4e-14   
ref|XP_004984414.1|  PREDICTED: rapid alkalinization factor-like      74.7    4e-14   
ref|XP_009381195.1|  PREDICTED: protein RALF-like 22                  74.3    4e-14   
ref|XP_006295275.1|  hypothetical protein CARUB_v10024364mg           73.6    4e-14   
ref|NP_001278545.1|  Rapid alkalinization factor 1 precursor          73.6    4e-14   
ref|XP_010052296.1|  PREDICTED: protein RALF-like 19                  73.6    5e-14   
ref|XP_010059255.1|  PREDICTED: protein RALF-like 19                  73.6    5e-14   
gb|ACG39263.1|  hypothetical protein                                  75.1    6e-14   
gb|EAY87021.1|  hypothetical protein OsI_08418                        73.6    6e-14   
ref|XP_006849879.1|  hypothetical protein AMTR_s00022p00078480        73.6    6e-14   
ref|XP_004505070.1|  PREDICTED: protein RALF-like 19-like             73.2    7e-14   
ref|NP_001047696.2|  Os02g0670500                                     73.2    7e-14   
gb|AFW79661.1|  rapid alkalinization factor 1                         73.2    8e-14   
ref|XP_007159334.1|  hypothetical protein PHAVU_002G229400g           72.8    9e-14   
ref|NP_001147163.1|  RALF precursor                                   72.8    1e-13   
ref|NP_001149446.1|  rapid alkalinization factor 1 precursor          72.8    1e-13   
tpg|DAA55320.1|  TPA: RALF                                            72.8    1e-13   
ref|XP_007212761.1|  hypothetical protein PRUPE_ppa026481mg           72.8    1e-13   
ref|XP_002305130.2|  hypothetical protein POPTR_0004s04470g           72.4    1e-13   
ref|XP_008338587.1|  PREDICTED: protein RALF-like 24                  73.6    1e-13   
ref|XP_008813275.1|  PREDICTED: protein RALF-like 33                  72.4    1e-13   
ref|XP_008791840.1|  PREDICTED: rapid alkalinization factor-like      72.8    1e-13   
ref|XP_006412966.1|  hypothetical protein EUTSA_v10026612mg           72.0    2e-13   
ref|XP_007034215.1|  RALFL33, putative                                72.4    2e-13   
ref|XP_009409606.1|  PREDICTED: protein RALF-like 22                  72.4    2e-13   
ref|XP_004298210.1|  PREDICTED: protein RALF-like 24-like             72.0    2e-13   
ref|XP_008225111.1|  PREDICTED: protein RALF-like 22                  72.0    2e-13   
ref|XP_010538170.1|  PREDICTED: protein RALF-like 19                  71.6    3e-13   
ref|XP_007043620.1|  Uncharacterized protein TCM_008135               71.6    4e-13   
gb|EKG20916.1|  Rapid ALkalinization Factor                           72.4    4e-13   
gb|EAZ11859.1|  hypothetical protein OsJ_01733                        71.2    4e-13   
ref|XP_004295624.1|  PREDICTED: rapid alkalinization factor-like      71.2    4e-13   
ref|XP_003637105.1|  RALF                                             70.9    5e-13   
gb|AFB73770.1|  rapid alkalinization factor                           70.9    6e-13   
ref|NP_001149642.1|  rapid ALkalinization Factor family protein p...  71.2    7e-13   
ref|XP_003567435.1|  PREDICTED: protein RALF-like 33                  70.5    7e-13   
ref|XP_008655401.1|  PREDICTED: RALFL33 isoform X1                    70.5    8e-13   
ref|XP_010656981.1|  PREDICTED: protein RALF-like 19                  70.5    1e-12   
ref|XP_011027816.1|  PREDICTED: protein RALF-like 19                  70.1    1e-12   
ref|XP_010925571.1|  PREDICTED: protein RALF-like 22                  70.1    1e-12   
ref|XP_009352900.1|  PREDICTED: protein RALF-like 19                  69.7    1e-12   
ref|NP_001152007.1|  RALFL33 precursor                                70.1    1e-12   
ref|XP_008655554.1|  PREDICTED: LOW QUALITY PROTEIN: rapid alkali...  70.1    2e-12   
gb|KHN16254.1|  hypothetical protein glysoja_046571                   69.3    2e-12   
gb|ACU19560.1|  unknown                                               69.7    2e-12   
ref|XP_006306243.1|  hypothetical protein CARUB_v10012072mg           69.3    2e-12   
ref|NP_001266447.1|  RALFL33                                          69.7    2e-12   
ref|XP_010915431.1|  PREDICTED: protein RALF-like 22                  69.7    2e-12   
ref|XP_003524928.1|  PREDICTED: protein RALF-like 24-like             69.7    2e-12   
ref|XP_002459039.1|  hypothetical protein SORBIDRAFT_03g044920        69.3    2e-12   
ref|XP_004485791.1|  PREDICTED: protein RALF-like 19-like             69.3    2e-12   
gb|AFK46281.1|  unknown                                               68.9    2e-12   
ref|XP_006468214.1|  PREDICTED: rapid alkalinization factor-like      68.9    3e-12   
ref|XP_003542740.1|  PREDICTED: protein RALF-like 19-like             68.9    3e-12   
ref|XP_010499341.1|  PREDICTED: protein RALF-like 4                   68.6    3e-12   
ref|NP_174148.1|  protein ralf-like 4                                 68.6    3e-12   
ref|NP_001237097.1|  uncharacterized protein LOC100306584 precursor   67.8    6e-12   
ref|XP_002459040.1|  hypothetical protein SORBIDRAFT_03g044930        67.8    7e-12   
ref|XP_011069491.1|  PREDICTED: protein RALF-like 24                  67.8    1e-11   
emb|CDY35727.1|  BnaC03g58480D                                        67.4    1e-11   
gb|KFK44698.1|  hypothetical protein AALP_AA1G291600                  67.4    1e-11   
ref|XP_004972328.1|  PREDICTED: rapid alkalinization factor-like      67.4    1e-11   
emb|CDM86027.1|  unnamed protein product                              67.4    1e-11   
ref|XP_008653461.1|  PREDICTED: protein RALF-like 1                   67.4    1e-11   
emb|CDX94598.1|  BnaC07g10600D                                        67.0    1e-11   
gb|KDP39325.1|  hypothetical protein JCGZ_01082                       67.0    1e-11   
ref|XP_004504245.1|  PREDICTED: protein RALF-like 19-like             67.0    1e-11   
ref|XP_004971175.1|  PREDICTED: rapid alkalinization factor-like      67.0    1e-11   
gb|EYU32711.1|  hypothetical protein MIMGU_mgv1a016289mg              67.4    1e-11   
ref|XP_009109739.1|  PREDICTED: protein RALF-like 4                   67.0    1e-11   
ref|XP_008349218.1|  PREDICTED: protein RALF-like 19                  67.0    1e-11   
emb|CDY15684.1|  BnaA07g08550D                                        67.8    2e-11   
ref|XP_006349913.1|  PREDICTED: protein RALF-like 33-like             67.4    2e-11   
gb|AAR00325.2|  rapid alkalinization factor 1                         67.4    2e-11   
emb|CDP05933.1|  unnamed protein product                              66.6    2e-11   
ref|XP_009113682.1|  PREDICTED: protein RALF-like 4                   66.6    2e-11   
ref|XP_006415678.1|  hypothetical protein EUTSA_v10009158mg           66.6    2e-11   
ref|XP_006285333.1|  hypothetical protein CARUB_v10006723mg           66.6    2e-11   
gb|EMT10153.1|  hypothetical protein F775_10210                       66.2    2e-11   
ref|XP_009102923.1|  PREDICTED: protein RALF-like 4                   66.2    3e-11   
ref|XP_008342967.1|  PREDICTED: rapid alkalinization factor-like      65.9    4e-11   
gb|AAL31098.1|AC091749_27  hypothetical protein                       65.9    4e-11   
gb|KDO77604.1|  hypothetical protein CISIN_1g044503mg                 65.9    4e-11   
ref|XP_007163812.1|  hypothetical protein PHAVU_001G266400g           65.9    4e-11   
gb|EAY78048.1|  hypothetical protein OsI_33090                        65.5    5e-11   
gb|AGT16909.1|  ralf-like protein                                     65.5    5e-11   
gb|AGT15906.1|  RALFL33 precursor                                     65.1    6e-11   
ref|XP_009392644.1|  PREDICTED: rapid alkalinization factor-like      65.5    6e-11   
gb|AGT16640.1|  rapid alkalinization factor 1                         65.1    6e-11   
gb|EYU28258.1|  hypothetical protein MIMGU_mgv1a016453mg              65.1    7e-11   
ref|XP_004958630.1|  PREDICTED: protein RALF-like 33-like             65.1    8e-11   
ref|XP_010108173.1|  hypothetical protein L484_014498                 65.1    8e-11   
ref|XP_002465288.1|  hypothetical protein SORBIDRAFT_01g035600        65.5    8e-11   
ref|XP_010908035.1|  PREDICTED: protein RALF-like 33                  64.7    9e-11   
ref|XP_006421017.1|  hypothetical protein CICLE_v10006214mg           64.7    1e-10   
ref|NP_001067847.1|  Os11g0456000                                     64.3    1e-10   
ref|XP_006373091.1|  hypothetical protein POPTR_0017s08620g           64.7    1e-10   
ref|XP_003632038.1|  PREDICTED: protein RALF-like 24                  64.7    1e-10   
ref|NP_001150677.1|  RALFL33 precursor                                63.9    1e-10   
ref|XP_009766091.1|  PREDICTED: protein RALF-like 24                  64.7    2e-10   
ref|XP_010314746.1|  PREDICTED: uncharacterized protein LOC101258931  65.1    2e-10   
gb|KDP39326.1|  hypothetical protein JCGZ_01083                       63.9    2e-10   
gb|KGN56707.1|  hypothetical protein Csa_3G129640                     63.9    2e-10   
ref|XP_009612980.1|  PREDICTED: protein RALF-like 24                  64.3    2e-10   
gb|EAZ26888.1|  hypothetical protein OsJ_10813                        63.9    2e-10   
gb|ABF95894.1|  Rapid ALkalinization Factor family protein            63.9    2e-10   
ref|XP_004979239.1|  PREDICTED: rapid alkalinization factor 23-like   63.5    2e-10   
ref|XP_003559814.1|  PREDICTED: rapid alkalinization factor 23-like   63.2    3e-10   
ref|XP_008438316.1|  PREDICTED: protein RALF-like 24                  63.5    3e-10   
ref|XP_008222806.1|  PREDICTED: protein RALF-like 24                  63.9    3e-10   
ref|XP_009349368.1|  PREDICTED: protein RALF-like 33                  62.8    4e-10   
ref|XP_006855698.1|  hypothetical protein AMTR_s00044p00139580        63.2    5e-10   
dbj|BAB67949.1|  hypothetical protein                                 62.8    5e-10   
ref|XP_002522804.1|  RALFL33, putative                                62.8    5e-10   
gb|EYU44954.1|  hypothetical protein MIMGU_mgv1a023845mg              62.4    7e-10   
ref|XP_002528254.1|  RALFL33, putative                                62.4    7e-10   
ref|XP_009400663.1|  PREDICTED: rapid alkalinization factor-like      62.4    7e-10   
ref|XP_003561647.1|  PREDICTED: protein RALF-like 22                  62.4    7e-10   
ref|XP_006663427.1|  PREDICTED: rapid alkalinization factor 23-like   62.4    7e-10   
ref|XP_010023633.1|  PREDICTED: protein RALF-like 32                  62.4    7e-10   
ref|XP_010241287.1|  PREDICTED: protein RALF-like 19                  62.4    8e-10   
ref|XP_003566439.1|  PREDICTED: rapid alkalinization factor-like      62.4    9e-10   
ref|XP_007223934.1|  hypothetical protein PRUPE_ppa013295mg           62.4    9e-10   
gb|EYU25270.1|  hypothetical protein MIMGU_mgv1a017076mg              61.6    9e-10   
gb|KDO50663.1|  hypothetical protein CISIN_1g033245mg                 62.0    1e-09   
ref|XP_006424193.1|  hypothetical protein CICLE_v10030160mg           62.0    1e-09   
ref|XP_009784377.1|  PREDICTED: protein RALF-like 19                  62.0    1e-09   
emb|CAN79219.1|  hypothetical protein VITISV_012796                   63.5    1e-09   
ref|XP_009623267.1|  PREDICTED: protein RALF-like 22                  62.0    1e-09   
ref|XP_006489845.1|  PREDICTED: protein RALF-like 31-like             61.6    1e-09   
ref|XP_010241351.1|  PREDICTED: rapid alkalinization factor-like      61.6    2e-09   
gb|KDP38641.1|  hypothetical protein JCGZ_03994                       61.2    2e-09   
ref|XP_011003629.1|  PREDICTED: protein RALF-like 24                  61.2    2e-09   
ref|XP_008794136.1|  PREDICTED: protein RALF-like 22                  61.2    2e-09   
ref|XP_011012491.1|  PREDICTED: protein RALF-like 31                  60.8    3e-09   
gb|EMS45535.1|  hypothetical protein TRIUR3_16964                     60.8    3e-09   
gb|KHN24772.1|  hypothetical protein glysoja_045891                   60.5    3e-09   
ref|XP_004244368.1|  PREDICTED: protein RALF-like 22                  60.5    3e-09   
gb|EWG53364.1|  hypothetical protein FVEG_11810                       59.7    4e-09   
ref|XP_010314082.1|  PREDICTED: protein RALF-like 22                  60.1    5e-09   
emb|CAN69272.1|  hypothetical protein VITISV_001680                   58.9    5e-09   
ref|XP_008229078.1|  PREDICTED: rapid alkalinization factor-like      60.1    6e-09   
gb|EMS58328.1|  hypothetical protein TRIUR3_13285                     59.7    6e-09   
ref|XP_002461186.1|  hypothetical protein SORBIDRAFT_02g042530        59.7    8e-09   
ref|NP_001241351.1|  uncharacterized protein LOC100801740 precursor   59.3    8e-09   
ref|XP_009340925.1|  PREDICTED: protein RALF-like 19                  58.9    1e-08   
ref|XP_003619621.1|  Rapid alkalinization factor                      58.5    1e-08   
ref|XP_010097951.1|  hypothetical protein L484_026842                 58.2    1e-08   
ref|XP_010435211.1|  PREDICTED: protein RALF-like 31                  58.5    2e-08   
ref|XP_004295623.1|  PREDICTED: protein RALF-like 19-like             58.5    2e-08   
ref|XP_010023649.1|  PREDICTED: protein RALF-like 24                  58.9    2e-08   
gb|EMS65783.1|  hypothetical protein TRIUR3_31877                     58.2    2e-08   
ref|XP_008345894.1|  PREDICTED: protein RALF-like 19                  58.5    2e-08   
emb|CDM82107.1|  unnamed protein product                              58.5    2e-08   
ref|XP_008338729.1|  PREDICTED: protein RALF-like 19                  58.2    2e-08   
ref|XP_003577585.1|  PREDICTED: rapid alkalinization factor 23-like   58.2    2e-08   
ref|NP_001152442.1|  RALF precursor                                   58.2    2e-08   
ref|XP_010230590.1|  PREDICTED: rapid alkalinization factor-like      58.2    2e-08   
ref|NP_001152377.1|  RALF precursor                                   58.2    3e-08   
ref|NP_001235167.1|  uncharacterized protein LOC100306190 precursor   58.2    3e-08   
ref|XP_009415108.1|  PREDICTED: protein RALF-like 19                  58.2    3e-08   
ref|XP_008349249.1|  PREDICTED: protein RALF-like 4                   57.8    3e-08   
gb|EXL95954.1|  hypothetical protein FOIG_11494                       57.0    3e-08   
emb|CDP03492.1|  unnamed protein product                              57.0    3e-08   
ref|XP_008441015.1|  PREDICTED: protein RALF-like 19                  57.8    3e-08   
emb|CDY53781.1|  BnaC04g44150D                                        57.4    4e-08   
emb|CCT67911.1|  uncharacterized protein FFUJ_14827                   57.0    4e-08   
gb|KFK39677.1|  protein ralf-like 24                                  57.0    5e-08   
gb|EMT67457.1|  hypothetical protein FOC4_g10005547                   57.0    5e-08   
gb|EXA36601.1|  hypothetical protein FOVG_12512                       56.6    5e-08   
gb|EGU80898.1|  hypothetical protein FOXB_08613                       56.2    5e-08   
gb|AFK34833.1|  unknown                                               57.4    5e-08   
gb|ENH64901.1|  hypothetical protein FOC1_g10005670                   57.0    6e-08   
ref|XP_010068992.1|  PREDICTED: protein RALF-like 24                  57.4    6e-08   
emb|CDY50107.1|  BnaC01g43550D                                        57.0    6e-08   
gb|KCW57211.1|  hypothetical protein EUGRSUZ_H00024                   56.6    6e-08   
dbj|BAK08263.1|  predicted protein                                    56.6    8e-08   
ref|XP_009102578.1|  PREDICTED: protein RALF-like 24                  56.6    8e-08   
gb|EXK36302.1|  hypothetical protein FOMG_09497                       56.2    9e-08   
ref|XP_009106333.1|  PREDICTED: protein RALF-like 24                  56.6    9e-08   
emb|CDX77484.1|  BnaA07g06220D                                        56.2    1e-07   
ref|XP_006284794.1|  hypothetical protein CARUB_v10006063mg           56.2    1e-07   
ref|NP_567413.1|  protein ralf-like 31                                56.2    1e-07   
gb|AAM62990.1|  unknown                                               56.2    1e-07   
ref|XP_010532737.1|  PREDICTED: protein RALF-like 24                  56.2    1e-07   
ref|XP_008381617.1|  PREDICTED: protein RALF-like 33                  55.8    1e-07   
ref|XP_001937123.1|  hypothetical protein PTRG_06790                  56.2    1e-07   
ref|XP_002868326.1|  hypothetical protein ARALYDRAFT_493518           55.8    2e-07   
gb|KFK36285.1|  hypothetical protein AALP_AA4G102800                  55.8    2e-07   
ref|XP_007198968.1|  hypothetical protein PRUPE_ppa015429mg           55.5    2e-07   
gb|EWY82434.1|  hypothetical protein FOYG_14526                       54.7    2e-07   
ref|XP_010450123.1|  PREDICTED: protein RALF-like 31                  55.5    2e-07   
ref|XP_002449934.1|  hypothetical protein SORBIDRAFT_05g025930        55.8    2e-07   
ref|XP_004148669.1|  PREDICTED: protein RALF-like 4-like              55.5    2e-07   
ref|XP_004971750.1|  PREDICTED: protein RALF-like 33-like             55.8    2e-07   
ref|XP_009406337.1|  PREDICTED: protein RALF-like 33                  55.5    2e-07   
ref|XP_009599090.1|  PREDICTED: rapid alkalinization factor-like      55.1    2e-07   
ref|XP_006414843.1|  hypothetical protein EUTSA_v10026600mg           55.5    2e-07   
gb|EMT00251.1|  hypothetical protein F775_01891                       54.3    2e-07   
ref|NP_001149391.1|  LOC100283017 precursor                           55.5    2e-07   
emb|CDY58804.1|  BnaC08g46770D                                        55.1    2e-07   
ref|XP_006848521.1|  hypothetical protein AMTR_s00013p00262240        55.1    2e-07   
ref|XP_009107494.1|  PREDICTED: protein RALF-like 31                  55.1    3e-07   
ref|XP_004150814.1|  PREDICTED: protein RALF-like 4-like              55.1    3e-07   
ref|XP_006421032.1|  hypothetical protein CICLE_v10006262mg           55.1    3e-07   
ref|XP_011083276.1|  PREDICTED: protein RALF-like 19                  54.7    3e-07   
emb|CDX85126.1|  BnaC07g07800D                                        54.7    4e-07   
ref|XP_009385221.1|  PREDICTED: uncharacterized protein LOC103972593  53.9    4e-07   
ref|XP_006492531.1|  PREDICTED: protein RALF-like 32-like             54.3    4e-07   
ref|XP_004308256.1|  PREDICTED: protein RALF-like 19-like             54.3    5e-07   
ref|XP_010450145.1|  PREDICTED: protein RALF-like 31                  53.9    7e-07   
ref|XP_007034206.1|  Ralf-like 32, putative                           53.9    7e-07   
ref|XP_006655080.1|  PREDICTED: rapid alkalinization factor-like      53.9    8e-07   
ref|XP_008813277.1|  PREDICTED: rapid alkalinization factor-like      53.5    9e-07   
ref|XP_002454987.1|  hypothetical protein SORBIDRAFT_03g002560        53.5    9e-07   
gb|EWZ30940.1|  hypothetical protein FOZG_15376                       52.8    1e-06   
ref|XP_009403123.1|  PREDICTED: protein RALF-like 33                  53.1    1e-06   
gb|EMT28519.1|  hypothetical protein F775_11053                       52.0    2e-06   
gb|AFW60220.1|  hypothetical protein ZEAMMB73_658976                  52.8    2e-06   
ref|XP_008392941.1|  PREDICTED: protein RALF-like 33                  52.4    3e-06   
ref|NP_001150887.1|  LOC100284520 precursor                           52.4    3e-06   
ref|XP_007408986.1|  hypothetical protein MELLADRAFT_31548            51.2    3e-06   
ref|XP_002319895.1|  hypothetical protein POPTR_0013s10870g           51.2    3e-06   
ref|XP_006418836.1|  hypothetical protein EUTSA_v10002729mg           52.0    4e-06   
gb|AAM66043.1|  unknown                                               51.6    5e-06   



>ref|XP_010326583.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=118

 Score =   145 bits (365),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 7/116 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTV-DA-GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MA  S C    IS LLIA+L    DA GGD D++GW+P+K+A+   C+GSIAECMAA   
Sbjct  1    MAANSFCSIFIISSLLIAALIISGDATGGDFDVSGWIPMKSADS--CEGSIAECMAAG--  56

