BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4792_g1_i2 len=2582 path=[201:0-1702 93:1703-2581]

Length=2582
                                                                      Score     E

ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like        1297   0.0     
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like        1289   0.0     
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like        1276   0.0     
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like        1270   0.0     
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7             1262   0.0     
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1              1259   0.0     
gb|KHG17686.1|  Oligopeptide transporter 7                             1257   0.0     
gb|KHG17687.1|  Oligopeptide transporter 7                             1255   0.0     
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7             1251   0.0     Vitis vinifera
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g            1249   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002518892.1|  Oligopeptide transporter, putative                1243   0.0     Ricinus communis
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like        1242   0.0     
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like        1236   0.0     
gb|KDP25233.1|  hypothetical protein JCGZ_20389                        1232   0.0     
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7             1227   0.0     
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7             1226   0.0     
emb|CDP12213.1|  unnamed protein product                               1226   0.0     
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...   1222   0.0     
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like        1217   0.0     
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...   1217   0.0     
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg            1216   0.0     
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...   1215   0.0     
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7-like        1215   0.0     
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like        1214   0.0     
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...   1209   0.0     
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                   1204   0.0     
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7             1203   0.0     
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg            1202   0.0     
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like        1202   0.0     
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7             1201   0.0     
gb|AES71704.2|  oligopeptide transporter OPT family protein            1201   0.0     
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg            1201   0.0     
ref|XP_003601453.1|  Oligopeptide transporter                          1201   0.0     
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like        1199   0.0     
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...   1198   0.0     
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg            1198   0.0     
ref|XP_002874647.1|  ATOPT7                                            1196   0.0     
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg            1195   0.0     
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like        1194   0.0     
gb|EPS60258.1|  hypothetical protein M569_14546                        1194   0.0     
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like        1192   0.0     
emb|CBI34570.3|  unnamed protein product                               1192   0.0     
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7             1189   0.0     
ref|NP_192815.1|  oligopeptide transporter 7                           1186   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EEC79904.1|  hypothetical protein OsI_21444                         1182   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like        1182   0.0     
emb|CDX86844.1|  BnaA09g22340D                                         1181   0.0     
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7             1180   0.0     
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like        1179   0.0     
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...   1177   0.0     
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like        1177   0.0     
dbj|BAD67732.1|  putative sexual differentiation process protein ...   1176   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like        1175   0.0     
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...   1175   0.0     
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530         1174   0.0     Sorghum bicolor [broomcorn]
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7             1174   0.0     
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like        1172   0.0     
gb|KCW77331.1|  hypothetical protein EUGRSUZ_D01692                    1168   0.0     
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g            1166   0.0     
ref|NP_001130398.1|  uncharacterized protein LOC100191494              1165   0.0     Zea mays [maize]
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...   1164   0.0     
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7             1157   0.0     
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like        1152   0.0     
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like        1147   0.0     
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...   1145   0.0     
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like        1145   0.0     
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000         1142   0.0     
ref|NP_001056665.1|  Os06g0127700                                      1138   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like        1134   0.0     
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like        1132   0.0     
gb|EMS45172.1|  Oligopeptide transporter 7                             1131   0.0     
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like        1130   0.0     
gb|EMT07894.1|  Oligopeptide transporter 7                             1126   0.0     
dbj|BAJ85948.1|  predicted protein                                     1126   0.0     
ref|NP_001056651.1|  Os06g0125500                                      1125   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like        1122   0.0     
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like        1114   0.0     
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like        1113   0.0     
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...   1110   0.0     
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...   1109   0.0     
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like        1106   0.0     
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like        1105   0.0     
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...   1104   0.0     
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein               1103   0.0     