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EFEMD+ESNRRILAT++YISYGALQ  + PCSRRG+SYYNC+ GA+ANPYTRGCS
Sbjct  57   -EFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPYTRGCS  111



>ref|XP_009775621.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=116

 Score =   143 bits (360),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 5/114 (4%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MA   +  F+  S L+   + + +A GD DM+GW+P+KA +   C G+IAECMAA    E
Sbjct  1    MAKPFSSTFIISSLLIALLIISGEASGDFDMSGWIPMKATDS--CDGTIAECMAAG---E  55

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            FEMD+ESNRRILAT +YISYGALQR   PCSRRG+SYYNCQ GA+ANPYTRGCS
Sbjct  56   FEMDSESNRRILATDDYISYGALQRNTVPCSRRGASYYNCQTGAEANPYTRGCS  109



>ref|XP_009604381.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=117

 Score =   139 bits (351),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 5/89 (6%)
 Frame = -1

Query  267  GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQR  88
            GGD DM+GW+P+K+A+   CQGSIAECMAA    EFEMD+ESNRRILAT +YISYGALQR
Sbjct  27   GGDFDMSGWIPMKSADS--CQGSIAECMAAG---EFEMDSESNRRILATDDYISYGALQR  81

Query  87   GNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
               PCSRRG+SYYNCQ GA+ANPYTRGCS
Sbjct  82   NTVPCSRRGASYYNCQTGAEANPYTRGCS  110



>ref|XP_002263387.1| PREDICTED: rapid alkalinization factor [Vitis vinifera]
 emb|CAN77387.1| hypothetical protein VITISV_033365 [Vitis vinifera]
 emb|CBI36827.3| unnamed protein product [Vitis vinifera]
Length=118

 Score =   137 bits (346),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 85/116 (73%), Gaps = 7/116 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFT--VDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN S  +FL IS + +A+LFT  V AGGD     W P   A    CQGSIAEC+A  G 
Sbjct  1    MAN-SNGLFL-ISSIFVAALFTASVSAGGDFSQLNWEPAAKA-AATCQGSIAECLA--GR  55

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +EFEMDTE NRRILAT+ YISYGALQR   PCS+RG+SYYNC+PGA+ANPY RGCS
Sbjct  56   DEFEMDTEINRRILATTQYISYGALQRNTVPCSQRGASYYNCKPGAEANPYNRGCS  111



>ref|XP_006444286.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 ref|XP_006479916.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR57526.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 gb|KDO87300.1| hypothetical protein CISIN_1g033577mg [Citrus sinensis]
Length=116

 Score =   135 bits (341),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 8/108 (7%)
 Frame = -1

Query  324  CVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTE  145
            CV+LF++ L++ S   VDAG D  ++ W+P KA    RCQGS+AECMA    EEF MD+E
Sbjct  10   CVYLFLAALMMDSSTVVDAGVDQRLS-WVPAKA----RCQGSMAECMA---DEEFGMDSE  61

Query  144  SNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             NRRILAT+ YISYGALQR + PCS+RG+SYYNC  GAQANPY+RGCS
Sbjct  62   INRRILATTKYISYGALQRDSVPCSQRGASYYNCHAGAQANPYSRGCS  109



>ref|XP_010269500.1| PREDICTED: rapid alkalinization factor-like [Nelumbo nucifera]
Length=139

 Score =   136 bits (342),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 78/100 (78%), Gaps = 7/100 (7%)
 Frame = -1

Query  300  LLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILAT  121
            LLI+S  T+DA G+  + GW+P ++     CQGS+ ECMA  GG EFEMD+E NRRILAT
Sbjct  40   LLISSSTTIDASGEYQL-GWLPTRST----CQGSMEECMA--GGNEFEMDSEINRRILAT  92

Query  120  SNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            S YISYGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  93   SQYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  132



>gb|KDP23480.1| hypothetical protein JCGZ_23313 [Jatropha curcas]
Length=125

 Score =   135 bits (341),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 12/122 (10%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLF-----TVDAGGDLDMA--GWMPVKAAEGGRCQGSIAECM  184
            MA + T  FL    +L+  +      TV+A GD      GW+P++++    C+GSIAEC+
Sbjct  1    MAKSITSCFLMCGAMLMILILMSGTSTVEASGDHHQQSLGWIPIRSS----CKGSIAECL  56

Query  183  AAS-GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRG  7
            A+  GGEEFE+D+E +RRILATSNYISYGALQR   PCSRRG+SYYNCQ GAQANPYTRG
Sbjct  57   ASDDGGEEFELDSEISRRILATSNYISYGALQRNTVPCSRRGASYYNCQNGAQANPYTRG  116

Query  6    CS  1
            CS
Sbjct  117  CS  118



>ref|XP_007050868.1| Ralf-like 33, putative [Theobroma cacao]
 gb|EOX95025.1| Ralf-like 33, putative [Theobroma cacao]
Length=116

 Score =   134 bits (338),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 7/99 (7%)
 Frame = -1

Query  297  LIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS  118
            LI SL TV+AGGD  +  W+P KA     CQGS+AEC+     +EF+MD+E NRRILAT+
Sbjct  18   LIISLSTVEAGGDHHLINWVPTKAG----CQGSMAECIT---NDEFDMDSEINRRILATT  70

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             YISYGALQR   PCS RG+SYYNCQPGAQANPY+RGCS
Sbjct  71   QYISYGALQRNTVPCSLRGASYYNCQPGAQANPYSRGCS  109



>ref|XP_002512426.1| RALFL33, putative [Ricinus communis]
 gb|EEF49878.1| RALFL33, putative [Ricinus communis]
Length=121

 Score =   134 bits (336),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 8/118 (7%)
 Frame = -1

Query  342  MANASTCVFLFISC----LLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS  175
            MAN  T  FL  +     +LIA+   V A GD    GW+P   +    C+GSIAEC+A S
Sbjct  1    MANLLTSCFLMCATTFILILIAASPAVQASGD--HLGWIPTIRSSST-CKGSIAECLA-S  56

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             GEEFEMD+E++RRILAT+ YISYGALQR + PCSRRG+SYYNCQPGAQANPY+RGCS
Sbjct  57   NGEEFEMDSETSRRILATTKYISYGALQRNSVPCSRRGASYYNCQPGAQANPYSRGCS  114



>ref|XP_008235043.1| PREDICTED: protein RALF-like 33 [Prunus mume]
Length=116

 Score =   133 bits (334),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 13/118 (11%)
 Frame = -1

Query  342  MANASTCVFLF----ISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS  175
            MAN+S+ +FLF     +  LI S +TV AGGD  ++ W+P + +    CQGSIAECMA  
Sbjct  1    MANSSS-IFLFAFYMFTATLIISTWTVHAGGDHGLS-WVPGRTS----CQGSIAECMA--  52

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              +EF+MD+E NRRILATS YISYGALQR   PCSRRG+SYYNC+PGA++NPY RGCS
Sbjct  53   -DDEFDMDSEINRRILATSQYISYGALQRNTVPCSRRGASYYNCKPGAESNPYNRGCS  109



>ref|XP_006382486.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK94089.1| unknown [Populus trichocarpa]
 gb|ERP60283.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=120

 Score =   132 bits (332),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 7/117 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASL---FTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG  172
            MA  S+   +  + L++ ++    TV   GD  + GW+P  A     C+GSIAECMA  G
Sbjct  1    MAKRSSWFLISATILILMAMGLSSTVQGSGDHHL-GWIP--ATRSSVCKGSIAECMAEDG  57

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EEFEMDTE NRRILAT+ Y+SYGALQR N PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  58   -EEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASYYNCQRGAQANPYSRGCS  113



>gb|AAO27366.1| rapid alkalinization factor 1 precursor [Populus trichocarpa 
x Populus deltoides]
Length=120

 Score =   132 bits (331),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 7/117 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASL---FTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG  172
            MA  S+   +  + L++ ++    TV   GD  + GW+P  A     C+GSIAECMA  G
Sbjct  1    MAKWSSWFLISATILILMAMGLSSTVQGSGDHHL-GWIP--ATRSSVCKGSIAECMAEDG  57

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EEFEMDTE NRRILAT+ Y+SYGALQR N PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  58   -EEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASYYNCQRGAQANPYSRGCS  113



>ref|XP_006359396.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=118

 Score =   131 bits (329),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 5/89 (6%)
 Frame = -1

Query  267  GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQR  88
            GGD D++GW+P+K+A+   C+GSIAECMAA    EFEMD+ESNRRILAT++YISYGALQ 
Sbjct  28   GGDFDVSGWVPMKSADS--CEGSIAECMAAG---EFEMDSESNRRILATTDYISYGALQS  82

Query  87   GNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             + PCSRRG+SYYNC+ GA+ANPYTR CS
Sbjct  83   NSVPCSRRGASYYNCKTGAEANPYTRDCS  111



>ref|XP_011023680.1| PREDICTED: rapid alkalinization factor-like [Populus euphratica]
Length=126

 Score =   131 bits (329),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = -1

Query  318  FLFISCLLIASLF----TVDAGGDLDMAGWMPVKAAEGGRC--QGSIAECMAASGGEEFE  157
            FL  + +LI  +     TV   GD    GW+P   A       +GS+AECMA   GEEFE
Sbjct  8    FLISATVLILMVMGLPSTVQGNGDHHHLGWIPTTTATRSSICDKGSLAECMAEEDGEEFE  67

Query  156  MDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            MDTE NRRILATS Y+SYGALQ+ N PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  68   MDTEINRRILATSKYVSYGALQKNNVPCSRRGASYYNCKNGAQANPYRRGCS  119



>ref|XP_007030995.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY11497.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=118

 Score =   130 bits (326),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 13/117 (11%)
 Frame = -1

Query  333  ASTCVFLFISCLLIASLF-----TVDAGGDLD-MAGWMPVKAAEGGRCQGSIAECMAASG  172
            A  C  L I  ++I ++      TVDA G+ + + GW+P     G  C+GSIAEC+A   
Sbjct  2    AVNCKLLVICAMIITAVVAATTRTVDASGEHERILGWIPT----GSPCKGSIAECLA---  54

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            GEEF++D+E +RRILAT+ YISYGALQR   PCSRRG+SYYNCQPGAQANPY+RGC+
Sbjct  55   GEEFQLDSEISRRILATAQYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCN  111



>ref|XP_006344656.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=114

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I C+L+ + F ++ A GD     WM    A  G C+GSIAECMA    +EF +D+ESNR
Sbjct  7    LIVCVLVGAFFISMAAAGDNGSYDWM--VPARSGECKGSIAECMAEE--DEFALDSESNR  62

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT NYISYGALQ+ + PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  63   RILATKNYISYGALQKNSVPCSRRGASYYNCKPGAQANPYTRGCS  107



>ref|XP_011036862.1| PREDICTED: protein RALF-like 33 [Populus euphratica]
Length=120

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASL---FTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG  172
            MA  S+   +  + L++ ++    TV   GD  + GW+P  A     C+GSIAECMA  G
Sbjct  1    MAKRSSWFLISATILILMAMGLSSTVQGSGDHHL-GWIP--ATRSSICKGSIAECMAEDG  57

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EEFEMDTE NRRILATS Y+SYGALQR N PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  58   -EEFEMDTEINRRILATSKYVSYGALQRNNVPCSRRGASYYNCRRGAQANPYGRGCS  113



>ref|XP_008246447.1| PREDICTED: rapid alkalinization factor [Prunus mume]
Length=121

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = -1

Query  342  MANASTCVFLFISC---LLIASLFTVDAGGDLDM-AGWMPVKAAEGGRCQGSIAECMAAS  175
            MA      FL + C   LL+ S  +V A GD      WMP   +    C+GSIAEC+AA 
Sbjct  1    MARLCCVSFLLLICASILLMGSSASVLASGDHPQNLSWMPTNKSS---CKGSIAECLAA-  56

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G EEF++D+E NRRILATS YISYGA+QR   PCSRRG+SYYNCQPGAQ+NPY+RGCS
Sbjct  57   GDEEFDLDSEINRRILATSKYISYGAMQRNTVPCSRRGASYYNCQPGAQSNPYSRGCS  114



>ref|XP_003626248.1| hypothetical protein MTR_7g113080 [Medicago truncatula]
 gb|ABN08027.1| Rapid ALkalinization Factor [Medicago truncatula]
 gb|AES82466.1| RALF [Medicago truncatula]
 gb|AFK41182.1| unknown [Medicago truncatula]
Length=127

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = -1

Query  339  ANASTCVFLFI-SCLLIASLF----TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS  175
            +N  + +FL I + LL+ ++     TVDA G  ++ G   +   +   C+GSIA+CM   
Sbjct  3    SNFYSQLFLVICATLLMTTMMSSSPTVDAAGGFELGGMEWIHQTKTATCEGSIADCMLQQ  62

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G EEF+ D E NRRILAT+ YISYGALQR   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  63   GEEEFQFDNEINRRILATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYSRGCS  120



>ref|XP_008370433.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score =   129 bits (324),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = -1

Query  297  LIASLFTV-DAGGDLDMAGWMPVKAAEGGRCQGSIAEC-MAASGGEEFEMDTESNRRILA  124
            + AS+  V  + GD     WMP   A+   C+GSIAEC +AA   EEF+MD+E +RRILA
Sbjct  13   ICASILVVGSSNGDQHHLSWMPTAXAKSASCKGSIAECALAAGDDEEFDMDSEISRRILA  72

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            T+ YISYGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  73   TTKYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  113



>gb|EYU46690.1| hypothetical protein MIMGU_mgv1a016538mg [Erythranthe guttata]
Length=117

 Score =   129 bits (323),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIAS--LFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MA     + L IS +++A+  L TVDAG +     WMP   A    C+GSIAECMA   G
Sbjct  1    MAKTHPLLRLLISAVVVAAVILATVDAGEEYS---WMPTNKA--ASCKGSIAECMAEGAG  55

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            E FE+D+ESNRRILATSNYISYGALQ  + PCSRRG+SYYNC+PGAQANPYTR CS
Sbjct  56   E-FELDSESNRRILATSNYISYGALQANSVPCSRRGASYYNCRPGAQANPYTRTCS  110



>ref|XP_002531878.1| RALFL33, putative [Ricinus communis]
 gb|EEF30515.1| RALFL33, putative [Ricinus communis]
Length=116

 Score =   128 bits (322),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 13/118 (11%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLF----TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS  175
            MA  S+ +FLF   LL++SL     TV+A  D  +  W+P    +  RCQG++A+CM   
Sbjct  1    MAKHSS-IFLFTFYLLLSSLIISTSTVEATIDHKL-NWVP----KTSRCQGTLADCMQE-  53

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              +EF+MD+E NRRILAT+NYISYGALQR   PCS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  54   --DEFDMDSEINRRILATTNYISYGALQRNTIPCSQRGASYYNCQPGAEANPYSRGCS  109



>ref|XP_007206150.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
 gb|EMJ07349.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
Length=121

 Score =   128 bits (322),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = -1

Query  342  MANASTCVFLFISC---LLIASLFTVDAGGDLDM-AGWMPVKAAEGGRCQGSIAECMAAS  175
            MA      FL + C   LL+ S  +V A GD      WMP   +    C+GSIAEC+AA 
Sbjct  1    MARLCCVSFLLLICASILLMGSSSSVIASGDHHPNLSWMPTNNSA---CKGSIAECLAA-  56

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G EEF++D+E NRRILATS YISYGA+QR   PCSRRG+SYYNCQPGAQ+NPY+RGCS
Sbjct  57   GDEEFDLDSEINRRILATSKYISYGAMQRNTVPCSRRGASYYNCQPGAQSNPYSRGCS  114



>emb|CBI26076.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   129 bits (324),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 11/123 (9%)
 Frame = -1

Query  357  RESTAMANASTCVFL--FISCLLIASLFTVDAGGDL--DMAGWMPVKAAEGGRCQGSIAE  190
            R    M N+S  V +   ++  ++ +   VD  GD      GW+P ++A    CQGSIAE
Sbjct  30   RREAKMGNSSAFVLICAIMAVHMVLTSSAVDFSGDHLQFQLGWIPARSA----CQGSIAE  85

Query  189  CMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTR  10
            C+A   GEEFEMD+E NRRILA+  YISYGAL R + PCSRRG+SYYNC+PGAQANPYTR
Sbjct  86   CLA---GEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQANPYTR  142

Query  9    GCS  1
            GCS
Sbjct  143  GCS  145



>ref|XP_010313004.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=114

 Score =   128 bits (321),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 5/105 (5%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I C+L+ + F ++ A GD     WM    A  G C+GSIAECMA    +EF +D+ESNR
Sbjct  7    LIVCVLVGAFFISMAAAGDSGSYDWM--VPARSGECKGSIAECMAEE--DEFALDSESNR  62

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT  YISYGALQ+ + PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  63   RILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYTRGCS  107



>gb|AAR00326.1| rapid alkalinization factor 2 [Solanum chacoense]
Length=114

 Score =   127 bits (319),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 5/105 (5%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I C+L+ + F ++ A GD     WM    A  G C+GSIAECMA    +EF +D+ESNR
Sbjct  7    LIVCVLVGAFFISMAAAGDNGSYDWM--VPARSGECKGSIAECMAEE--DEFALDSESNR  62

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT  YISYGALQ+ + PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  63   RILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYTRGCS  107



>emb|CAN83593.1| hypothetical protein VITISV_037723 [Vitis vinifera]
Length=118

 Score =   127 bits (319),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 11/118 (9%)
 Frame = -1

Query  342  MANASTCVFL--FISCLLIASLFTVDAGGDL--DMAGWMPVKAAEGGRCQGSIAECMAAS  175
            M N+S  V +   ++  ++ +   VD  GD      GW+P ++A    CQGSIAEC+A  
Sbjct  1    MXNSSAFVLICAIMAVHMVLTSSAVDFSGDHLQFQLGWIPARSA----CQGSIAECLA--  54

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             GEEFEMD+E NRRILA+  YISYGAL R + PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  55   -GEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQANPYTRGCS  111



>ref|XP_002273386.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
Length=118

 Score =   127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 83/118 (70%), Gaps = 11/118 (9%)
 Frame = -1

Query  342  MANASTCVFL--FISCLLIASLFTVDAGGDL--DMAGWMPVKAAEGGRCQGSIAECMAAS  175
            M N+S  V +   ++  ++ +   VD  GD      GW+P ++A    CQGSIAEC+A  
Sbjct  1    MGNSSAFVLICAIMAVHMVLTSSAVDFSGDHLQFQLGWIPARSA----CQGSIAECLA--  54

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             GEEFEMD+E NRRILA+  YISYGAL R + PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  55   -GEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQANPYTRGCS  111



>ref|XP_004290774.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004290775.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=114

 Score =   126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MA +S+ +     CL   ++    + G      ++P K+    RCQGSIAECMA    +E
Sbjct  1    MAKSSSIILFLAFCLFFTAVIIDASNGSDHGLSFVPAKS----RCQGSIAECMAE---DE  53

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F+MD+E NRRILAT+ YISYGALQR   PCS+RG+SYYNC+PGAQANPY RGCS
Sbjct  54   FDMDSEINRRILATTKYISYGALQRNTVPCSQRGASYYNCKPGAQANPYNRGCS  107



>ref|XP_010025230.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW61837.1| hypothetical protein EUGRSUZ_H04532 [Eucalyptus grandis]
Length=130

 Score =   127 bits (318),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 87/116 (75%), Gaps = 10/116 (9%)
 Frame = -1

Query  327  TCVFLFISCLLIASLFT--VDAGGDLDMA---GWMPVKAAEGGRCQGSIAECMAASG-GE  166
            +C+FL IS L++ASL    V  GG  +     GW     A G RC+GSIAEC+AA G GE
Sbjct  11   SCLFL-ISALVLASLLASAVHGGGVSEHGHRLGW--AGGAGGSRCEGSIAECLAAGGDGE  67

Query  165  -EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF++D+ESNRRILATS+YISYGAL+R   PCSRRG+SYYNC+PGA +NPY+RGCS
Sbjct  68   GEFDLDSESNRRILATSSYISYGALKRNTVPCSRRGASYYNCRPGASSNPYSRGCS  123



>ref|XP_004495709.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=120

 Score =   126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 85/119 (71%), Gaps = 11/119 (9%)
 Frame = -1

Query  342  MANASTCVFLFI--SCLLIASLF--TVDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMAA  178
            MAN+S+  F+ I  + +L+A  F  T  AGGD  +  GW+P+  A    C+GSIAEC+  
Sbjct  1    MANSSSLTFIMICAAAILLAMSFSRTAVAGGDHQLGMGWLPLTKAV---CEGSIAECLE-  56

Query  177  SGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
               +EFE+D+E NRRILA + YISYGALQR   PCSRRG+SYYNC+PGA+ANPY RGCS
Sbjct  57   --DDEFELDSEINRRILANTKYISYGALQRNTVPCSRRGASYYNCRPGAKANPYNRGCS  113



>ref|XP_007199089.1| hypothetical protein PRUPE_ppa020353mg [Prunus persica]
 gb|EMJ00288.1| hypothetical protein PRUPE_ppa020353mg [Prunus persica]
Length=103

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 76/99 (77%), Gaps = 8/99 (8%)
 Frame = -1

Query  297  LIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS  118
            LI S +TV AG D  ++ W+P +     RCQGSIAECMA    +EF+MD++ NRRILATS
Sbjct  6    LIISTWTVHAGSDHGLS-WVPGRT----RCQGSIAECMA---DDEFDMDSQINRRILATS  57

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             YISYGALQR   PCSRRG+SYYNC+PGA++NPY RGCS
Sbjct  58   QYISYGALQRNTVPCSRRGASYYNCKPGAESNPYNRGCS  96



>ref|XP_004172589.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN60955.1| hypothetical protein Csa_2G031140 [Cucumis sativus]
Length=121