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like        1098   0.0     
ref|XP_010090590.1|  Oligopeptide transporter 7                        1096   0.0     
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...   1095   0.0     
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like        1094   0.0     
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1              1090   0.0     
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...   1090   0.0     
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990         1090   0.0     
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like        1089   0.0     
ref|XP_002436389.1|  hypothetical protein SORBIDRAFT_10g001670         1089   0.0     Sorghum bicolor [broomcorn]
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g            1088   0.0     
gb|KDP46770.1|  hypothetical protein JCGZ_06558                        1087   0.0     
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like        1085   0.0     
ref|XP_002529653.1|  Oligopeptide transporter, putative                1083   0.0     Ricinus communis
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like        1083   0.0     
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like        1082   0.0     
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like        1081   0.0     
emb|CDP01884.1|  unnamed protein product                               1079   0.0     
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg            1079   0.0     
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...   1078   0.0     
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like        1077   0.0     
emb|CDY25261.1|  BnaA02g21950D                                         1075   0.0     
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...   1070   0.0     
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg            1068   0.0     
gb|EMS65129.1|  Oligopeptide transporter 7                             1068   0.0     
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like        1067   0.0     
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg               1063   0.0     
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like        1063   0.0     
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg               1063   0.0     
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like        1061   0.0     
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like        1060   0.0     
ref|XP_009773685.1|  PREDICTED: oligopeptide transporter 7-like i...   1058   0.0     
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like        1058   0.0     
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g            1057   0.0     
gb|KGN48927.1|  hypothetical protein Csa_6G506530                      1056   0.0     
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g            1047   0.0     
dbj|BAJ95761.1|  predicted protein                                     1045   0.0     
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like        1039   0.0     
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g            1038   0.0     
gb|EPS62495.1|  hypothetical protein M569_12295                        1035   0.0     
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like        1029   0.0     
dbj|BAJ87692.1|  predicted protein                                     1029   0.0     
ref|XP_009773686.1|  PREDICTED: oligopeptide transporter 7-like i...   1027   0.0     
dbj|BAJ85522.1|  predicted protein                                     1027   0.0     
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like        1026   0.0     
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like        1022   0.0     Vitis vinifera
ref|XP_010113336.1|  Oligopeptide transporter 7                        1021   0.0     
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6             1020   0.0     
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like        1016   0.0     
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like        1013   0.0     
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like        1012   0.0     
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g            1012   0.0     
gb|KDP42149.1|  hypothetical protein JCGZ_03016                        1010   0.0     
ref|XP_006441174.1|  hypothetical protein CICLE_v10019012mg            1009   0.0     
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g            1009   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010109222.1|  Oligopeptide transporter 6                        1008   0.0     
ref|XP_006491962.1|  PREDICTED: oligopeptide transporter 9-like        1008   0.0     
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like        1006   0.0     
ref|XP_003628537.1|  Oligopeptide transporter                          1006   0.0     
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g            1004   0.0     
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like        1003   0.0     
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like        1002   0.0     
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like        1001   0.0     
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         996   0.0     
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             996   0.0     
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         993   0.0     
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               992   0.0     
ref|XP_006656581.1|  PREDICTED: oligopeptide transporter 7-like         990   0.0     
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         990   0.0     
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         988   0.0     
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         988   0.0     
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         987   0.0     
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              985   0.0     
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              984   0.0     
ref|XP_010671377.1|  PREDICTED: oligopeptide transporter 6              984   0.0     
emb|CBI23049.3|  unnamed protein product                                982   0.0     
gb|EMT05930.1|  Oligopeptide transporter 7                              979   0.0     
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         979   0.0     
ref|XP_002515831.1|  Oligopeptide transporter, putative                 976   0.0     Ricinus communis
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              971   0.0     
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         971   0.0     
gb|KCW53166.1|  hypothetical protein EUGRSUZ_J02448                     963   0.0     
gb|KDO71234.1|  hypothetical protein CISIN_1g006390mg                   958   0.0     
ref|XP_006425446.1|  hypothetical protein CICLE_v10024968mg             957   0.0     
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              955   0.0     
emb|CDY19030.1|  BnaC01g20380D                                          953   0.0     
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         945   0.0     