 Score =   126 bits (316),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 77/108 (71%), Gaps = 12/108 (11%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAG-GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTE  145
            VFL  SC    S  TV AG G      W+P ++     C+GSIAEC    GGEEFE D+E
Sbjct  18   VFLIFSC----SSTTVHAGLGIQHSLAWIPNQST----CKGSIAECF---GGEEFEFDSE  66

Query  144  SNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             NRRILATS YISYGAL+R N PCSRRG+SYYNCQPGAQANPY+RGC+
Sbjct  67   INRRILATSQYISYGALRRNNVPCSRRGASYYNCQPGAQANPYSRGCN  114



>ref|XP_008454184.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=121

 Score =   125 bits (315),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 12/111 (11%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAG-GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
            S  VFL  SC   A    V AG G  +   W+P ++     C+GSIAEC    GGEEFE 
Sbjct  15   SAAVFLIFSCSSTA----VHAGIGIQNSLAWIPNQST----CKGSIAECF---GGEEFEF  63

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRRILATS YISYGAL+R N PCSRRG+SYYNCQPGAQANPY+RGC+
Sbjct  64   DSEINRRILATSQYISYGALRRNNVPCSRRGASYYNCQPGAQANPYSRGCN  114



>ref|XP_011082482.1| PREDICTED: rapid alkalinization factor-like [Sesamum indicum]
Length=115

 Score =   125 bits (314),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 81/112 (72%), Gaps = 9/112 (8%)
 Frame = -1

Query  330  STCVFLFISCLLIASLF--TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFE  157
            S+ + + I  +L A LF  T  AG D +   WMP+   +   CQGSIAECMA  G  EF+
Sbjct  4    SSLLGILIPAVLAAVLFLRTATAGDDFN---WMPMN--KPATCQGSIAECMADGG--EFD  56

Query  156  MDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            MD+E NRRILAT++YISYGALQ  N PCS+RG+SYYNCQPGA+ANPYTR C+
Sbjct  57   MDSEINRRILATTSYISYGALQANNVPCSQRGASYYNCQPGAEANPYTRSCT  108



>ref|XP_004494597.1| PREDICTED: protein RALF-like 33-like [Cicer arietinum]
Length=127

 Score =   125 bits (314),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = -1

Query  324  CVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTE  145
            CV L +  +L +S   VDAGG L+  G   +   +   C+GSIA+CM   G EEFE D E
Sbjct  16   CVTLMM-VMLSSSPTVVDAGG-LEQLGMEWIHQTKTI-CEGSIADCMLQQGEEEFEFDNE  72

Query  144  SNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             NRRILAT+ YISYGALQR   PCSRRG+SYYNC+PGAQANPYTRGCS
Sbjct  73   INRRILATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYTRGCS  120



>ref|XP_009376626.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=120

 Score =   124 bits (312),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -1

Query  297  LIASLFTV-DAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE-EFEMDTESNRRILA  124
            + AS+  V  + GD     W+P   A+   C+GSIAEC  A+G + EF+MD+E +RRILA
Sbjct  13   ICASILVVGSSNGDQHHLTWIPTADAKSAPCKGSIAECALAAGDDGEFDMDSEISRRILA  72

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            T+ YISYGALQR   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  73   TTKYISYGALQRNTVPCSRRGASYYNCKPGAQANPYSRGCS  113



>gb|AAS13437.1| rapid alkalinization factor preproprotein [Nicotiana attenuata]
Length=115

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 6/106 (6%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGW-MPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
             I C+LI + F ++   GD     W MP ++  G  C GSI ECMA    +EFE+D+ESN
Sbjct  7    LILCVLIGAFFISMATAGDSGAYDWVMPARSGRG--CNGSIGECMAEE--DEFELDSESN  62

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT  YISYGALQ+ + PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  63   RRILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCS  108



>ref|XP_002319521.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK95616.1| unknown [Populus trichocarpa]
 gb|EEE95444.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=128

 Score =   124 bits (310),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 76/114 (67%), Gaps = 8/114 (7%)
 Frame = -1

Query  318  FLFISCLLIASLF----TVDAGGDLDMA--GWMPVKAAEGGRC--QGSIAECMAASGGEE  163
            FL  + +LI  +     TV   GD      GW+P  A        +GS+AECMA   GEE
Sbjct  8    FLISATVLILMVMGWPSTVQGNGDHHHHHLGWIPTTATTRSSICDKGSLAECMAEEDGEE  67

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MDTE NRRILATS Y+SYGALQ+ N PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  68   FGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYYNCKNGAQANPYSRGCS  121



>gb|AAO27367.1| rapid alkalinization factor 2 precursor [Populus trichocarpa 
x Populus deltoides]
Length=128

 Score =   123 bits (309),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 76/114 (67%), Gaps = 8/114 (7%)
 Frame = -1

Query  318  FLFISCLLIASLF----TVDAGGDLDMA--GWMPVKAAEGGRC--QGSIAECMAASGGEE  163
            FL  + +LI  +     TV   GD      GW+P  A        +GS+AECMA   GEE
Sbjct  8    FLISATVLILMVMGWPSTVQGNGDHHHHHLGWIPTTATTRSSICDKGSLAECMAEEDGEE  67

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MDTE NRRILATS Y+SYGALQ+ N PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  68   FGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYYNCKNGAQANPYSRGCS  121



>ref|XP_008359858.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score =   122 bits (306),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 76/102 (75%), Gaps = 4/102 (4%)
 Frame = -1

Query  297  LIASLFTVDAGG-DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE--FEMDTESNRRIL  127
            + AS+  V +   D     W+P  A++   C+GSIA+C  A+G +E  F+MD+E +RRIL
Sbjct  13   ICASILAVGSSSEDHHHLSWIPAAASKSA-CKGSIADCALAAGNDEVEFDMDSEISRRIL  71

Query  126  ATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ATSNYISYGALQR   PCSRRG+SYYNCQPGAQ+NPY+RGCS
Sbjct  72   ATSNYISYGALQRNTVPCSRRGASYYNCQPGAQSNPYSRGCS  113



>emb|CDP03512.1| unnamed protein product [Coffea canephora]
Length=123

 Score =   122 bits (306),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 79/118 (67%), Gaps = 11/118 (9%)
 Frame = -1

Query  336  NASTCVFLFISCL--LIASLFTVDA-GGDLD---MAGWMPVKAAEGGRCQGSIAECMAAS  175
            N+ +   L  SC+  +I S   + A    LD   +  WMP+KAA    C+GSIAEC+   
Sbjct  4    NSPSDHLLLYSCIVSIIVSGRPISAHAASLDHQELNTWMPMKAAAS--CRGSIAECL---  58

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G  E  MD+E NRRILAT NYISYGALQR   PCSRRGSSYYNCQPG +ANPYTRGCS
Sbjct  59   GSGELSMDSEINRRILATRNYISYGALQRNTVPCSRRGSSYYNCQPGGEANPYTRGCS  116



>ref|XP_002283709.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
 emb|CAN61144.1| hypothetical protein VITISV_043554 [Vitis vinifera]
Length=124

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 11/92 (12%)
 Frame = -1

Query  255  DMAGWMPVKAAEGGRCQGSIAECMAASGGE-------EFEMDTESNRRILATSNYISYGA  97
            D   W+P ++     C+G++AEC+A +GGE       EF MD+E NRRILATS YISYGA
Sbjct  30   DNLSWIPTRSV----CKGTVAECLALAGGEDEFGLTSEFAMDSEINRRILATSKYISYGA  85

Query  96   LQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            LQR + PCSRRG+SYYNCQPGAQANPY RGCS
Sbjct  86   LQRNSVPCSRRGASYYNCQPGAQANPYNRGCS  117



>ref|XP_009342123.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
 ref|XP_009342133.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=113

 Score =   120 bits (302),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN+S  +F     L+ A + + DAG D  ++ W+P++     RC+GS+AECM     +E
Sbjct  1    MANSSAIIFSL--ALVTALIISADAGSDHRVS-WVPLRP----RCEGSVAECMD-DHDDE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MD+E +RRILATS YISYGALQR   PCS RG+SYYNC+ GAQ+NPY RGCS
Sbjct  53   FGMDSEISRRILATSQYISYGALQRNTVPCSHRGASYYNCKSGAQSNPYKRGCS  106



>ref|XP_010038196.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW50015.1| hypothetical protein EUGRSUZ_K03464 [Eucalyptus grandis]
Length=127

 Score =   120 bits (302),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 10/122 (8%)
 Frame = -1

Query  342  MANASTCVF--LFISCLLIAS------LFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAEC  187
            MA+ S   F  LF++ L++A+        +   GG  D   W+   +++ GRCQGSIAEC
Sbjct  1    MASPSLLTFHTLFLTSLIVAAAAISTSGASASGGGGGDGLAWV-AASSKPGRCQGSIAEC  59

Query  186  MAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRG  7
            MA  G E F+MDTE +RR+LATS YISYGALQR   PCS+RG+SYYNCQPGAQ+NPY+R 
Sbjct  60   MAEQGSE-FDMDTEVSRRVLATSQYISYGALQRNTVPCSQRGASYYNCQPGAQSNPYSRS  118

Query  6    CS  1
            CS
Sbjct  119  CS  120



>ref|XP_007144948.1| hypothetical protein PHAVU_007G197000g [Phaseolus vulgaris]
 gb|ESW16942.1| hypothetical protein PHAVU_007G197000g [Phaseolus vulgaris]
Length=116

 Score =   120 bits (301),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 11/94 (12%)
 Frame = -1

Query  279  TVDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISY  103
            T   GGD  +  GW       G  C+GSIAEC+   GGEE+E+D+E NRRILAT+ YISY
Sbjct  26   TAVGGGDHHLGMGW-------GSTCRGSIAECL---GGEEYELDSEINRRILATNKYISY  75

Query  102  GALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            GALQR   PCSRRG+SYYNCQPGAQANPY+RGCS
Sbjct  76   GALQRNTVPCSRRGASYYNCQPGAQANPYSRGCS  109



>ref|XP_010259629.1| PREDICTED: rapid alkalinization factor [Nelumbo nucifera]
Length=116

 Score =   120 bits (301),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 8/105 (8%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
            +F++ ++I+S   VDA G+  + GW+P  +     CQGS+ ECM A   +EF MD+E +R
Sbjct  13   VFVTAVIISS-SAVDASGEHQL-GWLPTIST----CQGSMGECMDAD--DEFGMDSEISR  64

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT+ YISYGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  65   RILATNQYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  109



>ref|XP_011087422.1| PREDICTED: rapid alkalinization factor [Sesamum indicum]
Length=117

 Score =   120 bits (301),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = -1

Query  264  GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRG  85
            GD D +GW+      G  C+G++AEC+A +  EEFE+D+ESNRRILAT  YISYGALQR 
Sbjct  26   GDHDASGWLMPAVRPG--CRGTVAECLA-NEDEEFELDSESNRRILATRRYISYGALQRN  82

Query  84   NTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            + PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  83   SVPCSRRGASYYNCRPGAQANPYSRGCS  110



>ref|XP_010474880.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score =   120 bits (301),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAG--GDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MA + T + L +  ++I S   + AG   DLD  GW       G  C GSIAEC+   G 
Sbjct  1    MAKSFTLMILILFIVMIISSPPIQAGFTNDLDGLGW-ATSGVHGSGCHGSIAECI---GA  56

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EE EMD+E NRRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  57   EEEEMDSEINRRILATTKYISYQSLRRNSVPCSRRGASYYNCQNGAQANPYSRGCS  112



>ref|XP_008368985.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=113

 Score =   120 bits (300),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN+ST +F     L+ A + + DAGGD  ++ W+P++      C+GS+AECM      E
Sbjct  1    MANSSTIIFSL--ALVAALIISADAGGDHRVS-WVPLRPG----CEGSVAECMD-DHDVE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MD+E +RRILATS YISYGALQR   PCS RG+SYYNC+ GAQ+NPY RGC+
Sbjct  53   FGMDSEISRRILATSQYISYGALQRNTVPCSHRGASYYNCKSGAQSNPYKRGCT  106



>gb|ABK96369.1| unknown [Populus trichocarpa x Populus deltoides]
Length=112

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 9/114 (8%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            M  +   +FL +S +L A   ++ +   +D   ++P++++    C+GSIAEC+     EE
Sbjct  1    MTTSKFYIFLLLSVVL-AVRVSLSSSTAVD---FLPLESS--SECRGSIAECLM---DEE  51

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MDTESNRRILATS Y+SYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  52   FGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  105



>ref|XP_002321018.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
 gb|EEE99333.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
Length=115

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 7/98 (7%)
 Frame = -1

Query  294  IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSN  115
            I S  TVDA  D ++  W+P +A     CQG++AECM   G +EFEMD+E NRRILATSN
Sbjct  18   IISSSTVDASEDHNL-NWVPTRARG---CQGTVAECM---GNDEFEMDSEINRRILATSN  70

Query  114  YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            YISY AL + N PCS+RG+SYYNC+ GA+ANPY+RGCS
Sbjct  71   YISYDALGKNNVPCSQRGASYYNCKTGAEANPYSRGCS  108



>ref|XP_010921813.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=123

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 7/82 (9%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSR  67
            GW+P + A    CQG+IAEC+A   GEEFE+D+E +RRILATS YISY AL+R +TPCSR
Sbjct  42   GWIPGRTA----CQGTIAECLA---GEEFELDSEISRRILATSRYISYDALRRDSTPCSR  94

Query  66   RGSSYYNCQPGAQANPYTRGCS  1
            RG+SYYNC+PGA ANPY+RGCS
Sbjct  95   RGASYYNCRPGAHANPYSRGCS  116



>ref|XP_003536069.1| PREDICTED: protein RALF-like 1-like [Glycine max]
Length=117

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 78/120 (65%), Gaps = 16/120 (13%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFT-----VDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMA  181
            MA + +   + IS   +    +     V  GGD  +  GW          C+GSIAEC+ 
Sbjct  1    MAKSCSLAMMLISAATVLVAMSRWPTAVGGGGDHHLGMGWAST-------CKGSIAECL-  52

Query  180  ASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              GGEE+E+D+E NRRILAT+ YISYGALQR   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  53   --GGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYSRGCS  110



>ref|XP_006389381.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
 gb|ERP48295.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
Length=112

 Score =   118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 9/114 (8%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            M  +   +FL +S +L A   ++ +   +D   ++P++++    C+GSIAEC+     EE
Sbjct  1    MTTSKFYIFLLLSAVL-AVRVSLSSSTAVD---FLPLESS--SECRGSIAECLM---DEE  51

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MDTESNRRILATS Y+SYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  52   FGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  105



>gb|KFK42648.1| rapid alkalinization factor 1 [Arabis alpina]
Length=123

 Score =   119 bits (297),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = -1

Query  327  TCVFL--FISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
            T +FL  FI+ ++I+S   V AG   D+ G +      G  C GSIAEC+   G EE EM
Sbjct  10   TIMFLIFFITIMIISSP-PVQAGFASDLDGLLAKTGVHGSGCHGSIAECI---GSEEEEM  65

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  66   DSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  116



>ref|NP_567476.1| protein ralf-like 33 [Arabidopsis thaliana]
 sp|Q8L9P8.1|RLF33_ARATH RecName: Full=Protein RALF-like 33; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM65845.1| RALF precursor [Arabidopsis thaliana]
 gb|ABF59010.1| At4g15800 [Arabidopsis thaliana]
 dbj|BAE99025.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83653.1| protein ralf-like 33 [Arabidopsis thaliana]
Length=116

 Score =   117 bits (294),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 12/110 (11%)
 Frame = -1

Query  321  VFLFISCLLIASLF---TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMD  151
            V + I+ L +  LF   T  + GD     ++P+++    +C G+IAEC  ++  EEFEMD
Sbjct  9    VAIIIAILTVHFLFAAVTSQSSGD-----FVPIES----KCNGTIAECSLSTAEEEFEMD  59

Query  150  TESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +E NRRILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  60   SEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  109



>gb|ABS72341.1| rapid alkalinization factor precursor [Litchi chinensis]
Length=126

 Score =   118 bits (295),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMA-----GWMPVKAAEGGRCQGSIAECMAASGGE---  166
            + L IS +++A    V A   +D       G+ P+K      C GSI EC      E   
Sbjct  9    LVLVISAVILAVHVAVSASSAVDFNAGHQFGFFPMKP----ECSGSIGECATVGDEELDL  64

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EFEMD+ESNRRILATS YISYGAL+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  65   EFEMDSESNRRILATSQYISYGALRRNSVPCSRRGASYYNCQTGAQANPYSRGCS  119



>ref|XP_004302396.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=106

 Score =   117 bits (293),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 16/107 (15%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            + ++ +  L+AS  T++AGGDL    W+P   +      G +++       +EFE+D+E 
Sbjct  11   LLIWATLFLMASSSTIEAGGDL---SWIPTTVS------GLVSD-------DEFELDSEI  54

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            NRRILATSNYISYGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  55   NRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  101



>ref|XP_009778264.1| PREDICTED: rapid alkalinization factor [Nicotiana sylvestris]
Length=115

 Score =   117 bits (293),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 4/105 (4%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             + C+LI + F T+ A GD     W+ + A  GG C GSI +CMA    EEFE+D+ESNR
Sbjct  7    LVLCVLIGAFFITMAAAGDSGAYDWV-MPARSGGGCNGSIGDCMAEE--EEFELDSESNR  63

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT  YISYGALQ+ + PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  64   RILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCS  108



>ref|XP_009629090.1| PREDICTED: rapid alkalinization factor [Nicotiana tomentosiformis]
 sp|Q945T0.1|RALF_TOBAC RecName: Full=Rapid alkalinization factor; Short=NtRALF; Flags: 
Precursor [Nicotiana tabacum]
 gb|AAL26478.1|AF407278_1 RALF precursor [Nicotiana tabacum]
Length=115

 Score =   117 bits (293),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = -1

Query  312  FISCLLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I C+LI + F ++ A GD     W+ + A  GG C+GSI EC+A    EEFE+D+ESNR
Sbjct  7    LILCVLIGAFFISMAAAGDSGAYDWV-MPARSGGGCKGSIGECIAEE--EEFELDSESNR  63

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT  YISYGALQ+ + PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  64   RILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPYSRGCS  108



>ref|XP_004302395.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=108

 Score =   117 bits (292),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 16/107 (15%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            + ++ +  L+AS  T++AGGDL    W+P   +      G +++       +EFE+D+E 
Sbjct  11   LLIWATLFLMASSSTIEAGGDL---SWIPTTVS------GLVSD-------DEFELDSEI  54

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            NRRILATSNYISYGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  55   NRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPYNRGCS  101



>ref|XP_010457289.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 76/116 (66%), Gaps = 6/116 (5%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAG--GDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MA + T + L    ++I S   + AG   DLD   W       G  C GSIAEC+   G 
Sbjct  1    MAKSFTLMILIFFIVMIISSPPIQAGFTNDLDGLEW-ATSGVHGSGCHGSIAECI---GA  56

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EE EMD+E NRRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  57   EEEEMDSEINRRILATTKYISYQSLRRNSVPCSRRGASYYNCQNGAQANPYSRGCS  112



>ref|XP_010691694.1| PREDICTED: protein RALF-like 33 [Beta vulgaris subsp. vulgaris]
Length=119

 Score =   117 bits (292),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MA+    + +    LL+A + TV++G + D        +  G  C+GS+ EC+     +E
Sbjct  1    MADTKKLLTIITIGLLLALISTVESGSNFDPTVMGLFTSGSG--CKGSVGECLGVDE-DE  57

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            FEMD+E NRRILATSNYISY AL R   PCSRRG+SYYNC+PGA ANPY+RGCS
Sbjct  58   FEMDSEINRRILATSNYISYAALNRNRVPCSRRGASYYNCRPGASANPYSRGCS  111



>ref|XP_011092082.1| PREDICTED: rapid alkalinization factor-like [Sesamum indicum]
Length=121

 Score =   116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 8/104 (8%)
 Frame = -1

Query  297  LIASLF--TVDAGGDLDMA--GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRI  130
            +I SLF   V AGGD D A   W+      G  C+G++AEC+  +  +EFE+D+ESNRRI
Sbjct  14   IIGSLFLSQVSAGGDHDAASVAWLMPSVRSG--CRGTVAECLD-NEDQEFELDSESNRRI  70

Query  129  LATSN-YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            LAT+  YISYGALQR + PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  71   LATARRYISYGALQRNSVPCSRRGASYYNCRPGAQANPYRRGCS  114



>ref|XP_008386646.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=113

 Score =   116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 12/116 (10%)
 Frame = -1

Query  342  MANASTCVF--LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN+S  +F   F++ L+I    +VDA G    A W+PV+     RC+GS+AECM     
Sbjct  1    MANSSAIIFSLAFVAALII----SVDASGGHG-ASWVPVRP----RCEGSVAECMD-DHD  50

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            + F MD+E +RRILATS YISYGALQR   PCS+R +SYYNC+PG Q+NPY RGCS
Sbjct  51   DVFGMDSEISRRILATSQYISYGALQRNTVPCSQRXASYYNCKPGXQSNPYNRGCS  106



>gb|KHN16104.1| hypothetical protein glysoja_012080 [Glycine soja]
Length=103

 Score =   115 bits (289),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 3/70 (4%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+   GGEE+E+D+E NRRILAT+ YISYGALQR   PCSRRG+SYYNCQPGA
Sbjct  24   CKGSIAECL---GGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCQPGA  80

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  81   QANPYSRGCS  90



>ref|XP_003529566.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=118

 Score =   116 bits (290),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 83/116 (72%), Gaps = 7/116 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDM-AGWMPVKAAEGGRCQGSIAECMAASGGE  166
            M +++ C F F+ C ++A      +   LD+ A ++P+K+     C+GS+AEC   +G +
Sbjct  1    MGSSTFCAF-FLLCAILAVHVAQSSSSTLDLDAFFLPLKSG----CRGSVAECSLLAGDD  55

Query  165  -EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF M++ESNRRILA  +YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  56   AEFLMESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  111