ref|XP_002867483.1|  ATOPT6                                             944   0.0     
ref|XP_006413036.1|  hypothetical protein EUTSA_v10024519mg             943   0.0     
ref|NP_194503.1|  oligopeptide transporter                              943   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         942   0.0     
emb|CDX96230.1|  BnaC02g14210D                                          941   0.0     
emb|CDY28832.1|  BnaA02g10240D                                          941   0.0     
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              941   0.0     
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              940   0.0     
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              939   0.0     
emb|CDY47076.1|  BnaA03g12220D                                          939   0.0     
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              937   0.0     
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             937   0.0     
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              937   0.0     
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             937   0.0     
ref|XP_010433323.1|  PREDICTED: oligopeptide transporter 6-like         936   0.0     
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    934   0.0     
emb|CDY38751.1|  BnaC03g14980D                                          933   0.0     
ref|NP_200164.1|  oligopeptide transporter 8                            933   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDY55351.1|  BnaAnng13860D                                          932   0.0     
ref|XP_002864248.1|  predicted protein                                  932   0.0     
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         932   0.0     
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             931   0.0     
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         927   0.0     
ref|XP_007156164.1|  hypothetical protein PHAVU_003G263700g             923   0.0     
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    922   0.0     
ref|NP_001167707.1|  uncharacterized protein LOC100381394               921   0.0     Zea mays [maize]
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              915   0.0     
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             914   0.0     
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              914   0.0     
emb|CDY35662.1|  BnaC09g29840D                                          913   0.0     
ref|XP_002864247.1|  ATOPT9                                             913   0.0     
ref|XP_006281882.1|  hypothetical protein CARUB_v10028080mg             909   0.0     
gb|KCW45497.1|  hypothetical protein EUGRSUZ_L00776                     902   0.0     
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             895   0.0     
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         895   0.0     
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             895   0.0     
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             895   0.0     
ref|NP_200163.1|  oligopeptide transporter 9                            894   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KEH19466.1|  oligopeptide transporter OPT family protein             892   0.0     
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              888   0.0     
gb|EMS65130.1|  Oligopeptide transporter 7                              888   0.0     
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         884   0.0     
gb|EYU33488.1|  hypothetical protein MIMGU_mgv1a0023121mg               884   0.0     
ref|XP_010104574.1|  Oligopeptide transporter 4                         883   0.0     
ref|XP_001767301.1|  predicted protein                                  879   0.0     
emb|CDY14374.1|  BnaA10g06810D                                          878   0.0     
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          876   0.0     
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              876   0.0     
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             875   0.0     
ref|XP_008374152.1|  PREDICTED: oligopeptide transporter 7-like         872   0.0     
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         872   0.0     
ref|XP_008346658.1|  PREDICTED: oligopeptide transporter 7-like         870   0.0     
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              867   0.0     
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             867   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              866   0.0     
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         866   0.0     
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         865   0.0     
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              865   0.0     Vitis vinifera
ref|NP_172464.1|  oligopeptide transporter 2                            865   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         865   0.0     
emb|CBI19303.3|  unnamed protein product                                865   0.0     
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         864   0.0     
ref|XP_002527347.1|  Oligopeptide transporter, putative                 863   0.0     Ricinus communis
gb|ABE65610.1|  oligopeptide transporter OPT family protein             863   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         862   0.0     
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         862   0.0     
ref|XP_002892535.1|  ATOPT2                                             862   0.0     
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         861   0.0     
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             861   0.0     
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         860   0.0     
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              858   0.0     
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             858   0.0     
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             858   0.0     
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             858   0.0     
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              858   0.0     
emb|CDY31321.1|  BnaA02g34200D                                          857   0.0     
ref|XP_002518328.1|  Oligopeptide transporter, putative                 858   0.0     Ricinus communis
emb|CDY46800.1|  BnaC02g43080D                                          857   0.0     
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                858   0.0     
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              856   0.0     
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             857   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         856   0.0     
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         853   0.0     
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    854   0.0     
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         853   0.0     
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4-like         852   0.0     
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         851   0.0     