>gb|KDP28133.1| hypothetical protein JCGZ_13904 [Jatropha curcas]
Length=128

 Score =   116 bits (290),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (66%), Gaps = 11/123 (9%)
 Frame = -1

Query  354  ESTAMANASTCVFLFISCLLIASLFTVDAGGDLDMAG-----WMPVKAAEGGRCQGSIAE  190
            ++  MA  ++ V L   C+  + L T+ +   ++  G     W+P +    G+ +GSIAE
Sbjct  4    KTLTMAECNSSVHLIALCIFFSLLITIFSSSTVEATGESKLSWIPTRR---GQWEGSIAE  60

Query  189  CMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTR  10
            C+   G EE +MD+E +RRIL T+ YISY ALQRG+ PCS RG++YYNCQPGA+AN YTR
Sbjct  61   CI---GEEELDMDSEIHRRILQTTRYISYAALQRGSVPCSHRGATYYNCQPGAEANAYTR  117

Query  9    GCS  1
            GC+
Sbjct  118  GCN  120



>ref|XP_009412092.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=119

 Score =   115 bits (288),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 79/117 (68%), Gaps = 20/117 (17%)
 Frame = -1

Query  315  LFISCLLIASLFTVDA------------GGDLDMAGWMPVKAAEGGRCQGSIAECMAASG  172
            L  S LL+A++  V              GG+L + GW+P  A     C+G+IAEC+A   
Sbjct  4    LVESSLLVAAILLVAGAAAITPAAASGEGGELPL-GWIPALAG----CRGTIAECLA---  55

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            GEEF++ +E  RRILATS+YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+R CS
Sbjct  56   GEEFDLGSEVTRRILATSSYISYGALKRDTVPCSRRGASYYNCRPGAQANPYSRSCS  112



>ref|XP_011033568.1| PREDICTED: protein RALF-like 1 [Populus euphratica]
Length=115

 Score =   115 bits (287),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 7/98 (7%)
 Frame = -1

Query  294  IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSN  115
            I S  TVDA    ++  W+P +A     CQG++AECM   G +EFEMD+E NRRILATS+
Sbjct  18   IISSSTVDASEGHNL-NWVPTRARG---CQGTVAECM---GNDEFEMDSEINRRILATSD  70

Query  114  YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            YISY AL++ N PCS+RG+SYYNC+ GA+ANPY+RGCS
Sbjct  71   YISYDALEKDNVPCSQRGASYYNCKTGAEANPYSRGCS  108



>emb|CDY15442.1| BnaA08g27260D [Brassica napus]
Length=121

 Score =   115 bits (287),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
            F  IS  L+ + FT     DLD   W      +   C GSIA+C+   G EE EMD+E N
Sbjct  16   FFIISSPLVQAGFT----NDLDGLEWATTGVQDSSGCHGSIADCI---GAEEEEMDSEIN  68

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  69   RRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  114



>ref|XP_009119598.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=146

 Score =   115 bits (289),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = -1

Query  363  IDRESTAMANASTC--VFLFISCLLIASLFTVDAGGDLDMAG--WMPVKAAEGGRCQGSI  196
            + +E   MA + +     + +S  LI S   + AG   D+ G  W          C GSI
Sbjct  18   LKKERKKMAKSFSLFPTLMIVSIFLIISSPLIQAGFTDDLKGLEWSSTGVHGSSGCHGSI  77

Query  195  AECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPY  16
            A+C+   G EE EMD+E NRRILAT+ YISY AL+R + PCSRRG+SYYNCQ GAQANPY
Sbjct  78   ADCI---GTEEEEMDSEINRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPY  134

Query  15   TRGCS  1
            +RGCS
Sbjct  135  SRGCS  139



>ref|XP_010105661.1| hypothetical protein L484_010825 [Morus notabilis]
 gb|EXC05642.1| hypothetical protein L484_010825 [Morus notabilis]
Length=119

 Score =   115 bits (287),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 70/106 (66%), Gaps = 8/106 (8%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
             + ++ +L  S       G  +  G+ PVK      C GSIAEC+     EEFEMD+E +
Sbjct  15   LVILAVILAVSWLPAKVLGGGEEIGFFPVKKG----CDGSIAECLE----EEFEMDSEIS  66

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISYGALQR   PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  67   RRILATTKYISYGALQRNTVPCSRRGASYYNCKTGAQANPYNRGCS  112



>gb|KFK39006.1| hypothetical protein AALP_AA3G188700 [Arabis alpina]
Length=124

 Score =   115 bits (287),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = -1

Query  336  NASTCVFLFISCLLIASLFTVDA--GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            N+       I  LL    ++V A     +D AG  P    E   C+G+IAEC + S G+E
Sbjct  7    NSGAAAIFAIFVLLAVQHWSVSAVSSHSIDFAGDFPPFDTE---CRGTIAEC-SVSAGDE  62

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            FEMD+E NRRILAT  YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  63   FEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCS  116



>ref|XP_006606531.1| PREDICTED: protein RALF-like 1-like [Glycine max]
Length=117

 Score =   114 bits (286),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 14/119 (12%)
 Frame = -1

Query  342  MANASTCVFLFI---SCLLIASLF-TVDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMAA  178
            MA +S+     I   + L+  S + T   GGD  +  GW+         C+G+IAEC+  
Sbjct  1    MAKSSSLAITLICAATVLVAMSRWPTAVGGGDHHLGMGWV------SSTCKGTIAECL--  52

Query  177  SGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             GGEE+E+D+E NRRILAT+ YISY ALQR   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  53   -GGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGAQANPYSRGCS  110



>gb|KFK32572.1| hypothetical protein AALP_AA6G260700 [Arabis alpina]
Length=124

 Score =   115 bits (287),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = -1

Query  336  NASTCVFLFISCLLIASLFTVDA--GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            N+     L I  +L    ++V A     +D AG  P    E   C+G+I+EC + S G+E
Sbjct  7    NSGAAAILAIFVILAVQHWSVSAVSSHSIDFAGDFPPFETE---CRGTISEC-SVSAGDE  62

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            FEMD+E NRRILAT  YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  63   FEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCS  116



>ref|XP_009136714.1| PREDICTED: protein RALF-like 33 [Brassica rapa]
 emb|CDX90567.1| BnaA03g42140D [Brassica napus]
Length=111

 Score =   114 bits (285),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = -1

Query  312  FISCLLIASLFTVDAGGDLDMAG-WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I+ L +  LF+      +D A  +MP +      C GSIAEC  A+   EFEMD+E NR
Sbjct  6    IIAILTVLCLFSAAHSQSVDFAADFMPFET----ECTGSIAECSTATA--EFEMDSEINR  59

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  60   RILATTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  104



>emb|CDX99974.1| BnaC09g03270D [Brassica napus]
Length=116

 Score =   114 bits (286),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = -1

Query  333  ASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
            +S  +++ ++ L+I +  TVDA G  D  G+M V+      C+GSIA+C+     EEF +
Sbjct  3    SSRVIYVLVAILVIVTA-TVDANGYEDALGFM-VQTGSSSNCRGSIADCIPEE--EEFGL  58

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E +RRILA+  Y+SYGA+++ + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  59   DSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYSRGCS  109



>ref|XP_002516916.1| RALFL33, putative [Ricinus communis]
 gb|EEF45530.1| RALFL33, putative [Ricinus communis]
Length=117

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -1

Query  300  LLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAEC-MAASGGEEFEMDTESNRRILA  124
            LLI+++  V           +     E G C+GSIAEC M+     EF MDTE NRRILA
Sbjct  10   LLISAILAVHVAVSSSTKSPVDFLPMESGGCRGSIAECLMSGEDDLEFAMDTEINRRILA  69

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            T+ YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGC+
Sbjct  70   TNKYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCN  110



>emb|CDX89932.1| BnaA10g01500D [Brassica napus]
Length=122

 Score =   114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 71/107 (66%), Gaps = 7/107 (7%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            +FL IS  LI + FT     DL    W          C GSIA+C+   G EE EMD+E 
Sbjct  16   IFLIISSPLIQAGFT----DDLKGLEWSSTGVHGSSGCHGSIADCI---GTEEEEMDSEI  68

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            NRRILAT+ YISY AL+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  69   NRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  115



>emb|CDX86697.1| BnaC08g00060D [Brassica napus]
Length=121

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
            F  IS  L+ + FT     DLD   W      +   C GSIA+C+   G EE EMD+E +
Sbjct  16   FFIISSPLVQAGFT----NDLDGLEWATTGVHDSSSCHGSIADCI---GAEEEEMDSEIS  68

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  69   RRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  114



>ref|XP_010097623.1| hypothetical protein L484_001106 [Morus notabilis]
 gb|EXB69889.1| hypothetical protein L484_001106 [Morus notabilis]
Length=164

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
             + ++ +L  S +     G  +  G+ PVK      C GSIAEC+     EEFEMD+E +
Sbjct  15   LVILAVILAVSWWPAKVLGGGEEIGFFPVKKG----CDGSIAECLE----EEFEMDSEIS  66

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISYGALQR   PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  67   RRILATTKYISYGALQRNTVPCSRRGASYYNCKTGAQANPYNRGCS  112



>gb|EYU42176.1| hypothetical protein MIMGU_mgv1a016421mg [Erythranthe guttata]
Length=122

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 11/109 (10%)
 Frame = -1

Query  312  FISCLLIASLFTVDAGGDLDMA-----GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDT  148
            F + LL+A      AGGD   A     GW+   A  G  C+G++AEC+  +  EEFEMD+
Sbjct  13   FTASLLLAQ---ASAGGDHRDAAAAAVGWVMPSARSG--CKGTVAECLG-NEDEEFEMDS  66

Query  147  ESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ESNRRILAT  +ISYGAL+  + PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  67   ESNRRILATRRFISYGALESDSVPCSRRGASYYNCRPGAQANPYNRGCS  115



>ref|XP_009111745.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
Length=116

 Score =   113 bits (283),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = -1

Query  333  ASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
            +S  +++ ++ L+IA+   VDA G  D  G+M V+      C+GSIA+C+     EEF +
Sbjct  3    SSRVIYVVVAILVIATA-RVDANGYEDALGFM-VQTGSSSNCRGSIADCIPQE--EEFGL  58

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E +RRILA+  Y+SYGA+++ + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  59   DSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYSRGCS  109



>ref|XP_003550267.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=120

 Score =   113 bits (283),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 7/117 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDM-AGWMPVKAAEGGRCQGSIAECMAASGGE  166
            M +++T    F+ C +++      +   LD+   ++P+K+     C+GS+AEC   +G +
Sbjct  1    MGSSTTFCAFFLVCTILSVHVAQSSSSTLDLDTFFLPLKSG----CRGSVAECSLLAGDD  56

Query  165  --EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              EF M++ESNRRILA  +YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  57   DTEFLMESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  113



>ref|XP_010434917.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=119

 Score =   112 bits (281),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 5/81 (6%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            +MP+  +   RC GSIAEC  +S  EEFEMD+E NRRILAT+ YISYGAL+R   PCSRR
Sbjct  37   FMPIIES---RCTGSIAECSLSS--EEFEMDSEINRRILATTKYISYGALKRNTVPCSRR  91

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+ GAQANPY+RGCS
Sbjct  92   GASYYNCRRGAQANPYSRGCS  112



>ref|XP_010043059.1| PREDICTED: rapid alkalinization factor [Eucalyptus grandis]
 gb|KCW85083.1| hypothetical protein EUGRSUZ_B01916 [Eucalyptus grandis]
Length=117

 Score =   112 bits (281),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 3/84 (4%)
 Frame = -1

Query  249  AGWMPVKAAEGGR-CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPC  73
            AG +    A G R C GS+AECM  S  EEF MD+ESNRRILA+S YISYGALQR + PC
Sbjct  29   AGHLGFIPANGSRQCTGSLAECM--SEEEEFAMDSESNRRILASSKYISYGALQRNSVPC  86

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG+SYYNC+PGA +NPY RGCS
Sbjct  87   SRRGASYYNCKPGASSNPYNRGCS  110



>ref|XP_010481344.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=122

 Score =   112 bits (280),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 69/99 (70%), Gaps = 8/99 (8%)
 Frame = -1

Query  297  LIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS  118
            LI + FT     DLD  GW       G  C GSIAEC+   G EE EMD+E NRRILAT+
Sbjct  25   LIQAGFT----NDLDGLGWA-TSGVHGSGCHGSIAECI---GAEEEEMDSEINRRILATT  76

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  77   KYISYQSLRRNSVPCSRRGASYYNCQNGAQANPYSRGCS  115



>ref|XP_007035581.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY06507.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=128

 Score =   112 bits (280),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 78/118 (66%), Gaps = 16/118 (14%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVD-AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE----  166
            + C  L +   + AS  T+D  GGD     ++P+K+     C+GSIAEC+  SG E    
Sbjct  12   AICAILAVHVAVSASSPTLDFVGGD----QFLPIKS----ECRGSIAECLMLSGDESSSD  63

Query  165  ---EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
               EF M +E  RRILAT+ YISYGAL+R   PCSRRG+SYYNCQPGAQANPY+RGC+
Sbjct  64   FDAEFAMGSEIYRRILATTRYISYGALRRNTVPCSRRGASYYNCQPGAQANPYSRGCN  121



>ref|XP_002870208.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46467.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 72/106 (68%), Gaps = 6/106 (6%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAGGDLDMAG-WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
            + I+ L +  LF           G +M + +    +C G+IAEC + S  EEFEMD+E N
Sbjct  11   ILIAILTVHFLFAAVTSQSTGFTGDFMQIDS----KCNGTIAEC-SLSTAEEFEMDSEIN  65

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  66   RRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  111



>ref|XP_009111178.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=121

 Score =   112 bits (279),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAG--GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            L I  L I S   V AG   DLD   W      +   C+GSIA+C+   G EE EMD+E 
Sbjct  11   LMILGLFIISSPLVQAGFTNDLDGLEWTTTGVHDSSGCRGSIADCI---GAEEEEMDSEI  67

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +RRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  68   SRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  114



>ref|XP_007154282.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
 gb|ESW26276.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
Length=122

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 11/113 (10%)
 Frame = -1

Query  324  CVFLFISCLLIA--SLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAEC---MAASGGEEF  160
            C F F++C ++A  S  T++   DL  A ++PVK+     C+GS+AEC    AA    EF
Sbjct  9    CAF-FLACAILAQSSSSTLEFTADLG-AFFLPVKS----ECRGSVAECGLLAAADDDAEF  62

Query  159  EMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             MD+E++RRILA   YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  63   LMDSETSRRILAGKTYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  115



>ref|XP_006414444.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
 gb|ESQ55897.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
Length=122

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 6/101 (6%)
 Frame = -1

Query  300  LLIASLFTVDAGGDLDMAG-WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILA  124
            L +  L +V     +  A  +MP++      C GSIAEC  A+  EEFEMD+E NRRILA
Sbjct  20   LTVHWLISVATSQSVGFAADFMPIETE----CTGSIAECSTAAA-EEFEMDSEINRRILA  74

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            T+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  75   TTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  115



>emb|CDY18130.1| BnaC05g01530D [Brassica napus]
Length=122

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAGGDLDMAG--WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            + +S  LI S   + AG   D+ G  W          C GSIA+C+   G EE EMD+E 
Sbjct  12   MIVSIFLIISSPLIQAGLTDDLKGLEWSSTGVHGSSGCYGSIADCI---GTEEEEMDSEI  68

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            NRRILAT+ YISY AL+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  69   NRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  115



>gb|AES91867.2| RALF [Medicago truncatula]
Length=126

 Score =   112 bits (279),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 12/116 (10%)
 Frame = -1

Query  324  CVFLFISCLL-----IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE--  166
            CVF  +  +L     ++S  T+D   +   + ++P  +     C+GSIAEC   +G E  
Sbjct  8    CVFFLLFSILALHVALSSSSTLDFTDNQLSSFFLPSDSG----CRGSIAECSLLAGDEDD  63

Query  165  -EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF MD+ESNRRILA   YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  64   SEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>ref|NP_171789.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
 sp|Q9SRY3.1|RLF1_ARATH RecName: Full=Protein RALF-like 1; AltName: Full=Rapid alkalinization 
factor 1; Short=AtRALF1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02876.1|AC009525_10 Unknown protein [Arabidopsis thaliana]
 gb|AAQ22643.1| At1g02900 [Arabidopsis thaliana]
 gb|AEE27494.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
Length=120

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = -1

Query  363  IDRESTAMANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECM  184
            +D+  T     +  V   IS   + + F  D GG      W       G  C GSIAEC+
Sbjct  1    MDKSFTLFLTLTILVVFIISSPPVQAGFANDLGG----VAW-ATTGDNGSGCHGSIAECI  55

Query  183  AASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
               G EE EMD+E NRRILAT+ YISY +L+R + PCSRRG+SYYNCQ GAQANPY+RGC
Sbjct  56   ---GAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGC  112

Query  3    S  1
            S
Sbjct  113  S  113



>ref|XP_009349507.1| PREDICTED: rapid alkalinization factor-like [Pyrus x bretschneideri]
Length=115

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 10/116 (9%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN S  +FL I   + A + +VDAGGD  ++ W+PV+     RC+G++AECM     EE
Sbjct  1    MANFSAIIFLLI--FVAALVISVDAGGDHGVS-WVPVRP----RCEGAVAECMD-DRDEE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPG--AQANPYTRGCS  1
            F MD+E +RRILATS  ISY A+QR   PCS+RG+S  NC+PG  +Q+NPY RGCS
Sbjct  53   FGMDSEISRRILATSRNISYEAMQRNTVPCSQRGASSNNCKPGGQSQSNPYNRGCS  108



>ref|XP_010522782.1| PREDICTED: protein RALF-like 1 [Tarenaya hassleriana]
Length=111

 Score =   110 bits (275),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 75/115 (65%), Gaps = 12/115 (10%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMAASGGE  166
            MA + T V +    L IAS     AG   DM+ GW     A  G C GS AEC       
Sbjct  1    MAKSLTLVIVLFLLLTIASP-PAQAGSMGDMSLGW-----ATAGGCHGSTAEC-----DG  49

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EFEMD+E NRRILAT++YISY ALQR + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  50   EFEMDSEINRRILATTDYISYQALQRNSIPCSRRGASYYNCRAGAQANPYSRGCS  104



>ref|XP_010069952.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW58484.1| hypothetical protein EUGRSUZ_H01161 [Eucalyptus grandis]
Length=121

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 10/119 (8%)
 Frame = -1

Query  342  MANASTC----VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS  175
            MANA +      FL I+ LL++S+ T +AGGD +++  +P      G CQG IAEC+A  
Sbjct  1    MANAPSASILSFFLSIAILLVSSI-TANAGGDRELSWMLPAPLRAPG-CQGPIAECLAE-  57

Query  174  GGEEFEMDTESNRRILAT-SNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              +EF MD+E +RRILAT   +ISY ALQ G  PCS RG+SYYNC+PGA+ANPY R CS
Sbjct  58   --DEFGMDSEISRRILATMPRHISYDALQPGTVPCSLRGASYYNCRPGAEANPYNRPCS  114



>ref|XP_006285957.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
 gb|EOA18855.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
Length=116

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 7/115 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWM-PVKAAEGGRCQGSIAECMAASGGE  166
            M   ST   L I+ +L      + A        +M P+++     C GSIAEC  +   E
Sbjct  1    MRGLSTKSVLIITAILAVHFLLLTAVTSQSAVDFMMPIESG----CTGSIAEC--SLSVE  54

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EFEMD+E +RRILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  55   EFEMDSEISRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  109



>ref|XP_010090810.1| hypothetical protein L484_009088 [Morus notabilis]
 gb|EXB40843.1| hypothetical protein L484_009088 [Morus notabilis]
Length=118

 Score =   110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 9/117 (8%)
 Frame = -1

Query  342  MANASTCVF---LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG  172
            MAN S+ +    L+ + L +A  F+   G       W+   ++ GG C+GSIAECMA + 
Sbjct  1    MANFSSTLLAMLLYTTALTVA--FSAVEGSVDHRLSWLRTMSSGGG-CRGSIAECMAQN-  56

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              +F+M+ ES RRILATS YISYG+LQR   PCSRRG+SYYNC+ GA+ANPY R CS
Sbjct  57   --DFDMELESKRRILATSQYISYGSLQRNTVPCSRRGASYYNCKQGAEANPYNRECS  111



>ref|XP_010914425.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=122

 Score =   110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     CQG+IAEC+A   GEEF++ +E  RRILATS+YISY AL+R N PCSRR
Sbjct  42   WIPGLST----CQGTIAECLA---GEEFDLSSEVARRILATSDYISYNALKRDNVPCSRR  94

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY+RGCS
Sbjct  95   GASYYNCRPGAQANPYSRGCS  115



>ref|XP_008789920.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=126

 Score =   110 bits (275),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = -1

Query  270  AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQ  91
            AGG  D+ GW+P +      C+G++AEC+A   G+EFE+++E +RRILA   YISY +L+
Sbjct  38   AGGAADL-GWIPGRT----ECRGTVAECIA---GDEFELESEISRRILAFRRYISYNSLR  89

Query  90   RGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RG+ PCSRRG+SYYNC+PGA ANPY+RGCS
Sbjct  90   RGSVPCSRRGASYYNCRPGAHANPYSRGCS  119



>ref|XP_008786719.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=119

 Score =   110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 7/82 (9%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSR  67
            GW+P + A    C+G+IAEC+A   G+EFE+D+E +RRILA+S YISY +L+R   PCSR
Sbjct  38   GWIPGRTA----CRGTIAECLA---GDEFELDSEISRRILASSRYISYDSLRRDRVPCSR  90

Query  66   RGSSYYNCQPGAQANPYTRGCS  1
            RG+SYYNC+PGA ANPY+RGCS
Sbjct  91   RGASYYNCRPGAHANPYSRGCS  112



>gb|KHN31786.1| hypothetical protein glysoja_050399, partial [Glycine soja]
Length=86