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         851   0.0     
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              851   0.0     Vitis vinifera
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              851   0.0     
gb|AAM64614.1|  Isp4-like protein                                       850   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             850   0.0     
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             850   0.0     
ref|NP_201246.1|  oligopeptide transporter 4                            849   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         850   0.0     
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             849   0.0     
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             850   0.0     
ref|XP_007039427.1|  Oligopeptide transporter 7 isoform 2               839   0.0     
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         848   0.0     
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              848   0.0     
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         848   0.0     
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              848   0.0     
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             847   0.0     
emb|CDY69955.1|  BnaCnng66090D                                          847   0.0     
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             847   0.0     
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         847   0.0     
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         847   0.0     
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              847   0.0     
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              846   0.0     
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              847   0.0     
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     845   0.0     
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         845   0.0     
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         845   0.0     
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             845   0.0     
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              845   0.0     
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         844   0.0     
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         845   0.0     
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         845   0.0     
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         843   0.0     
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         844   0.0     
ref|XP_004164894.1|  PREDICTED: oligopeptide transporter 4-like         844   0.0     
ref|XP_007042780.1|  Oligopeptide transporter 4                         851   0.0     
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    844   0.0     
ref|XP_010112260.1|  Oligopeptide transporter 4                         843   0.0     
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         843   0.0     
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         843   0.0     
gb|EAY75055.1|  hypothetical protein OsI_02950                          843   0.0     
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         843   0.0     
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       841   0.0     
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         841   0.0     
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         840   0.0     
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                840   0.0     
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    848   0.0     
emb|CAN81605.1|  hypothetical protein VITISV_025060                     839   0.0     
dbj|BAJ90957.1|  predicted protein                                      839   0.0     
dbj|BAB89477.1|  isp4 protein-like                                      839   0.0     
emb|CDY22616.1|  BnaC08g42500D                                          843   0.0     
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              838   0.0     
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         837   0.0     
ref|XP_003593303.1|  Oligopeptide transporter                           837   0.0     
ref|XP_008218454.1|  PREDICTED: oligopeptide transporter 1-like         837   0.0     
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             837   0.0     
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              837   0.0     
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         838   0.0     
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              837   0.0     
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              837   0.0     
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         837   0.0     
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             836   0.0     
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         836   0.0     
ref|XP_007018306.1|  Oligopeptide transporter 4                         836   0.0     
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          835   0.0     
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         835   0.0     
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        834   0.0     
ref|XP_004288877.1|  PREDICTED: oligopeptide transporter 2-like         833   0.0     
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             832   0.0     
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         832   0.0     
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         832   0.0     
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         831   0.0     
gb|EEE57620.1|  hypothetical protein OsJ_08019                          830   0.0     
ref|XP_003608353.1|  Oligopeptide transporter                           829   0.0     
ref|XP_007018304.1|  Oligopeptide transporter 2                         829   0.0     
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g             828   0.0     
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     828   0.0     
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         828   0.0     
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              828   0.0     
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    827   0.0     
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like         827   0.0     
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         827   0.0     
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    827   0.0     
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     827   0.0     
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         826   0.0     
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          827   0.0     
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     827   0.0     
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         826   0.0     
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         825   0.0     
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         826   0.0     
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         826   0.0     
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             825   0.0     
ref|XP_010097383.1|  Oligopeptide transporter 1                         825   0.0     
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         824   0.0     
dbj|BAD08158.1|  putative sexual differentiation process protein ...    824   0.0     
ref|XP_010474158.1|  PREDICTED: oligopeptide transporter 9-like         823   0.0     
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              823   0.0     
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         823   0.0     
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    825   0.0     
gb|KHN00468.1|  Oligopeptide transporter 7                              817   0.0     
ref|XP_008384590.1|  PREDICTED: oligopeptide transporter 1-like         822   0.0     
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         822   0.0     
gb|EMT01286.1|  Oligopeptide transporter 4                              822   0.0     
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         822   0.0     
emb|CBI19304.3|  unnamed protein product                                822   0.0     
ref|XP_008366195.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    822   0.0     
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         821   0.0     
ref|XP_006857743.1|  hypothetical protein AMTR_s00061p00190940          820   0.0     
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         820   0.0     
ref|XP_002991411.1|  hypothetical protein SELMODRAFT_269808             819   0.0     
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              819   0.0     
ref|XP_009367241.1|  PREDICTED: oligopeptide transporter 1-like         820   0.0     
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                819   0.0     
gb|EEC73829.1|  hypothetical protein OsI_08562                          820   0.0     
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         819   0.0     
ref|XP_010485098.1|  PREDICTED: oligopeptide transporter 8-like         817   0.0     
ref|XP_004295186.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    819   0.0     
ref|XP_009334674.1|  PREDICTED: oligopeptide transporter 1-like         819   0.0     
ref|NP_001062118.1|  Os08g0492000                                       818   0.0     
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         817   0.0     
gb|EMT31418.1|  Oligopeptide transporter 7                              810   0.0     
gb|KGN44392.1|  hypothetical protein Csa_7G279240                       817   0.0     
ref|XP_004151247.1|  PREDICTED: oligopeptide transporter 1-like         817   0.0     
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         817   0.0     
gb|EMS68344.1|  Oligopeptide transporter 4                              814   0.0     
gb|EMS57513.1|  Oligopeptide transporter 7                              820   0.0     
ref|XP_008463021.1|  PREDICTED: oligopeptide transporter 1-like i...    815   0.0     
ref|XP_010104576.1|  Oligopeptide transporter 2                         812   0.0     
gb|AES90550.2|  oligopeptide transporter OPT family protein             811   0.0     
ref|XP_008463020.1|  PREDICTED: oligopeptide transporter 1-like i...    813   0.0     
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         813   0.0     
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          813   0.0     
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             811   0.0     
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         811   0.0     
ref|XP_004160259.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    811   0.0     
gb|KCW53169.1|  hypothetical protein EUGRSUZ_J02450                     802   0.0     
ref|XP_010096485.1|  Oligopeptide transporter 1                         810   0.0     
emb|CBI35438.3|  unnamed protein product                                808   0.0     
ref|XP_002993852.1|  hypothetical protein SELMODRAFT_137672             808   0.0     
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             809   0.0     
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         808   0.0     
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         810   0.0     
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like         808   0.0     
emb|CDP00949.1|  unnamed protein product                                808   0.0     
ref|XP_009795934.1|  PREDICTED: oligopeptide transporter 7-like i...    802   0.0     
ref|XP_010096486.1|  Oligopeptide transporter 1                         808   0.0     
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         808   0.0     
ref|XP_010092336.1|  Oligopeptide transporter 1                         807   0.0     
gb|AEJ88342.1|  putative oligopeptide transporter                       797   0.0     
ref|XP_004973781.1|  PREDICTED: oligopeptide transporter 1-like         806   0.0     
gb|EMT26246.1|  Oligopeptide transporter 7                              801   0.0     
emb|CDP19590.1|  unnamed protein product                                805   0.0     
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         805   0.0     
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         804   0.0     
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g             803   0.0     
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              803   0.0     
ref|XP_006475109.1|  PREDICTED: oligopeptide transporter 1-like         803   0.0     
gb|KCW53167.1|  hypothetical protein EUGRSUZ_J02449                     798   0.0     
emb|CBI39770.3|  unnamed protein product                                803   0.0     
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         802   0.0     
emb|CBI18634.3|  unnamed protein product                                802   0.0     
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         801   0.0     
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              802   0.0     
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         801   0.0     
ref|XP_006452632.1|  hypothetical protein CICLE_v10010604mg             800   0.0     
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         799   0.0     
ref|XP_009600998.1|  PREDICTED: oligopeptide transporter 1-like         799   0.0     
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         799   0.0     
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         799   0.0     
ref|XP_006595683.1|  PREDICTED: oligopeptide transporter 1-like         799   0.0     
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         798   0.0     
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          798   0.0     
ref|XP_002522788.1|  Oligopeptide transporter, putative                 799   0.0     
ref|XP_007046675.1|  Oligopeptide transporter 7 isoform 3               790   0.0     
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         798   0.0     
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              798   0.0     
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              797   0.0     
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             798   0.0     
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 797   0.0     