 Score =   108 bits (271),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 3/70 (4%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+G+IA+C+   GGEE+E+D+E NRRILAT+ YISY ALQR   PCSRRG+SYYNC+PGA
Sbjct  13   CKGTIADCL---GGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGA  69

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  70   QANPYSRGCS  79



>gb|KHN20242.1| hypothetical protein glysoja_023805 [Glycine soja]
Length=81

 Score =   108 bits (271),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 61/70 (87%), Gaps = 3/70 (4%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+G+IA+C+   GGEE+E+D+E NRRILAT+ YISY ALQR   PCSRRG+SYYNC+PGA
Sbjct  8    CKGTIADCL---GGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGA  64

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  65   QANPYSRGCS  74



>ref|XP_003609670.1| Rapid alkalinization factor [Medicago truncatula]
Length=139

 Score =   110 bits (275),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 12/116 (10%)
 Frame = -1

Query  324  CVFLFISCLL-----IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE--  166
            CVF  +  +L     ++S  T+D   +   + ++P  +     C+GSIAEC   +G E  
Sbjct  8    CVFFLLFSILALHVALSSSSTLDFTDNQLSSFFLPSDSG----CRGSIAECSLLAGDEDD  63

Query  165  -EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF MD+ESNRRILA   YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  64   SEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>ref|XP_002892134.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68393.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
Length=119

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 8/111 (7%)
 Frame = -1

Query  321  VFLFISCLLIASLFT--VDAG--GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
            +FL ++ L+I  + +  V AG   +LD   W       G  C GSIAEC+   G EE EM
Sbjct  7    LFLSLTILIIFIISSPPVQAGFANNLDGLEWA-TNGVHGSGCHGSIAECI---GAEEEEM  62

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRRILAT+ YISY +L+R + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  63   DSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCRNGAQANPYSRGCS  113



>ref|XP_003521558.1| PREDICTED: rapid alkalinization factor-like [Glycine max]
Length=115

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            M++ S  + LF+   L      V A G+  +  W+P        CQ SI ECMA     E
Sbjct  1    MSSVSFLLALFMVVALSIFPSIVGAIGEHRLR-WVPETTTP---CQSSIEECMAEG---E  53

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
            F MD+ES+RRILATS YISY ALQR   PCSRRG+SYYNC+PGA ANPYTRGC
Sbjct  54   FGMDSESHRRILATSQYISYKALQRNTVPCSRRGASYYNCKPGADANPYTRGC  106



>ref|XP_009802961.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=117

 Score =   109 bits (273),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 9/115 (8%)
 Frame = -1

Query  339  ANASTCVFLFISCLLIASLFTVDAGGDLDMAGWM-PVKAAEGGRCQGSIAECMAASGGEE  163
            A++   +++ I  L I+++  VDA    ++ GWM P+++A GG C+GSI ECM       
Sbjct  3    ASSGQALYVLIVALFISNM--VDANDGTELVGWMMPLRSA-GGICEGSIGECMDEE----  55

Query  162  FEMDTESNRRILATSN-YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             E      RRILATS  YISYGALQR N PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  56   LEELEVDKRRILATSRRYISYGALQRNNIPCSRRGASYYNCRPGAQANPYSRGCS  110



>emb|CDY09740.1| BnaC07g33210D [Brassica napus]
Length=111

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -1

Query  312  FISCLLIASLFTVDAGGDLDMAG-WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
             I+ L +  LF+      +  A  +MP +      C GSIAEC  A+   EFEMD+E +R
Sbjct  6    IIAILTVLCLFSAAHSQSVGFAADFMPFET----ECTGSIAECSTATA--EFEMDSEISR  59

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  60   RILATTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGCS  104



>gb|EPS59172.1| rapid alkalinization factor 2, partial [Genlisea aurea]
Length=106

 Score =   108 bits (270),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 68/104 (65%), Gaps = 9/104 (9%)
 Frame = -1

Query  300  LLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG----EEFEMDTESNRR  133
            L   ++ T   G DLD+     V       C+G+IAECMA  GG    +E  MD+E NRR
Sbjct  2    LAAVAIETAVCGSDLDI-----VPMNRQTICRGTIAECMAEGGGGAEDDEIRMDSEVNRR  56

Query  132  ILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ILAT+ YISYGALQ G  PC RRG+SYYNC+PGA ANPYTR CS
Sbjct  57   ILATTRYISYGALQAGIVPCPRRGASYYNCRPGAPANPYTRSCS  100



>ref|XP_008800838.1| PREDICTED: rapid alkalinization factor-like [Phoenix dactylifera]
Length=120

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     CQG+I EC+A   GEEF++ +E  RRILATS+YISY +L+R NTPCSRR
Sbjct  40   WIPGMST----CQGTIEECLA---GEEFDLSSEVARRILATSDYISYNSLKRDNTPCSRR  92

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY+RGCS
Sbjct  93   GASYYNCRPGAQANPYSRGCS  113



>ref|XP_009381039.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=115

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 6/82 (7%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSR  67
            GW+P   +    C+G+IAEC+A   GEEF++ +E+ RRILATS+YISYGAL+R   PCSR
Sbjct  32   GWIPSSLSG---CRGTIAECLA---GEEFDLGSEAGRRILATSSYISYGALKRDTVPCSR  85

Query  66   RGSSYYNCQPGAQANPYTRGCS  1
            RG+SYYNC+PGAQANPY+R CS
Sbjct  86   RGASYYNCRPGAQANPYSRSCS  107



>gb|EYU42214.1| hypothetical protein MIMGU_mgv1a016660mg [Erythranthe guttata]
Length=112

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 8/91 (9%)
 Frame = -1

Query  273  DAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGAL  94
            +AG D     WM   A     C+GSIAEC  A+GGE F MD+E NR ILAT++YISYGAL
Sbjct  23   NAGKDY---SWMTKPAT----CEGSIAECTMANGGE-FYMDSEINRHILATTDYISYGAL  74

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            Q    PCSRRG+SYYNCQPGA+A+PYTR CS
Sbjct  75   QANTVPCSRRGASYYNCQPGAEADPYTRSCS  105



>ref|XP_008775576.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=119

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 64/81 (79%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     CQG+IAEC+A   GEEF++ ++  RR+LATSNYISY AL+R N PCSRR
Sbjct  39   WIPGLST----CQGTIAECLA---GEEFDLSSDVARRMLATSNYISYNALKRNNVPCSRR  91

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY RGCS
Sbjct  92   GASYYNCRPGAQANPYNRGCS  112



>ref|XP_006419584.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 ref|XP_006489088.1| PREDICTED: rapid alkalinization factor 23-like [Citrus sinensis]
 gb|ESR32824.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 gb|KDO71637.1| hypothetical protein CISIN_1g032876mg [Citrus sinensis]
Length=131

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 11/99 (11%)
 Frame = -1

Query  276  VDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE-------EFEMDTESNRRILATS  118
            VD  G     G++PVK+     C+GSIAECM+  G +       EF MD E NRRILA  
Sbjct  30   VDFDGLGHQLGFIPVKS----ECRGSIAECMSVEGDDGDQELDLEFAMDGEINRRILAMR  85

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             YISYGAL+R + PCSRRG+SYYNC+ G QANPY+RGCS
Sbjct  86   RYISYGALRRNSVPCSRRGASYYNCRAGGQANPYSRGCS  124



>ref|NP_001235444.1| uncharacterized protein LOC100500513 precursor [Glycine max]
 gb|ACU15614.1| unknown [Glycine max]
Length=115

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 56/69 (81%), Gaps = 3/69 (4%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            CQGSI ECMA     EF MD+ES+RRILATS YISY ALQR   PCSRRG+SYYNC+PGA
Sbjct  41   CQGSIEECMADG---EFGMDSESHRRILATSQYISYKALQRNTVPCSRRGASYYNCKPGA  97

Query  30   QANPYTRGC  4
             ANPYTRGC
Sbjct  98   DANPYTRGC  106



>ref|XP_009351497.1| PREDICTED: rapid alkalinization factor-like [Pyrus x bretschneideri]
Length=115

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 10/116 (9%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN+   +FL I   + A + +VDAGGD  ++ W+PV+     RC+GS+AECM     +E
Sbjct  1    MANSYAIIFLLI--FVAALVISVDAGGDHGVS-WVPVRP----RCEGSVAECMD-DRDDE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPG--AQANPYTRGCS  1
            F MD+E +RRILATS  ISY A+QR + PC++RG+S  NC+PG  +Q+NPY RGCS
Sbjct  53   FGMDSEISRRILATSRNISYEAMQRNSVPCAQRGASSNNCKPGGQSQSNPYNRGCS  108



>ref|XP_010931639.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=117

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     CQG+IAEC+A   GEEF++ +E  RRILATS+YISY AL+R + PCSRR
Sbjct  37   WIPGMST----CQGTIAECLA---GEEFDLSSEVARRILATSDYISYNALKRDSVPCSRR  89

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY+RGCS
Sbjct  90   GASYYNCRPGAQANPYSRGCS  110



>ref|XP_009418953.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=117

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 7/88 (8%)
 Frame = -1

Query  264  GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRG  85
            GD    GW+PV++     C GS+AEC+A   GEEFE+ +E  RRILA S YISY AL+R 
Sbjct  30   GDELSLGWIPVRSG----CSGSVAECVA---GEEFELGSEVTRRILARSYYISYAALRRD  82

Query  84   NTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            + PCSRRG+SYYNC+PGA+ANPY+R CS
Sbjct  83   SVPCSRRGASYYNCRPGARANPYSRSCS  110



>gb|AFK33323.1| unknown [Medicago truncatula]
Length=126

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 75/116 (65%), Gaps = 12/116 (10%)
 Frame = -1

Query  324  CVFLFISCLL-----IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE--  166
            CVF  +  +L     ++S  T+D   +   + ++P  +     C+GSIA C   +G E  
Sbjct  8    CVFFLLFSILALHVALSSSSTLDFTDNQLSSFFLPSDSG----CRGSIAGCSLLAGDEDD  63

Query  165  -EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF MD+ESNRRILA   YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  64   SEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>ref|XP_006288916.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
 gb|EOA21814.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
Length=117

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            V L IS ++I S   V+AGG  D+ G++ V+      C+GSIA+C+A    EEFE+D+E 
Sbjct  10   VVLVISMIVIVS---VEAGGYEDVLGFV-VRTRTSSDCKGSIADCIAEE--EEFELDSEI  63

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +RRILA+  Y+SYGA+++ N PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  64   SRRILASKKYVSYGAMRKNNVPCSRRGASYYNCKRGAQANPYRRGCS  110



>ref|XP_007147024.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
 gb|ESW19018.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
Length=104

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 21/116 (18%)
 Frame = -1

Query  342  MANASTCVFLFI--SCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN+ + +FL I  + L++++  T +AG       WMP                   S  
Sbjct  1    MANSCSWLFLAICATVLVLSASPTAEAGALGMEMMWMP-------------------SMD  41

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EEF++D+E +RRILAT+ YISYGALQR   PCSRRG+SYYNCQPGAQANPY+RGCS
Sbjct  42   EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCS  97



>ref|XP_010931638.1| PREDICTED: rapid alkalinization factor-like [Elaeis guineensis]
Length=115

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     CQG+IAEC+   GGEEF++ +E  RRILA SNY+SY AL++ + PCSRR
Sbjct  35   WIPRLST----CQGTIAECL---GGEEFDLSSEVARRILADSNYVSYNALKQDSVPCSRR  87

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNCQPGA+ANPY+RGCS
Sbjct  88   GASYYNCQPGAEANPYSRGCS  108



>ref|XP_010098288.1| hypothetical protein L484_023536 [Morus notabilis]
 gb|EXB74792.1| hypothetical protein L484_023536 [Morus notabilis]
Length=125

 Score =   107 bits (267),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM-  154
            + C  L +  L +AS   +D   D  ++ W+   AA    C+GSI EC+ A    E EM 
Sbjct  12   AICAILAVH-LTLASSSAIDLISDHQLS-WI---AARSDGCRGSIGECLIADVDSELEME  66

Query  153  -DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             D+E +RRILA   YISYGAL+R   PCSRRGSSYYNC+PG QANPY+RGCS
Sbjct  67   MDSEGHRRILAQRRYISYGALRRNTVPCSRRGSSYYNCRPGGQANPYSRGCS  118



>ref|XP_004508218.1| PREDICTED: rapid alkalinization factor 23-like [Cicer arietinum]
Length=127

 Score =   107 bits (267),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 13/114 (11%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAGGDLDMAG------WMPVKAAEGGRCQGSIAECMAASGGE---E  163
             F+ C ++A    + +    D         ++P+ +     C+GSIAEC   +G E   E
Sbjct  11   FFLVCTILAVHVALSSSSTFDFTDNQLSSFFLPLDSG----CRGSIAECSLLAGDEDDTE  66

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F MD+E++RRILA   YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  67   FLMDSENSRRILAGRRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  120



>gb|KGN44918.1| hypothetical protein Csa_7G396340 [Cucumis sativus]
Length=112

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 6/110 (5%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMD  151
            +T V   +   L+ ++ TV +        W  V      RC GS+AECM      EF+MD
Sbjct  2    ATTVSFLLPIFLLVAILTVSSTAK--TPSW--VLDGAHARCHGSMAECMMEDI--EFQMD  55

Query  150  TESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +E NRRILA  NYISY AL+  + PCSR+G+SYYNCQPGA+ANPY RGC+
Sbjct  56   SEINRRILADLNYISYDALKANSVPCSRKGASYYNCQPGAEANPYDRGCN  105



>ref|XP_008451660.1| PREDICTED: rapid alkalinization factor-like [Cucumis melo]
Length=112

 Score =   107 bits (266),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 12/107 (11%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            +FL ++ L ++S  T  +        W  V      RC GS+AECM      EFEMD+E 
Sbjct  11   IFLLVAILTVSSTATTPS--------W--VLGGAHARCHGSMAECMKED--IEFEMDSEI  58

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            NRRILA  NYISY AL+  + PCSR+G+SYYNCQPGA+ANPY RGC+
Sbjct  59   NRRILADLNYISYDALRANSVPCSRKGASYYNCQPGAEANPYDRGCN  105



>ref|XP_008339535.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=115

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 10/116 (9%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN+S  +F  I     A + +VDAGGD  ++ W PV+     RC+GS+AECM     +E
Sbjct  1    MANSSAIIFSLI--FXAALVISVDAGGDHGVS-WXPVRP----RCEGSVAECMD-DRDDE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA--QANPYTRGCS  1
            F MD+E +RRILATS  ISY ALQR   PCS+RG+S  NC+PGA  Q+NPY  GCS
Sbjct  53   FGMDSEISRRILATSRNISYEALQRNTVPCSQRGASSNNCKPGAQNQSNPYNXGCS  108



>ref|XP_006304742.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
 gb|EOA37640.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
Length=123

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = -1

Query  261  DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGN  82
            DLD   W       G  C GSIAEC+   G EE EMD+E +RR+LAT+ YISY +L++ +
Sbjct  33   DLDGLEWATSGVHGGSGCHGSIAECI---GAEEEEMDSEISRRVLATTKYISYQSLKKNS  89

Query  81   TPCSRRGSSYYNCQPGAQANPYTRGCS  1
             PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  90   VPCSRRGASYYNCQNGAQANPYSRGCS  116



>ref|XP_008358766.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=115

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 14/118 (12%)
 Frame = -1

Query  342  MANASTCVF--LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN+S  +F   F++ L+I    +VDAGGD  ++ W+PV+     R +GS+AECM     
Sbjct  1    MANSSAIIFSLAFVAALII----SVDAGGDHGVS-WVPVRP----RREGSVAECMD-DRD  50

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA--QANPYTRGCS  1
            +EF MD+E +RRILATS  ISY ALQR   PCS+RG+S  NC+PGA  Q+NPY RGCS
Sbjct  51   DEFGMDSEISRRILATSRNISYEALQRNTVPCSQRGASSNNCKPGAQNQSNPYNRGCS  108



>ref|XP_003521695.2| PREDICTED: protein RALF-like 1-like isoform 1 [Glycine max]
Length=174

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 75/121 (62%), Gaps = 20/121 (17%)
 Frame = -1

Query  354  ESTAMANASTCVFLFISCLLIASLF---TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECM  184
            + T+MAN+ T +FL IS  L+  L    T +AG       W+P    E            
Sbjct  64   KQTSMANSYTWLFLAISATLLLLLSSSPTANAGALGMEMTWIPSMPME------------  111

Query  183  AASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
                 EEF++D+E +RRILAT+ YISYGALQR   PCSRRG+SYYNCQPGAQANPY+RGC
Sbjct  112  -----EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGC  166

Query  3    S  1
            S
Sbjct  167  S  167



>ref|XP_009384171.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=118

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 13/119 (11%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIAS---LFTV--DAGGDLDMAGWMPVKAAEGGRCQGSIAECMAA  178
            MA     +F  ++ LL  +   L T   ++G  L + GW+P  +     C+G++AEC+A 
Sbjct  1    MAGLKAFIFFPVALLLFLAGNALATAGGESGSQLPL-GWIPSLSG----CRGTVAECVA-  54

Query  177  SGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              G+EF++ +E  RRILATS YISY AL+R   PCSRRG+SYYNC+PGAQANPY+R CS
Sbjct  55   --GDEFDLGSEVTRRILATSRYISYNALRRDTVPCSRRGASYYNCRPGAQANPYSRSCS  111



>ref|XP_006299574.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
 gb|EOA32472.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
Length=131

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 13/124 (10%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE-  166
            ++  +  +F  +  L +       +   ++++G  P    E   C+GSIAEC  ++ G+ 
Sbjct  4    LSVTTAAIFAILVILTVQYWSVAVSSQSVELSGDFPPFETE---CRGSIAECSVSAEGDL  60

Query  165  ---------EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYT  13
                     EFEMD+E NRRILAT  YISYGAL+R   PCSRRG+SYYNC+ GAQANPY 
Sbjct  61   FSGGGGMGAEFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYR  120

Query  12   RGCS  1
            RGCS
Sbjct  121  RGCS  124



>ref|XP_008353053.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 33 [Malus domestica]
Length=172

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 10/116 (9%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            MAN+S  +F  I     A + +VDAGGD  ++ W PV+     RC+GS+AECM     +E
Sbjct  1    MANSSAIIFSLI--FXAALVISVDAGGDHGVS-WXPVRP----RCEGSVAECMD-DRDDE  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA--QANPYTRGCS  1
            F MD+E +RRILATS  ISY ALQR   PCS+RG+S  NC+PGA  Q+NPY  GCS
Sbjct  53   FGMDSEISRRILATSRNISYEALQRNTVPCSQRGASSNNCKPGAQNQSNPYNXGCS  108



>ref|XP_004152366.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 ref|XP_004156891.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN52797.1| hypothetical protein Csa_4G001640 [Cucumis sativus]
Length=122

 Score =   105 bits (263),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 8/83 (10%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQG-SIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCS  70
             W+  +A    RC G SI+ECM      EFEMD+E NRRILATS+YISY +L+  N PCS
Sbjct  40   NWLSTEA----RCHGRSISECMM---HIEFEMDSEINRRILATSSYISYKSLRANNIPCS  92

Query  69   RRGSSYYNCQPGAQANPYTRGCS  1
            RRGSSYYNCQPGA+ANPY RGC+
Sbjct  93   RRGSSYYNCQPGAEANPYQRGCT  115



>gb|KHN15225.1| hypothetical protein glysoja_042499 [Glycine soja]
Length=114

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 69/114 (61%), Gaps = 21/114 (18%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAGGDLDMAG----WMPVKAAEGGRCQGSIAECMAASGGEE  163
            +TC  LF   LLI+S  T DAGG     G    WMP  + EG                EE
Sbjct  11   ATCATLF---LLISSATTADAGGAGTAPGMEMTWMPSISMEGAE--------------EE  53

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F +D E NRR+LA++ YISY A+ RG+ PCS RG+SYY+CQPGAQANPY RGCS
Sbjct  54   FMLDNEINRRMLASTRYISYCAIHRGSVPCSHRGASYYHCQPGAQANPYHRGCS  107



>gb|KDP27792.1| hypothetical protein JCGZ_18872 [Jatropha curcas]
Length=118

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = -1

Query  300  LLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFE----MDTESNRR  133
            LLI ++  V A               E G C+GSIAEC+  +G E+FE    MD+E NRR
Sbjct  10   LLICAILAVHAAISSSSTAGFDFIPMESG-CRGSIAECLI-NGDEDFETEFAMDSEINRR  67

Query  132  ILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ILAT  YISYGAL+R + PCSRRG+SYYNC+ GAQANPY+RGC+
Sbjct  68   ILATRTYISYGALRRNSVPCSRRGASYYNCRAGAQANPYSRGCN  111



>ref|XP_009393214.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSR  67
            GW+P  +     C+GSIAEC+A   GEEF++ +E +RR LATS+YISYGAL+    PCSR
Sbjct  41   GWIPSLSG----CRGSIAECLA---GEEFDLGSEVSRRFLATSSYISYGALKSDTVPCSR  93

Query  66   RGSSYYNCQPGAQANPYTRGCS  1
            RG+SYYNC+PGAQANPY+R CS
Sbjct  94   RGASYYNCRPGAQANPYSRSCS  115



>ref|XP_002883013.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59272.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 75/127 (59%), Gaps = 18/127 (14%)
 Frame = -1

Query  336  NASTCVFLFISCLLIASLFTVDAGGD-LDMAGWMPVKAAEGGRCQGSIAECMAAS-----  175
            N+       I  +L    ++V      ++ AG  P    E   C+G+IAEC  ++     
Sbjct  7    NSGAAAIFAILVILTVQFWSVTVSSQSIEFAGDFPPFETE---CRGTIAECSVSAALGED  63

Query  174  ------GGE---EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQAN  22
                  GGE   EFEMD+E NRRILAT  YISYGAL+R   PCSRRG+SYYNC+ GAQAN
Sbjct  64   GDLFYGGGEMGAEFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQAN  123

Query  21   PYTRGCS  1
            PY+RGCS
Sbjct  124  PYSRGCS  130



>emb|CDY19732.1| BnaA09g03850D [Brassica napus]
Length=116

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 68/92 (74%), Gaps = 3/92 (3%)
 Frame = -1

Query  276  VDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGA  97
            V+A G  D  G+M V+      C+GSIA+C+     EEF +D+E +RRILA+  Y+SYGA
Sbjct  21   VEASGYEDTLGFM-VQTGSSSNCRGSIADCIPQE--EEFGLDSEISRRILASKKYVSYGA  77

Query  96   LQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +++ + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  78   MRKNSVPCSRRGASYYNCQRGAQANPYSRGCS  109



>ref|XP_003554646.1| PREDICTED: protein RALF-like 1-like [Glycine max]
 gb|KHN43298.1| hypothetical protein glysoja_001881 [Glycine soja]
Length=129

 Score =   105 bits (261),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 73/121 (60%), Gaps = 20/121 (17%)
 Frame = -1

Query  354  ESTAMANASTCVFLFISCLLIASLF---TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECM  184
            + T+MAN  + +FL I   L+  L    T DAG       W+P    E            
Sbjct  19   KQTSMANTYSWLFLAICATLLLLLSSSPTADAGALGMEMTWIPSMPME------------  66

Query  183  AASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
                 EEF++D+E +RRILAT+ YISYGALQR   PCSRRG+SYYNCQPGAQANPY+RGC
Sbjct  67   -----EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGC  121

Query  3    S  1
            S
Sbjct  122  S  122



>ref|XP_004143090.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 ref|XP_004163235.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN47180.1| hypothetical protein Csa_6G194150 [Cucumis sativus]
Length=118

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 14/122 (11%)
 Frame = -1

Query  363  IDRESTAMANASTCVFLFISCLLIASLFT-VDAGGDLDMAGWMPVKAAEGGRCQGSIAEC  187
            I R S+ +A     VFL ++   + S+   VD  GD ++  ++P  +           + 
Sbjct  3    ISRVSSLLA-----VFLILAPHFVFSMAAAVDFSGDHELL-FVPTTSDFF-------DDN  49

Query  186  MAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRG  7
                 G EF+MD+E NRRILAT+ YISYGAL+R N PCSRRG+SYYNC+PGAQANPYTRG
Sbjct  50   DDFGFGMEFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYTRG  109

Query  6    CS  1
            CS
Sbjct  110  CS  111



>ref|XP_008458453.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=119

 Score =   104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G EF+MD+E NRRILAT+ YISYGAL+R N PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  56   GMEFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPYSRGCS  112



>ref|XP_009351500.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=115

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 80/118 (68%), Gaps = 14/118 (12%)
 Frame = -1

Query  342  MANASTCVF--LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN+   +F   F++ L+I    +VDAGGD  ++ W+PV+     RC+GS+AECM     
Sbjct  1    MANSYAIIFSLAFVAALII----SVDAGGDHGVS-WVPVRP----RCEGSVAECMD-DRD  50

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPG--AQANPYTRGCS  1
            +EF MD+E +RR LATS  ISY ALQR   PCS+RG+S  NC+PG  +Q+NPY RGCS
Sbjct  51   DEFGMDSEISRRSLATSRNISYDALQRNTEPCSQRGASSNNCKPGGQSQSNPYNRGCS  108



>ref|XP_006406825.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
 gb|ESQ48278.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
Length=136

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 71/120 (59%), Gaps = 16/120 (13%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG----------  172
            +F  +  L +       +   ++ AG  P    E   C+G+IAEC  ++           
Sbjct  13   IFAILVILAVQHWSVAVSSQSVEFAGDFPPIETE---CRGTIAECSVSAALGDEGDLFYG  69

Query  171  ---GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
               G EFEMD+E NRRILA   YISYGAL+R + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  70   GGMGAEFEMDSEINRRILANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPYSRGCS  129



>emb|CDX92081.1| BnaA05g23260D [Brassica napus]
Length=127

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 70/111 (63%), Gaps = 16/111 (14%)
 Frame = -1

Query  294  IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG-------------GEEFEM  154
            I ++F + A   L +A   P    E   C+G+IAEC  ++              G EFEM
Sbjct  13   ILAIFAILAVQHLTVAADFPPLETE---CRGTIAECSVSAAFGDEGDLFYGGGMGAEFEM  69

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRR+LA   YISYGAL+R + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  70   DSEINRRMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPYSRGCS  120



>ref|XP_010487517.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
 ref|XP_010487519.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=129

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 16/121 (13%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS--------  175
            +T   L I  +L A  ++V A     +    P++      C+G+IAEC  ++        
Sbjct  7    TTAAILAILVILTAQYWSV-AVSSQSVEFLSPIET----ECRGTIAECSVSAAIGDEDGD  61

Query  174  ---GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
               GG EFEMD+E NRR+LA   YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGC
Sbjct  62   LFYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQANPYSRGC  121

Query  3    S  1
            S
Sbjct  122  S  122



>ref|XP_010465683.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=128

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 10/80 (13%)
 Frame = -1

Query  210  CQGSIAECMAAS----------GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRG  61
            C+G+IAEC  ++          GG EFEMD+E NRR+LA   YISYGAL+R   PCSRRG
Sbjct  42   CRGTIAECSVSAALGDEGDLFYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRG  101

Query  60   SSYYNCQPGAQANPYTRGCS  1
            +SYYNC+ GAQANPY+RGCS
Sbjct  102  ASYYNCRRGAQANPYSRGCS  121



>ref|XP_006840509.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
 gb|ERN02184.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
Length=119

 Score =   102 bits (255),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P K +    C+GSI EC++   GEEF MD+E NRRILAT  YISY AL++   PCS++
Sbjct  36   WVPAKQS----CEGSIGECLS---GEEFAMDSEINRRILATDQYISYNALKKNIVPCSKK  88

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G SYYNC+ G QANPY+RGCS
Sbjct  89   GQSYYNCRAGGQANPYSRGCS  109



>ref|XP_010493984.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=116

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 80/114 (70%), Gaps = 5/114 (4%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            M N S  +++ ++ LLI ++  V+AGG  D  G++ V+      C+GSIA+C+A     E
Sbjct  1    MVN-SRIIYVVVTILLIVTV-AVEAGGYEDSLGFV-VRTGTSSECKGSIADCIAEDEEFE  57

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            F+ +   +RRILA+  Y+SYGA+++ N PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  58   FDSEI--SRRILASKKYVSYGAMRKNNVPCSRRGASYYNCKRGAQANPYSRGCS  109



>ref|XP_009349509.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=115

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 80/118 (68%), Gaps = 14/118 (12%)
 Frame = -1

Query  342  MANASTCVF--LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            MAN+   +F   F++ L+I    +VDAGGD  ++  +PV+     RC+GS+AECM     
Sbjct  1    MANSYAIIFSLAFVAALII----SVDAGGDHGVS-CVPVRP----RCEGSVAECMD-DRD  50

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA--QANPYTRGCS  1
            +EF MD+E +RRILATS  ISY A+QR   PCS+RG+S  NC+PGA  Q+NPY RGCS
Sbjct  51   DEFGMDSEISRRILATSRNISYDAMQRNTVPCSQRGASSNNCKPGAQSQSNPYNRGCS  108



>gb|EPS64947.1| rapid alkalinization factor 2, partial [Genlisea aurea]
Length=101

 Score =   101 bits (251),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = -1

Query  276  VDAGGDLDMAG--WMPVKAAEGGRCQGSIAECMAASGGEEFEM-DTESNRRILATSNYIS  106
            V +GG+   A    + + AA    C+G++ EC+A  GG+EFE+  +ES RRIL    YIS
Sbjct  3    VASGGEHHSASSELVMMSAAMNSGCKGTVGECLA--GGDEFELLRSESERRILFARRYIS  60

Query  105  YGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            YGALQR   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  61   YGALQRDAVPCSRRGASYYNCRPGAQANPYVRGCS  95



>ref|XP_006279280.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
 gb|EOA12178.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
Length=85

 Score =   100 bits (250),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 3/73 (4%)
 Frame = -1

Query  219  GGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQ  40
            G  C GSIAEC+   G EE EMD+E +RR+LAT+ YISY +L++ + PCSRRG+SYYNCQ
Sbjct  9    GSGCHGSIAECI---GAEEEEMDSEISRRVLATTKYISYQSLKKNSVPCSRRGASYYNCQ  65

Query  39   PGAQANPYTRGCS  1
             GAQANPY+RGCS
Sbjct  66   NGAQANPYSRGCS  78



>ref|XP_006433408.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
 ref|XP_006472087.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR46648.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
Length=112

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 69/114 (61%), Gaps = 17/114 (15%)
 Frame = -1

Query  333  ASTCVFLFISCL--LIASLFTVDAGGDLDMA-GWMPVKAAEGGRCQGSIAECMAASGGEE  163
            +S    L IS +  ++ SL  VDA GDL    GWMP          GS+A          
Sbjct  6    SSCAALLVISAMIFMLNSLSAVDASGDLQHHLGWMP---------SGSLAIEEEEF----  52

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             E+D+E NRRILAT+ YISYGALQR   PCSRRG+SYYNCQ G QANPY RGCS
Sbjct  53   -ELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCQNGGQANPYNRGCS  105



>gb|KHN03976.1| hypothetical protein glysoja_022662 [Glycine soja]
Length=75

 Score =   100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EEF++D+E +RRILAT+ YISYGALQR   PCSRRG+SYYNCQPGAQANPY+RGCS
Sbjct  13   EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPYSRGCS  68



>ref|XP_009146075.1| PREDICTED: rapid alkalinization factor 23-like [Brassica rapa]
Length=127

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 69/111 (62%), Gaps = 16/111 (14%)
 Frame = -1

Query  294  IASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG-------------GEEFEM  154
            I ++F + A   L +A   P    E   C+G+IAEC  ++              G EFEM
Sbjct  13   ILAIFAILAVQHLTVAADFPPLETE---CRGTIAECSVSAAFGDEGDLFYGGGMGAEFEM  69

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NR +LA   YISYGAL+R + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  70   DSEINRHMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPYSRGCS  120



>ref|XP_009385018.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=119

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 7/81 (9%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            W+P  +     C+G++AEC+A   GE+F++  E  RR+LATSNY+SYGAL+R   PCS R
Sbjct  39   WVPSLSG----CRGTVAECLA---GEQFDLGAEVTRRMLATSNYVSYGALKRDTVPCSSR  91

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY+R CS
Sbjct  92   GASYYNCRPGAQANPYSRSCS  112



>ref|XP_010938417.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=126

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 7/82 (9%)
 Frame = -1

Query  246  GWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSR  67
            GW+P + A    C+G++AEC+A   G+EF+ ++E +RRILA+  YISY AL+R + PCSR
Sbjct  45   GWIPGQTA----CRGTVAECIA---GDEFDFESEISRRILASWRYISYNALRRDSVPCSR  97

Query  66   RGSSYYNCQPGAQANPYTRGCS  1
            RG+SYYNC+PGA ANPY RGCS
Sbjct  98   RGASYYNCRPGAYANPYHRGCS  119



>emb|CDY43109.1| BnaC05g36680D [Brassica napus]
Length=127

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 24/125 (19%)
 Frame = -1

Query  336  NASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASG-----  172
            N+ T   L I  +L     TV        A ++P++      C+G+IAEC  ++      
Sbjct  7    NSGTAAILAIFAILAVQHLTV-------AADFLPLET----ECRGTIAECSVSAALGEEG  55

Query  171  --------GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPY  16
                    G EFEMD+E NRR+LA   YISYGAL+R + PCSRRG+SYYNC+ GA ANPY
Sbjct  56   DLFYGGGMGAEFEMDSEINRRMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAHANPY  115

Query  15   TRGCS  1
            +RGCS
Sbjct  116  SRGCS  120



>ref|XP_009135493.1| PREDICTED: rapid alkalinization factor 23-like [Brassica rapa]
 emb|CDX82397.1| BnaA03g34240D [Brassica napus]
Length=133

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 13/83 (16%)
 Frame = -1

Query  210  CQGSIAECMAASG-------------GEEFEMDTESNRRILATSNYISYGALQRGNTPCS  70
            C+G+IAEC  ++              G EFEMD+E NRR+LAT  YISYGAL+R   PCS
Sbjct  44   CRGTIAECSVSAALVEEGDLFYGGGMGAEFEMDSEINRRMLATRRYISYGALRRNTVPCS  103

Query  69   RRGSSYYNCQPGAQANPYTRGCS  1
            RRG+SYYNC+ GAQANPY+RGCS
Sbjct  104  RRGASYYNCRRGAQANPYSRGCS  126



>emb|CBI39521.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EF MD+E NRRILATS YISYGALQR + PCSRRG+SYYNCQPGAQANPY RGCS
Sbjct  86   EFAMDSEINRRILATSKYISYGALQRNSVPCSRRGASYYNCQPGAQANPYNRGCS  140



>emb|CDX75886.1| BnaC03g39690D [Brassica napus]
Length=133

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 13/83 (16%)
 Frame = -1

Query  210  CQGSIAECMAASG-------------GEEFEMDTESNRRILATSNYISYGALQRGNTPCS  70
            C+G+IAEC  ++              G EFEMD+E NRR+LAT  YISYGAL+R   PCS
Sbjct  44   CRGTIAECSVSAAFGDEGDLFYGGGMGAEFEMDSEINRRMLATRRYISYGALRRNTVPCS  103

Query  69   RRGSSYYNCQPGAQANPYTRGCS  1
            RRG+SYYNC+ GAQANPY+RGCS
Sbjct  104  RRGASYYNCRRGAQANPYSRGCS  126



>ref|XP_003625906.1| RALF [Medicago truncatula]
 gb|AES82124.1| RALF [Medicago truncatula]
Length=118

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 8/116 (7%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLF--TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGG  169
            M+N S  +      ++  S+F  T  A G+  +    P+       CQGSI EC+     
Sbjct  1    MSNVSFLLLPLYLFMVSTSIFPATSSATGEHHLRWVAPMTTPT---CQGSIEECIEEG--  55

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF M++ES+RRILAT++YISY ALQR   PCS +G+SYYNCQ GA+ANPY+RGC+
Sbjct  56   -EFGMNSESHRRILATTHYISYRALQRNTVPCSHKGASYYNCQTGAEANPYSRGCA  110



>ref|XP_002442268.1| hypothetical protein SORBIDRAFT_08g017280 [Sorghum bicolor]
 gb|EES16106.1| hypothetical protein SORBIDRAFT_08g017280 [Sorghum bicolor]
Length=126

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = -1

Query  261  DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMD----TESNRRILATSNYISYGAL  94
            DLD+        A    C+G++AEC+AA   EE  +D     ES+RR L  + YISYGAL
Sbjct  29   DLDLGFLSSSSGARRRECRGTVAECLAAEESEEERLDLVSSPESHRRALYGNGYISYGAL  88

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +R N PCSRRG+SYYNC+PG QANPY RGCS
Sbjct  89   RRDNVPCSRRGASYYNCRPGGQANPYHRGCS  119



>ref|XP_004494362.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=118

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 66/101 (65%), Gaps = 7/101 (7%)
 Frame = -1

Query  300  LLIASLF-TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILA  124
            ++  S+F T++         W+   A     CQGSI EC+      EF MD+ES+RRILA
Sbjct  16   MVSMSIFPTIEGATSEHRLRWV---ATTTPTCQGSIEECIEDG---EFGMDSESHRRILA  69

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            TS YISY ALQR   PCS +G+SYYNCQ GA+ANPY+RGC+
Sbjct  70   TSQYISYRALQRNTVPCSHKGASYYNCQKGAEANPYSRGCT  110



>gb|KFK44989.1| hypothetical protein AALP_AA1G329500 [Arabis alpina]
Length=105

 Score = 99.4 bits (246),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EEFEMD+E NRRILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  43   EEFEMDSEINRRILATTRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCS  98



>ref|XP_007227502.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
 gb|EMJ28701.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
Length=124

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 67/113 (59%), Gaps = 16/113 (14%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDA-------GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEF  160
            F+F   +L A L    +       G  LD   W+  ++A G          +A     E 
Sbjct  14   FIFACAILAAHLVHASSAAVDFSGGHQLDQLSWVSTRSAGG---------LIAEDEDLEL  64

Query  159  EMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             M++E +RRILAT+ YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  65   PMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  117



>ref|XP_010037445.1| PREDICTED: rapid alkalinization factor [Eucalyptus grandis]
 gb|KCW84482.1| hypothetical protein EUGRSUZ_B01311 [Eucalyptus grandis]
Length=135

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 8/93 (9%)
 Frame = -1

Query  258  LDMAGWMPVKAAEGGRCQGSIAECMAASGGEE-------FEMDTESNRRILATSNYISYG  100
            LD A  + +    GG C+G+IAEC+AA GG           MD+E+NRRILA   YISYG
Sbjct  37   LDFAAAV-IPYPAGGECRGTIAECLAAGGGGGEWEWGEELAMDSETNRRILAGRRYISYG  95

Query  99   ALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            AL+R   PCSRRG+SYYNC+PGA ANPY+R CS
Sbjct  96   ALRRNVVPCSRRGASYYNCRPGAAANPYSRACS  128



>ref|XP_009781864.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=128

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 7/121 (6%)
 Frame = -1

Query  345  AMANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVK----AAEGGRCQGSIAECMAA  178
            AM   ++   L IS + +      +A G  ++ G+ P+     ++     +GSI E +A 
Sbjct  2    AMVKVNSFTILLISSIFLIVAAAAEATGAHEL-GFHPMTLSMTSSASSIYEGSIGELLAE  60

Query  177  SGG-EEFEMDTESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
            +G  EEF M++ES RRILA    YISYGAL R   PCSRRG+SYYNC+PGAQANPY RGC
Sbjct  61   NGSDEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRRGASYYNCRPGAQANPYRRGC  120

Query  3    S  1
            S
Sbjct  121  S  121



>ref|XP_009615222.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=128

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 7/121 (6%)
 Frame = -1

Query  345  AMANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVK----AAEGGRCQGSIAECMAA  178
            AM   ++   L IS + +       A G  ++ G+ P+     ++     +GSI E +A 
Sbjct  2    AMVKVNSFTILLISSIFLIGAAAAAATGAHEL-GFYPMTLSMTSSASSIYEGSIGEFLAE  60

Query  177  SGG-EEFEMDTESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
            +G  EEF M++ES RRILA    YISYGAL R   PCSRRG+SYYNC+PGAQANPY RGC
Sbjct  61   NGSDEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRRGASYYNCRPGAQANPYRRGC  120

Query  3    S  1
            S
Sbjct  121  S  121



>ref|XP_008246129.1| PREDICTED: rapid alkalinization factor-like [Prunus mume]
Length=124

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 16/113 (14%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDA-------GGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEF  160
            F+F+  +L A L    +       G  L    W+  ++A G          +A     E 
Sbjct  14   FIFVCAILAAHLVHASSAAVDFSGGHQLGQLSWVSTRSAGG---------LIAEDEDLEL  64

Query  159  EMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             M++E +RRILAT+ YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  65   PMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  117



>ref|XP_006394946.1| hypothetical protein EUTSA_v10005147mg [Eutrema salsugineum]
 gb|ESQ32232.1| hypothetical protein EUTSA_v10005147mg [Eutrema salsugineum]
Length=120

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            VFL I  ++IA    V+AGG  D  G++ VK    G+C+GS+A+C+A    E       S
Sbjct  9    VFLAIFVIVIA---VVEAGGYEDSLGFV-VKTGSSGKCKGSMADCIAEEEEEFELESEIS  64

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             RRIL +  YISYGAL+R   PCSRRG+SYYNC+ GA+ANPY+ GCS
Sbjct  65   -RRILDSKVYISYGALRRNVVPCSRRGASYYNCERGAEANPYSHGCS  110



>ref|XP_007140560.1| hypothetical protein PHAVU_008G122900g [Phaseolus vulgaris]
 gb|ESW12554.1| hypothetical protein PHAVU_008G122900g [Phaseolus vulgaris]
Length=108

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 67/101 (66%), Gaps = 19/101 (19%)
 Frame = -1

Query  300  LLIASLFTVDAGG-DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILA  124
            +L +S  T +AGG  ++MA WMP           SI E +      E EMD+E NRRILA
Sbjct  19   MLTSSPTTAEAGGVGMEMA-WMP-----------SIEEEL------ELEMDSEINRRILA  60

Query  123  TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +SNYISY A+QRG  PCS  G+SYYNC+PGA+ANPY RGCS
Sbjct  61   SSNYISYQAIQRGTVPCSLAGASYYNCKPGAEANPYQRGCS  101



>ref|XP_010524867.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = -1

Query  318  FLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
             L I  +L A++ + D  G     G +   ++  G C+GSIAECMA    EE E+ +E +
Sbjct  10   ILSILAILTAAVESADDYGA--AVGLIRTGSSLSG-CKGSIAECMAEE--EELELGSEIS  64

Query  138  RRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RRILAT+ YISYGALQR + PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  65   RRILATNKYISYGALQRNSVPCSRRGASYYNCRRGAQANPYSRGCS  110



>ref|XP_009402519.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=115

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 7/88 (8%)
 Frame = -1

Query  264  GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRG  85
            G     GW+P  A     C+G+IAEC+   G EE ++    +RR+LATS+YISYGAL+  
Sbjct  28   GKQPPLGWIPSLAG----CRGTIAECL---GDEELDLGAVVSRRVLATSSYISYGALRAD  80

Query  84   NTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             TPCS+ G+SYYNCQPGAQ+NPY+R CS
Sbjct  81   TTPCSQPGASYYNCQPGAQSNPYSRSCS  108



>ref|XP_010504445.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=130

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 15/85 (18%)
 Frame = -1

Query  210  CQGSIAECMAAS------------GGE---EFEMDTESNRRILATSNYISYGALQRGNTP  76
            C+G+IAEC  ++            GGE   EFEMD+E +RR+LA   YISYGAL+R   P
Sbjct  39   CRGTIAECSVSAALGDEDGDLFYGGGEMGAEFEMDSEISRRMLAARRYISYGALRRNTVP  98

Query  75   CSRRGSSYYNCQPGAQANPYTRGCS  1
            CSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  99   CSRRGASYYNCRRGAQANPYSRGCS  123



>ref|XP_008360280.1| PREDICTED: protein RALF-like 33 [Malus domestica]
Length=126

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = -1

Query  324  CVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM--D  151
            C  L    + IAS      G  L    W  +++A GG         + A   EE EM  D
Sbjct  18   CAILAAHLVAIASAVDFSGGHQLGELSWGSIRSAAGG---------LIADEDEEAEMLMD  68

Query  150  TESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +E NRRILA    YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  69   SEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>gb|KHN20413.1| hypothetical protein glysoja_039711 [Glycine soja]
Length=67

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
            EF MD+ES+RRILATS YISY ALQR   PCSRRG+SYYNC+PGA ANPYTRGC
Sbjct  5    EFGMDSESHRRILATSQYISYKALQRNTVPCSRRGASYYNCKPGADANPYTRGC  58



>gb|ABK22709.1| unknown [Picea sitchensis]
Length=122

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 67/114 (59%), Gaps = 13/114 (11%)
 Frame = -1

Query  321  VFLFIS-----CLLIASLFTVDAGGDLDM--AGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            VF F S     C+L   L    AG ++D   A W+   +    RC+GSI EC      EE
Sbjct  5    VFFFFSGVLLVCVLSTVLIEPVAGSEMDAFEALWV---SKPRPRCEGSIGECFE---DEE  58

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             +MD+E NRR LA   Y+SYGAL+  + PCSRRGSSYYNC   +QANPY R C+
Sbjct  59   MQMDSEINRRFLAGRTYVSYGALRSNSVPCSRRGSSYYNCGSTSQANPYKRSCT  112



>ref|XP_006356972.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=134

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = -1

Query  246  GWMPVKAAE-GGRCQGSIAECMAASGGEEFEMDTESNRRILA-TSNYISYGALQRGNTPC  73
            G+ P+  +     C GSI +C+A    +EF M++ES+RR+LA    YISYGAL     PC
Sbjct  44   GYFPMTLSSFSPICDGSIGDCLAEEDEDEFGMESESSRRMLAYRRRYISYGALSSNRVPC  103

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG+SYYNC+PGAQANPY RGCS
Sbjct  104  SRRGASYYNCRPGAQANPYQRGCS  127



>ref|NP_566555.1| rapid alkalinization factor 23 [Arabidopsis thaliana]
 sp|Q9LUS7.1|RLF23_ARATH RecName: Full=Rapid alkalinization factor 23; Short=AtRALF23; 
AltName: Full=Protein RALF-like 23; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB02748.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK82563.1| AT3g16570/MGL6_2 [Arabidopsis thaliana]
 gb|AAL62021.1| AT3g16570/MGL6_2 [Arabidopsis thaliana]
 gb|AAM61153.1| unknown [Arabidopsis thaliana]
 gb|AEE75839.1| rapid alkalinization factor 23 [Arabidopsis thaliana]
Length=138

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 72/121 (60%), Gaps = 17/121 (14%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAAS----GGEEF--  160
            +F  +  L + +     +    + AG  P    E   C+G+IAEC  ++    GG+ F  
Sbjct  13   IFAILLILAVHNWSVAVSSQSTEFAGDFPPFETE---CRGTIAECSVSAALGDGGDLFYG  69

Query  159  --------EMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
                    EMD+E NRRILAT  YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGC
Sbjct  70   GGEMGEEFEMDSEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGC  129

Query  3    S  1
            S
Sbjct  130  S  130



>ref|XP_008390661.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=126

 Score = 94.4 bits (233),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 63/111 (57%), Gaps = 12/111 (11%)
 Frame = -1

Query  324  CVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE--EFEMD  151
            C  L    + IAS      G  L    W  +++A GG         + A   E  E  MD
Sbjct  18   CAILAAHLVAIASAVDFSGGHQLGELSWGSIRSAAGG---------LIADEDEXAEMLMD  68

Query  150  TESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +E NRRILA    YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  69   SEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>ref|XP_009352252.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=126

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = -1

Query  324  CVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM--D  151
            C  L    + IAS      G  L    W  +++A GG         + A   E+ EM  D
Sbjct  18   CAILAAHLVAIASAVEFSGGHQLGELSWGSMRSAAGG---------LIADEDEDAEMLMD  68

Query  150  TESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +E NRRILA    YISYGAL+R   PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  69   SEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQANPYRRGCS  119



>ref|XP_004229189.1| PREDICTED: rapid alkalinization factor-like [Solanum lycopersicum]
Length=135

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -1

Query  240  MPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILA-TSNYISYGALQRGNTPCSRR  64
            M + ++    C GSI +C+A     EF M++ES+RR+LA    YISYGAL     PCSRR
Sbjct  48   MTLSSSSSPICDGSIGDCLAEEDENEFGMESESSRRMLAYRRRYISYGALSSNRVPCSRR  107

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PGAQANPY RGCS
Sbjct  108  GASYYNCRPGAQANPYQRGCS  128



>ref|XP_004962821.1| PREDICTED: rapid alkalinization factor-like [Setaria italica]
Length=117

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = -1

Query  261  DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEF-EMDTESNRRILATSNYISYGALQRG  85
            D+D+ G++   A     C+G++AEC+A    EE      ES+RRIL    YISYGAL+R 
Sbjct  25   DMDL-GFLSAGAGRR-ECRGTVAECLAEEEEEELGSASAESHRRILRGRGYISYGALRRD  82

Query  84   NTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            N PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  83   NVPCSRRGASYYNCRPGAQANPYHRGCS  110



>ref|XP_010038087.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW49886.1| hypothetical protein EUGRSUZ_K03354 [Eucalyptus grandis]
Length=117

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 15/119 (13%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASL-FTVDAG---GDLDMAGWMPVKAAEGGRCQG-SIAECMAA  178
            M N S  + +F++ L IA+   T+       DL  A +   ++     CQG SI EC   
Sbjct  1    MDNTSKRLHVFLALLAIAAFSITISCASEHADLHQASYFVWRS----ECQGDSIGECRVL  56

Query  177  SGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              GEE    TES RRILAT  YISYGAL+R + PCS+RG+SYYNC+ G Q+NPY+RGCS
Sbjct  57   --GEE----TESERRILATRQYISYGALRRNSAPCSQRGASYYNCRAGGQSNPYSRGCS  109



>ref|XP_006418288.1| hypothetical protein EUTSA_v10009124mg [Eutrema salsugineum]
 gb|ESQ36641.1| hypothetical protein EUTSA_v10009124mg [Eutrema salsugineum]
Length=122

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = -1

Query  276  VDAG--GDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISY  103
            V AG   ++D   W       G  C GSIAEC+   G EE EM++E NRRILAT+ YISY
Sbjct  26   VQAGFTSEIDGLEWT-TNGVHGSGCHGSIAECI---GAEEEEMESEINRRILATTKYISY  81

Query  102  GALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             +L+R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  82   QSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCS  115



>dbj|BAK00812.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 11/98 (11%)
 Frame = -1

Query  279  TVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMD-----TESNRRILATSN  115
            T  AGGD    G         G C+G++AEC    GGE+ E +      E++RR+L    
Sbjct  24   TSIAGGDHLQLGLFAGPGR--GECRGTVAEC----GGEDAEGELGSASAEAHRRVLQGRG  77

Query  114  YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            YISYGAL+RG  PC+RRG+SYYNC+PGAQANPY RGCS
Sbjct  78   YISYGALRRGTVPCNRRGASYYNCRPGAQANPYHRGCS  115



>ref|XP_008340810.1| PREDICTED: protein RALF-like 33 [Malus domestica]
Length=61

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             +MD+E NRRILATS YISYGAL+R   PCSRRG+SYYNC+PGA ANPY RGCS
Sbjct  1    MQMDSEINRRILATSRYISYGALRRNTIPCSRRGASYYNCRPGAPANPYRRGCS  54



>ref|XP_002874355.1| hypothetical protein ARALYDRAFT_910810 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50614.1| hypothetical protein ARALYDRAFT_910810 [Arabidopsis lyrata subsp. 
lyrata]
Length=116

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = -1

Query  342  MANASTCVFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEE  163
            M N+ T ++  ++ L+I  +  V+AG   D  G++ V+      C+GSIAE    +  EE
Sbjct  1    MVNSRT-IYAAVAILMIV-IAAVEAGSYEDALGFV-VRTGTTSNCKGSIAE--CIAEEEE  55

Query  162  FEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            FE D+E ++RILA+  YISYGA+++ N PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  56   FEFDSEISKRILASKKYISYGAMRKNNVPCSRRGASYYNCKRGAQANPYSRGCS  109



>gb|ACN40381.1| unknown [Picea sitchensis]
Length=121

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 9/111 (8%)
 Frame = -1

Query  318  FLFISCLLIASLFTVD-----AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
              F + LL+ S+ + D     AG ++D  G +   +    RC+G I EC      +E +M
Sbjct  5    IFFFAGLLLLSVLSADLIGSAAGSEMDAWGVL-WDSKPRPRCEGLIGECFEE---DEMQM  60

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRR LA   YISY AL+  + PCSRRGSSYYNC+  +QANPY R C+
Sbjct  61   DSEINRRFLAGRTYISYAALRANSVPCSRRGSSYYNCRSTSQANPYQRSCT  111



>ref|XP_010548947.1| PREDICTED: rapid alkalinization factor 23-like [Tarenaya hassleriana]
Length=134

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 16/114 (14%)
 Frame = -1

Query  297  LIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM------------  154
            +IA LF   A     + G+       G  C+GSIAEC + S G++ ++            
Sbjct  15   VIAILFISAAESTPSVGGFTGDFFPVGAECRGSIAEC-SISAGDDGDLLYGGGISAEGEE  73

Query  153  ---DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
               ++E++RRILAT  YISYGAL+RG+ PCSRRG+SYYNC+ GA ANPY+RGCS
Sbjct  74   FEMESETSRRILATRRYISYGALRRGSVPCSRRGASYYNCRRGAHANPYSRGCS  127



>ref|NP_001150599.1| LOC100284232 precursor [Zea mays]
 gb|ACG24954.1| RALF precursor [Zea mays]
 gb|ACG39706.1| RALF precursor [Zea mays]
 gb|AFW56505.1| RALF [Zea mays]
Length=118

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+G++AEC+A    EE      S+RR L    YISYGAL+R N PCSRRG+SYYNC+PG 
Sbjct  42   CRGTVAECLAEESDEEGLDLAGSHRRALYGGGYISYGALRRDNVPCSRRGASYYNCRPGG  101

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  102  QANPYHRGCS  111



>gb|KHN02967.1| hypothetical protein glysoja_009833 [Glycine soja]
 gb|KHN03361.1| hypothetical protein glysoja_004387 [Glycine soja]
Length=59

 Score = 88.6 bits (218),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  MDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            M++ESNRRILA  +YISYGAL+R   PCSRRG+SYYNC+PGAQANPY+RGCS
Sbjct  1    MESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQANPYSRGCS  52



>ref|XP_009383793.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=120

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -1

Query  327  TCVFLFISCLLIASLFTVDAGGD--LDMAGWMPVKAAEG-GRCQGSIAECMAASGGEEFE  157
            T  F  ++  LI  LF   AGG+    + GW+P+        C+G+IAEC+A   G    
Sbjct  5    TKTFPLLTVTLIFLLFITVAGGERGKGVEGWLPLGWNPSLSGCRGTIAECLA---GYNPT  61

Query  156  MDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            + +E++R +LA S YISY AL+  + PCS R +SYYNC+PGA+ NPY R CS
Sbjct  62   LGSEASRHVLANSIYISYNALRWDSVPCSSRDASYYNCRPGAEVNPYVRSCS  113



>gb|ABK25798.1| unknown [Picea sitchensis]
 gb|ACN41181.1| unknown [Picea sitchensis]
Length=121

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 9/111 (8%)
 Frame = -1

Query  318  FLFISCLLIASLFTVD-----AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEM  154
              F + LL+ S+ + D     AG ++D  G +   +    RC+G I EC      +E +M
Sbjct  5    IFFFAGLLLLSVLSADLIGSAAGSEMDAWGVL-WDSKPRPRCEGLIGECFEE---DEMQM  60

Query  153  DTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            D+E NRR LA   YISY AL+  + PCS+RGSSYYNC+  +QANPY R C+
Sbjct  61   DSEINRRFLAGRTYISYAALRANSVPCSKRGSSYYNCRSTSQANPYQRSCT  111



>gb|KDO71638.1| hypothetical protein CISIN_1g032876mg [Citrus sinensis]
Length=122

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 61/99 (62%), Gaps = 20/99 (20%)
 Frame = -1

Query  276  VDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGE-------EFEMDTESNRRILATS  118
            VD  G     G++PVK+     C+GSIAECM+  G +       EF MD E NRRILA  
Sbjct  30   VDFDGLGHQLGFIPVKS----ECRGSIAECMSVEGDDGDQELDLEFAMDGEINRRILA--  83

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
                   ++R + PCSRRG+SYYNC+ G QANPY+RGCS
Sbjct  84   -------MRRNSVPCSRRGASYYNCRAGGQANPYSRGCS  115



>ref|XP_010449887.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=122

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = -1

Query  297  LIASLFTVD--------AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            +I ++ TV+        A     +  +MP+  +   RC GSIAEC  +S   E       
Sbjct  11   IITAILTVNFLLTTSATATSQSSVGVFMPITES---RCTGSIAECSLSSSESEEFEMDSE  67

Query  141  -NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             NRRILAT+ YISYGAL+R   PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  68   INRRILATTKYISYGALKRNTVPCSRRGASYYNCRRGAQANPYSRGCS  115



>gb|EAY83408.1| hypothetical protein OsI_38624 [Oryza sativa Indica Group]
Length=127

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = -1

Query  219  GGRCQGSIAECMAASG--GEEFEMDT---ESNRRILATSNYISYGALQRGNTPCSRRGSS  55
            GG C+G++ EC+      GEE E+ +   E++RR+LA   YISY +L+R + PCSRRG+S
Sbjct  43   GGECRGTVGECLEGGDVDGEEGELGSASGEAHRRVLAGRGYISYQSLRRDSVPCSRRGAS  102

Query  54   YYNCQPGAQANPYTRGCS  1
            YYNC+PGA ANPY RGCS
Sbjct  103  YYNCRPGASANPYHRGCS  120



>ref|NP_001066957.1| Os12g0541700 [Oryza sativa Japonica Group]
 gb|ABA99460.1| Rapid ALkalinization Factor family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29976.1| Os12g0541700 [Oryza sativa Japonica Group]
 gb|EAZ20770.1| hypothetical protein OsJ_36394 [Oryza sativa Japonica Group]
 dbj|BAG96073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=127

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = -1

Query  219  GGRCQGSIAECMAASG--GEEFEMDT---ESNRRILATSNYISYGALQRGNTPCSRRGSS  55
            GG C+G++ EC+      GEE E+ +   E++RR+LA   YISY +L+R + PCSRRG+S
Sbjct  43   GGECRGTVGECLEGGDVDGEEGELGSASGEAHRRVLAGRGYISYQSLRRDSVPCSRRGAS  102

Query  54   YYNCQPGAQANPYTRGCS  1
            YYNC+PGA ANPY RGCS
Sbjct  103  YYNCRPGASANPYHRGCS  120



>ref|XP_002459740.1| hypothetical protein SORBIDRAFT_02g009700 [Sorghum bicolor]
 gb|EER96261.1| hypothetical protein SORBIDRAFT_02g009700 [Sorghum bicolor]
Length=127

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 61/93 (66%), Gaps = 8/93 (9%)
 Frame = -1

Query  261  DLDMAGWMPVKAAEGGRCQG-SIAECMAASGGEEFEMD-----TESNRRILATSNYISYG  100
            DLD+  ++   A     C+G ++ EC+A    E  ++D      +S+RR L    YISY 
Sbjct  30   DLDLGSFL-SSAGRREECRGGTVGECLAEDP-EPLDLDLAGASADSHRRALYGGGYISYR  87

Query  99   ALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ALQRGN PCSRRG+SYYNC+PGAQANPY RGCS
Sbjct  88   ALQRGNVPCSRRGASYYNCRPGAQANPYHRGCS  120



>gb|AGT16384.1| hypothetical protein SHCRBa_052_I12_R_250 [Saccharum hybrid cultivar 
R570]
Length=190

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 8/81 (10%)
 Frame = -1

Query  219  GGR---CQGSIAECMAASG-----GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRR  64
            GGR   C+G++AEC+A +      G +     ES+RR L    YISYGAL+R N PCSRR
Sbjct  103  GGRRRECRGTVAECLAEASESEEEGLDLVSSAESHRRALYGGGYISYGALRRDNVPCSRR  162

Query  63   GSSYYNCQPGAQANPYTRGCS  1
            G+SYYNC+PG QANPY RGCS
Sbjct  163  GASYYNCRPGGQANPYHRGCS  183



>gb|AGT16335.1| hypothetical protein SHCRBa_256_D11_F_160 [Saccharum hybrid cultivar 
R570]
 gb|AGT17389.1| hypothetical protein SHCRBa_176_L06_R_120 [Saccharum hybrid cultivar 
R570]
Length=281

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 57/84 (68%), Gaps = 8/84 (10%)
 Frame = -1

Query  228  AAEGGR---CQGSIAECMAASG-----GEEFEMDTESNRRILATSNYISYGALQRGNTPC  73
            +  GGR   C+G++AEC+A +      G +     ES+RR L    YISYGAL+R N PC
Sbjct  191  SPPGGRRRECRGTVAECLAEASESEEEGLDLVSSAESHRRALYGGGYISYGALRRDNVPC  250

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG+SYYNC+PG QANPY RGCS
Sbjct  251  SRRGASYYNCRPGGQANPYHRGCS  274



>gb|EPS62616.1| hypothetical protein M569_12176, partial [Genlisea aurea]
Length=112

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 10/107 (9%)
 Frame = -1

Query  309  ISCLLIASLFTVD---AGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESN  139
            + C++ A++  +    AG D ++    P+ +   G C+G++ EC+   GG EFE+D+E+N
Sbjct  6    LVCVIAAAILLLSDFSAGADPELWVMGPLNS---GGCKGTVGECL---GGGEFELDSETN  59

Query  138  RR-ILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RR +L T  YI Y ALQ+   PC+ RG+ YYNC+ G QANPY R C+
Sbjct  60   RRRVLFTRRYIGYDALQKDAVPCALRGAPYYNCRQGGQANPYYRSCN  106



>ref|XP_003575694.1| PREDICTED: rapid alkalinization factor-like [Brachypodium distachyon]
Length=129

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  171  GEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            GE      E++RRILA   YISYGAL+RG  PC+RRG+SYYNC+PGAQANPY RGCS
Sbjct  66   GELGSASAEAHRRILAGRGYISYGALRRGTVPCNRRGASYYNCRPGAQANPYHRGCS  122



>ref|XP_010524533.1| PREDICTED: rapid alkalinization factor 23-like [Tarenaya hassleriana]
Length=138

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 61/96 (64%), Gaps = 19/96 (20%)
 Frame = -1

Query  243  WMPVKAAEGGRCQGSIAECMAASGGEEFEMDTE---------------SNRRILATSNYI  109
            + P++     +C GS+A+C  ++G  +     E               ++RRILAT  YI
Sbjct  40   FFPIET----KCLGSMAQCSISAGDGDLLYGGEISDASEEMEMEMESETSRRILATRRYI  95

Query  108  SYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            SYGAL+RG+ PCSRRG+SYYNC+ GAQANPY+RGCS
Sbjct  96   SYGALRRGSVPCSRRGASYYNCRRGAQANPYSRGCS  131



>ref|XP_010546717.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A    EE E+D+E +RRILAT+ YISYGALQR + PCSRRG+SYYNC+ GA
Sbjct  43   CRGSIAECLAEE--EELELDSEISRRILATNKYISYGALQRNSVPCSRRGASYYNCRRGA  100

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  101  QANPYSRGCS  110



>ref|XP_002280202.1| PREDICTED: protein RALF-like 19 [Vitis vinifera]
Length=128

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 67/113 (59%), Gaps = 8/113 (7%)
 Frame = -1

Query  321  VFLFISCLLIASLFTV--DAGGD--LDMAGWMPVKAAEG-GRCQGSIAECMAASGGEEFE  157
            +FL +   L+   F+   D+  D  + +     V A +G   C G++ +C+     +E  
Sbjct  8    IFLHLGFALVVESFSFADDSWDDSQIQLVDGTQVNATDGFAPCDGAVGDCINED--DEMM  65

Query  156  MDTESNRRILATSN-YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            MD+E+NRR LA    YISYGAL+R   PC+RRG SYYNC+ G +ANPY RGCS
Sbjct  66   MDSETNRRSLAQRRRYISYGALRRNQVPCNRRGRSYYNCRRGGRANPYRRGCS  118



>gb|AGT16104.1| hypothetical protein SHCRBa_134_J05_F_340 [Saccharum hybrid cultivar 
R570]
 gb|AGT16492.1| rapid alkalinization factor 1 precursor [Saccharum hybrid cultivar 
R570]
Length=137

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 13/99 (13%)
 Frame = -1

Query  264  GDL--DMAGWMPVKAAEGGR-CQGSIAECMAASGGE-EFEMDTE------SNRRIL-ATS  118
            GDL   +AG + ++   GGR C+G++ ECM   G + E E D        S RR+L   S
Sbjct  34   GDLAAHLAGAVVIR--RGGRTCRGTVGECMEYFGADAEGEADVAGMATGGSKRRVLQGGS  91

Query  117  NYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             YI Y AL+R N PCS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  92   GYIGYDALRRDNVPCSQRGASYYNCQPGAEANPYSRGCS  130



>ref|XP_002882418.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58677.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            V   ++ ++ A   T D G  LD           G  C GSIAEC+A     EF  D+E 
Sbjct  9    VIAILAIVISAVESTGDFGDSLDFVRTGSSSLFSG--CTGSIAECIAEEEEMEF--DSEI  64

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +RRILA   YISYGA++R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  65   SRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCS  111



>ref|XP_010440247.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=122

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -1

Query  213  RCQGSIAECMAASGGEEFEMDTES---NRRILATSNYISYGALQRGNTPCSRRGSSYYNC  43
            RC GSIAEC   S   E E        NRRILAT+ YISYGAL+R   PCSRRG+SYYNC
Sbjct  42   RCTGSIAECSLLSSSSEEEEFEMDSEINRRILATTKYISYGALKRNTVPCSRRGASYYNC  101

Query  42   QPGAQANPYTRGCS  1
            + GAQANPY+RGCS
Sbjct  102  RRGAQANPYSRGCS  115



>ref|NP_566253.1| protein RALF-like 22 [Arabidopsis thaliana]
 sp|Q9MA62.1|RLF22_ARATH RecName: Full=Protein RALF-like 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF64534.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67020.1| RALF precursor [Arabidopsis thaliana]
 gb|AAO22595.1| unknown protein [Arabidopsis thaliana]
 gb|ABD38901.1| At3g05490 [Arabidopsis thaliana]
 gb|AEE74248.1| protein RALF-like 22 [Arabidopsis thaliana]
Length=119

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTES  142
            V   ++ ++ A   T D G  LD           G  C GSIAEC+A     EF  D++ 
Sbjct  10   VIAILAIVISAVESTGDFGDSLDFVRAGSSSLFSG--CTGSIAECIAEEEEMEF--DSDI  65

Query  141  NRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +RRILA   YISYGA++R + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  66   SRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPYSRGCS  112



>ref|XP_002457590.1| hypothetical protein SORBIDRAFT_03g009900 [Sorghum bicolor]
 gb|EES02710.1| hypothetical protein SORBIDRAFT_03g009900 [Sorghum bicolor]
Length=142

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 14/100 (14%)
 Frame = -1

Query  264  GDL---DMAGWMPVKAAEGGR-CQGSIAECMAASGGE-EFEMDTE------SNRRIL-AT  121
            GDL    +AG + ++   GGR C+G++ ECM   G + E E D        S RR+L   
Sbjct  38   GDLAVAHLAGAVVIR--RGGRTCRGTVGECMEYLGADAEGEADVAGMATGGSKRRVLQGG  95

Query  120  SNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            S YI Y AL+R N PCS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  96   SGYIGYDALRRDNVPCSQRGASYYNCQPGAEANPYSRGCS  135



>ref|XP_006408069.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
 gb|ESQ49522.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
Length=119

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = -1

Query  273  DAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGAL  94
            D GG LD           G  C+GSIAEC+A     EF  D+E +RRILA   Y+SYGA+
Sbjct  26   DFGGSLDFVRTGSSSLFSG--CKGSIAECIAEEEEMEF--DSEISRRILAQKKYVSYGAM  81

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ++ + PCSRRG+SYYNC+ GAQANPY RGCS
Sbjct  82   RKNSVPCSRRGASYYNCRRGAQANPYRRGCS  112



>ref|XP_010272745.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 33 [Nelumbo 
nucifera]
Length=59

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  156  MDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            M +E N RILATS YISYGAL R   PCSRRG+SYYNC+ GAQANPY RGC+
Sbjct  1    MASEINHRILATSXYISYGALXRNTVPCSRRGASYYNCKHGAQANPYNRGCN  52



>ref|XP_010550987.1| PREDICTED: protein RALF-like 22 [Tarenaya hassleriana]
Length=117

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A    EE E+D+E +RRILA + YISYGALQR + PCSRRG+SYYNC+ GA
Sbjct  43   CRGSIAECLAEE--EELELDSEISRRILAMNRYISYGALQRNSVPCSRRGASYYNCRRGA  100

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  101  QANPYSRGCS  110



>ref|XP_010247579.1| PREDICTED: protein RALF-like 24 [Nelumbo nucifera]
Length=134

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -1

Query  234  VKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSS  55
            ++A     C G I EC+ A+  E  EMD+E+NRR+L    YISY +L++   PCSR GSS
Sbjct  44   IEAMVSRPCTGKINECLWATKMEA-EMDSETNRRMLMMQKYISYESLKQDIVPCSRPGSS  102

Query  54   YYNCQPGAQANPYTRGC  4
            YYNC P  +ANPY RGC
Sbjct  103  YYNCPPMGRANPYNRGC  119



>emb|CDY40711.1| BnaC03g34270D [Brassica napus]
Length=118

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D+E +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  44   CEGSIAECIAEEEEMEF--DSEISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  101

Query  30   QANPYTRGCS  1
            QANPY+RGCS
Sbjct  102  QANPYSRGCS  111



>ref|NP_001150875.1| RALF precursor [Zea mays]
 gb|ACG40735.1| RALF precursor [Zea mays]
Length=126

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 51/77 (66%), Gaps = 7/77 (9%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEF---EMDTESNRRIL----ATSNYISYGALQRGNTPCSRRGSSY  52
            C+G++AEC+    G +        ES+RR L        YISYGAL+R N PCSRRG+SY
Sbjct  43   CRGTVAECLDEEEGLDLGAGPASVESHRRALYGGGGGGGYISYGALRRDNVPCSRRGASY  102

Query  51   YNCQPGAQANPYTRGCS  1
            YNC+PG QANPY RGCS
Sbjct  103  YNCRPGGQANPYHRGCS  119



>ref|XP_009124021.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
Length=119

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 10/115 (9%)
 Frame = -1

Query  330  STCVFLFISCLLIASLFTVDAGG-----DLDMAGWMPVKAAEGGRCQGSIAECMAASGGE  166
            S  ++  I+ L I  + +VDA G      LD           G  C+GSIAEC+A     
Sbjct  3    SRAIYAVIALLAIV-ISSVDASGFSFGHSLDFVRTGSSSLFSG--CEGSIAECIAEEEEM  59

Query  165  EFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GAQANPY+RGCS
Sbjct  60   EF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYSRGCS  112



>gb|EPS72954.1| rapid alkalinization factor [Genlisea aurea]
Length=100

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            EE  MD+E++RR LA  NYISYGAL+R   PCSRRG SYYNC+   +ANPY RGC+
Sbjct  35   EELMMDSEASRRQLAAGNYISYGALRRNRVPCSRRGHSYYNCRASGRANPYRRGCT  90



>gb|EPS64652.1| rapid alkalinization factor, partial [Genlisea aurea]
Length=67

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -1

Query  168  EEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
             EF M +ES+RR LA  NYISYGAL R   PCSRRGSSYYNC+ G +ANPYTR C+
Sbjct  4    REFAMGSESDRRQLAAGNYISYGALNRDRIPCSRRGSSYYNCRGGRKANPYTRSCT  59



>gb|KFK31007.1| hypothetical protein AALP_AA6G056400 [Arabis alpina]
Length=110

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 60/106 (57%), Gaps = 7/106 (7%)
 Frame = -1

Query  315  LFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
            + I  L+I  L T+    +   A W   K+   G  QG    C+    G E  MD+E+NR
Sbjct  1    MAIKFLMILGLLTLVVVAESANATWGLTKSCVNG--QG----CIGDDDGLESLMDSETNR  54

Query  135  RILATSN-YISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            R LA    YISYGAL++ N PCSRRG SYY+C    +ANPY RGCS
Sbjct  55   RQLAARRTYISYGALKKNNVPCSRRGRSYYDCNKRKRANPYRRGCS  100



>emb|CDO99525.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C G + +C+  +  EE  +D+E++RR+LA + YISY AL+RGN PCSRRGSSYYNC    
Sbjct  47   CNGRVGDCIDEA--EEMMLDSEASRRVLAQTRYISYDALRRGNIPCSRRGSSYYNCGSHQ  104

Query  30   QANPYTRGCS  1
            + NPY+ GC+
Sbjct  105  KINPYSGGCT  114



>gb|KFK37938.1| hypothetical protein AALP_AA3G049600 [Arabis alpina]
Length=117

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 6/104 (6%)
 Frame = -1

Query  309  ISCLLIASL-FTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRR  133
            I  ++IA++  TVD    LD   ++   ++    C+GSIAEC+A     EF  D++ +RR
Sbjct  12   ILAIVIANVESTVDFTDSLD---FVRTGSSLFSGCKGSIAECIAEEEEMEF--DSDISRR  66

Query  132  ILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ILA   Y+SYGA+++ + PCSRRG+SYYNCQ GAQANPY RGCS
Sbjct  67   ILAQKRYVSYGAMKKNSVPCSRRGASYYNCQRGAQANPYRRGCS  110



>ref|XP_010485998.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=123

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  49   CKGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  106

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  107  QANPYRRGCS  116



>ref|XP_010428004.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=126

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  52   CKGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  109

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  110  QANPYRRGCS  119



>ref|XP_010464074.1| PREDICTED: protein RALF-like 22 [Camelina sativa]
Length=122

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  48   CKGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  105

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  106  QANPYRRGCS  115



>emb|CDY18799.1| BnaAnng02640D [Brassica napus]
Length=119

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = -1

Query  300  LLIASLFTVDAGG-----DLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNR  136
            LL   + +VDA G      LD           G  C+GSIAEC+A     EF  D++ +R
Sbjct  12   LLAIVISSVDASGFSFGHSLDFVRTGSSSLFSG--CEGSIAECIAEEEEMEF--DSDISR  67

Query  135  RILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            RILA   Y+SYGA+++ + PCSRRG+SYYNCQ GAQANPY RGCS
Sbjct  68   RILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPYRRGCS  112



>ref|NP_001042630.1| Os01g0257100 [Oryza sativa Japonica Group]
 dbj|BAA85220.1| putative RALF precursor [Oryza sativa Japonica Group]
 dbj|BAB07979.1| putative RALF precursor [Oryza sativa Japonica Group]
 dbj|BAF04544.1| Os01g0257100 [Oryza sativa Japonica Group]
 gb|EAZ11299.1| hypothetical protein OsJ_01158 [Oryza sativa Japonica Group]
 dbj|BAH01501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = -1

Query  252  MAGWMPVKAAEGGR-CQGSIAECMA-----ASGGEEFEMDTESNRRIL-ATSNYISYGAL  94
            + G   V    GGR C+G++ ECM        G +E        RR+L   S YI Y AL
Sbjct  34   VVGRAAVVMRRGGRTCRGTVGECMEFLGVDGEGEDELAAAATGKRRVLQGGSGYIGYDAL  93

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +R + PCS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  94   RRDSVPCSQRGASYYNCQPGAEANPYSRGCS  124



>gb|EAY73360.1| hypothetical protein OsI_01239 [Oryza sativa Indica Group]
Length=131

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = -1

Query  252  MAGWMPVKAAEGGR-CQGSIAECMA-----ASGGEEFEMDTESNRRIL-ATSNYISYGAL  94
            + G   V    GGR C+G++ ECM        G +E        RR+L   S YI Y AL
Sbjct  34   VVGRAAVVMRRGGRTCRGTVGECMEYLGVDGEGEDELAAAATGKRRVLQGGSGYIGYDAL  93

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            +R + PCS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  94   RRDSVPCSQRGASYYNCQPGAEANPYSRGCS  124



>ref|XP_003566535.1| PREDICTED: rapid alkalinization factor-like [Brachypodium distachyon]
Length=130

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 54/79 (68%), Gaps = 6/79 (8%)
 Frame = -1

Query  219  GGR-CQGSIAECMAASG----GEEFEMDTESNRRILAT-SNYISYGALQRGNTPCSRRGS  58
            GGR C+G++ ECM   G    GEE        RR+L   S YI Y AL+R + PCS+RG+
Sbjct  45   GGRTCRGTVGECMEFFGVDGEGEEEVAAMAGKRRVLQDGSGYIGYDALKRDSVPCSQRGA  104

Query  57   SYYNCQPGAQANPYTRGCS  1
            SYYNCQPGA+ANPY+RGCS
Sbjct  105  SYYNCQPGAEANPYSRGCS  123



>emb|CDY18779.1| BnaAnng02440D [Brassica napus]
Length=119

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  45   CEGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  102

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  103  QANPYRRGCS  112



>ref|XP_006298819.1| hypothetical protein CARUB_v10014925mg [Capsella rubella]
 gb|EOA31717.1| hypothetical protein CARUB_v10014925mg [Capsella rubella]
Length=125

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  51   CKGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  108

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  109  QANPYRRGCS  118



>ref|XP_009134826.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
 emb|CDX74145.1| BnaA03g29020D [Brassica napus]
Length=118

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = -1

Query  210  CQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGA  31
            C+GSIAEC+A     EF  D++ +RRILA   Y+SYGA+++ + PCSRRG+SYYNCQ GA
Sbjct  44   CEGSIAECIAEEEEMEF--DSDISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGA  101

Query  30   QANPYTRGCS  1
            QANPY RGCS
Sbjct  102  QANPYRRGCS  111



>ref|XP_004967815.1| PREDICTED: protein RALF-like 22-like [Setaria italica]
Length=135

 Score = 81.6 bits (200),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 19/102 (19%)
 Frame = -1

Query  264  GDLDMAGWMPVKAAEGGR-CQGSIAECMAASGGEEFEMDTE------------SNRRIL-  127
            GDL     +  + + GGR C+G++ ECM     E  ++D E            S RR+L 
Sbjct  32   GDLASELLVVRRGSSGGRACRGTVGECM-----EYADVDAEGEGDVAGMATGGSKRRVLQ  86

Query  126  ATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
              S YI Y AL+R N PCS+RG+SYYNCQPGA+ANPY+RGC+
Sbjct  87   GGSGYIGYDALRRDNVPCSQRGASYYNCQPGAEANPYSRGCN  128



>emb|CDJ26443.1| unnamed protein product [Triticum aestivum]
Length=133

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 16/85 (19%)
 Frame = -1

Query  222  EGGR-CQGSIAECMAASGGEEFEMDTES---------NRRILAT-SNYISYGALQRGNTP  76
             GGR C+G++ ECM     E F +D E           RR+L   S YI Y AL+R N P
Sbjct  47   RGGRTCRGTVGECM-----EYFGVDGEGEGEVAAMAGKRRVLQDGSGYIGYDALRRDNVP  101

Query  75   CSRRGSSYYNCQPGAQANPYTRGCS  1
            CS+RG+SYYNCQPGA+ANPY+RGCS
Sbjct  102  CSQRGASYYNCQPGAEANPYSRGCS  126



>ref|XP_009147231.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 22 [Brassica 
rapa]
Length=119

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 4/91 (4%)
 Frame = -1

Query  273  DAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATSNYISYGAL  94
            D GG LD           G  C+GSIAEC+A     EF  D++ +RRILA   Y+S GA+
Sbjct  26   DFGGSLDFVRTGSSSLFSG--CKGSIAECIAEEEEMEF--DSDISRRILAQKKYVSXGAM  81

Query  93   QRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            ++ + PCSRRG+SYYNCQ GAQANPY RGCS
Sbjct  82   RKNSVPCSRRGASYYNCQRGAQANPYRRGCS  112



>ref|XP_009373554.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 24 [Pyrus x 
bretschneideri]
Length=152

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 12/109 (11%)
 Frame = -1

Query  321  VFLFISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGR--CQGSIAECMAASGGEEFEMDT  148
            +  ++S LLI + F +  G  L  +G   ++AA  GR  C   + ECM      E EM++
Sbjct  43   LIFYVSLLLIHTHFPICNGVSLKGSG---IEAAMAGRSGCSEKLGECMT-----EPEMES  94

Query  147  ESNRRILA-TSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGC  4
            ES+RRILA  + YISYG L+R + PC   G+SYYNC     ANPY RGC
Sbjct  95   ESSRRILAMQTKYISYGTLKRDSVPCGTPGASYYNCH-AVAANPYNRGC  142



>dbj|BAK04479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=137

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 16/84 (19%)
 Frame = -1

Query  219  GGR-CQGSIAECMAASGGEEFEMDTES---------NRRIL-ATSNYISYGALQRGNTPC  73
            GGR C+G++ ECM     E F +D E           RR+L   S YI Y AL+R N PC
Sbjct  52   GGRTCRGTVGECM-----EYFGVDGEGEGEVAAMAGKRRVLQGGSGYIGYDALRRDNVPC  106

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            S RG+SYYNCQPGA+ANPY+RGCS
Sbjct  107  SERGASYYNCQPGAEANPYSRGCS  130



>ref|NP_001043013.1| Os01g0358100 [Oryza sativa Japonica Group]
 dbj|BAB63645.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC10728.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04927.1| Os01g0358100 [Oryza sativa Japonica Group]
 gb|EAY73995.1| hypothetical protein OsI_01879 [Oryza sativa Indica Group]
 gb|EAY73998.1| hypothetical protein OsI_01882 [Oryza sativa Indica Group]
 gb|EAZ11861.1| hypothetical protein OsJ_01735 [Oryza sativa Japonica Group]
 dbj|BAG97138.1| unnamed protein product [Oryza sativa Japonica Group]
Length=116

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  174  GGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            G E  +  T   RR+L   +YISYGAL+R  TPCS RG+SYYNCQPGA+ANPY+RGCS
Sbjct  52   GEEAADSATAVVRRVLQQGSYISYGALRRDTTPCSVRGASYYNCQPGAEANPYSRGCS  109



>ref|NP_850219.1| protein RALF-like 19 [Arabidopsis thaliana]
 sp|Q6NME6.1|RLF19_ARATH RecName: Full=Protein RALF-like 19; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAS49077.1| At2g33775 [Arabidopsis thaliana]
 gb|AEC08883.1| protein RALF-like 19 [Arabidopsis thaliana]
Length=110

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 7/84 (8%)
 Frame = -1

Query  249  AGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS-NYISYGALQRGNTPC  73
            A W   K+   G  QG    C+   G  ++ MD+E+NRR LA   +YISYGAL++ N PC
Sbjct  23   ATWTLTKSCVNG--QG----CIGEDGELDYLMDSETNRRQLAARRSYISYGALRKNNVPC  76

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG SYY+C+   +ANPY RGCS
Sbjct  77   SRRGRSYYDCKKRKRANPYRRGCS  100



>ref|XP_010549330.1| PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]
Length=110

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 59/104 (57%), Gaps = 7/104 (7%)
 Frame = -1

Query  309  ISCLLIASLFTVDAGGDLDMAGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRI  130
            +  L + +L T+    +   A W   K+   G  +G    C+    G E  MD+E+NRR 
Sbjct  3    LKLLFVFALLTLAMVAESANASWPLTKSCVNG--EG----CIGDEDGVETLMDSETNRRQ  56

Query  129  LAT-SNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPYTRGCS  1
            LA    YISYGAL++ N PCSRRG SYY+C+   + NPY RGCS
Sbjct  57   LAQGRRYISYGALRKNNVPCSRRGRSYYDCRRRKRVNPYRRGCS  100



>ref|XP_002879470.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55729.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 7/84 (8%)
 Frame = -1

Query  249  AGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS-NYISYGALQRGNTPC  73
            A W   K+   G  QG    C+   G  ++ MD+E+NRR LA   +YISYGAL++ N PC
Sbjct  23   ATWTLTKSCVNG--QG----CIGEDGELDYLMDSETNRRQLAARRSYISYGALRKNNVPC  76

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG SYY+C+   +ANPY RGCS
Sbjct  77   SRRGRSYYDCKKRKRANPYRRGCS  100



>ref|XP_004502245.1| PREDICTED: protein RALF-like 24-like [Cicer arietinum]
 ref|XP_004502246.1| PREDICTED: protein RALF-like 24-like [Cicer arietinum]
Length=132

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = -1

Query  261  DLDMAGWMPVKAAEGGR-CQGSIAECMAASGGEEFEMDTESNRRILA-TSNYISYGALQR  88
            DL++     +      R C  SI EC+      E EMD+E+NRR+LA    YISY  L+R
Sbjct  36   DLNLLKHSEIDTVITKRVCTKSIGECLT-----EPEMDSETNRRVLAMQKKYISYDTLKR  90

Query  87   GNTPCSRRGSSYYNCQPGAQANPYTRGC  4
               PC R G+SYYNC P  QANPY+RGC
Sbjct  91   DMVPCDRAGASYYNCHP-RQANPYSRGC  117



>ref|XP_006410523.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
 gb|ESQ51976.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
Length=110

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 53/84 (63%), Gaps = 7/84 (8%)
 Frame = -1

Query  249  AGWMPVKAAEGGRCQGSIAECMAASGGEEFEMDTESNRRILATS-NYISYGALQRGNTPC  73
            A W   K+   G  QG    C+    G E  MD+E+NRR LA   +YISYGAL++ N PC
Sbjct  23   ATWTLTKSCVNG--QG----CIGDDDGLESLMDSETNRRQLAARRSYISYGALKKNNVPC  76

Query  72   SRRGSSYYNCQPGAQANPYTRGCS  1
            SRRG SYY+C+   +ANPY RGCS
Sbjct  77   SRRGRSYYDCKKRKRANPYRRGCS  100



>ref|XP_010526512.1| PREDICTED: protein RALF-like 4 [Tarenaya hassleriana]
Length=102

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  195  AECMAASGGEEFEMDTESNRRILATSNYISYGALQRGNTPCSRRGSSYYNCQPGAQANPY  16
              C A SG    E  TE +RRIL  + YISY AL+R N PC+RRG SYYNC PG   NPY
Sbjct  28   VRCSALSGDCVKEEATEMSRRILKGTRYISYDALKRNNIPCNRRGRSYYNCGPGGPVNPY  87

Query  15   TRGCS  1
             RGCS
Sbjct  88   HRGCS  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514511713122