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         797   0.0     
emb|CDP19592.1|  unnamed protein product                                795   0.0     
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         797   0.0     
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         796   0.0     
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         796   0.0     
gb|KCW70462.1|  hypothetical protein EUGRSUZ_F03679                     796   0.0     
ref|XP_004148255.1|  PREDICTED: oligopeptide transporter 5-like         797   0.0     
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         796   0.0     
ref|XP_010064976.1|  PREDICTED: oligopeptide transporter 1-like         795   0.0     
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         795   0.0     
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              795   0.0     
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              794   0.0     
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             794   0.0     
ref|XP_004491523.1|  PREDICTED: oligopeptide transporter 1-like         795   0.0     
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              794   0.0     
ref|XP_003603705.1|  Oligopeptide transporter                           793   0.0     
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    792   0.0     
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    793   0.0     
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         794   0.0     
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          793   0.0     
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     792   0.0     
emb|CDY42539.1|  BnaC08g10640D                                          792   0.0     
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         793   0.0     
gb|ABF70152.1|  oligopeptide transporter OPT family protein             792   0.0     
gb|AET00810.2|  oligopeptide transporter OPT family protein             792   0.0     
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             791   0.0     
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             792   0.0     
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              792   0.0     
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    791   0.0     
ref|XP_003519637.1|  PREDICTED: oligopeptide transporter 1-like         791   0.0     
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   791   0.0     
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         791   0.0     
ref|XP_008449039.1|  PREDICTED: oligopeptide transporter 5-like         791   0.0     
ref|XP_008218466.1|  PREDICTED: oligopeptide transporter 1-like         791   0.0     
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         790   0.0     
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    791   0.0     
ref|XP_003617851.1|  Oligopeptide transporter OPT family                791   0.0     
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              790   0.0     
gb|ADW09325.1|  oligopeptide transporter 3                              790   0.0     
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                790   0.0     
gb|KHN23341.1|  Oligopeptide transporter 6                              791   0.0     
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             788   0.0     
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         788   0.0     
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    788   0.0     
emb|CAH67988.1|  OSIGBa0142I02-OSIGBa0101B20.31                         788   0.0     
ref|NP_001152089.1|  oligopeptide transporter 4                         789   0.0     
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              789   0.0     
ref|XP_011069784.1|  PREDICTED: oligopeptide transporter 5-like         789   0.0     
emb|CDY06549.1|  BnaC02g12730D                                          788   0.0     
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         787   0.0     
ref|XP_006364990.1|  PREDICTED: oligopeptide transporter 4-like         787   0.0     
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             786   0.0     
gb|AAK96781.1|  Unknown protein                                         786   0.0     
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    786   0.0     
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         786   0.0     
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          786   0.0     
gb|KEH32683.1|  oligopeptide transporter OPT family protein             786   0.0     
gb|ACL82964.1|  glutathione transporter                                 786   0.0     
gb|KDO59178.1|  hypothetical protein CISIN_1g0044241mg                  785   0.0     
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             785   0.0     
ref|XP_006474840.1|  PREDICTED: oligopeptide transporter 1-like         785   0.0     
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         784   0.0     
ref|XP_006452634.1|  hypothetical protein CICLE_v10007552mg             785   0.0     
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             784   0.0     
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              784   0.0     



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =  1297 bits (3356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/762 (86%), Positives = 704/762 (92%), Gaps = 10/762 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKV-ESLP----EAAEEENSPIREVALTVP  206
             ME SA EIKTPLL  ++     HG ASSSKSKV +SL     E  EEENSPI++VALTVP
Sbjct  1     MEESALEIKTPLLSNLD-----HGIASSSKSKVNDSLELKKQEEDEEENSPIKQVALTVP  55

Query  207   TTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAR  386
              TDDPSLPVLTFRMW LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA+
Sbjct  56    ITDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAK  115

Query  387   ITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFF  566
             IT RVFF+G+KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY K+ITFF
Sbjct  116   ITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYQKNITFF  175

Query  567   VSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQ  746
             VSLI+V+TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPK G+TRTQ
Sbjct  176   VSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKCGLTRTQ  235

Query  747   FFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSS  926
             FF+IAFICSFAYYVFPGYLF MLTSLSWICW FP+SV AQQLGSGL GLGIGAIGLDWSS
Sbjct  236   FFLIAFICSFAYYVFPGYLFSMLTSLSWICWIFPKSVFAQQLGSGLNGLGIGAIGLDWSS  295

Query  927   ISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTY  1106
             ISSYLGSPLASPWFATAN+AVGFF I+Y+ TPI YW DVF AKTFPIFSD LFTSSGQ Y
Sbjct  296   ISSYLGSPLASPWFATANVAVGFFFIMYILTPICYWLDVFKAKTFPIFSDGLFTSSGQVY  355

Query  1107  NISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSK  1286
             NIS+IIDSNFHLD+ AY+Q+G LYLSTFF +TYGVGFAAL+AT++HV++FHGREIWEQSK
Sbjct  356   NISSIIDSNFHLDIAAYEQQGHLYLSTFFVITYGVGFAALSATVMHVLIFHGREIWEQSK  415

Query  1287  SSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACV  1466
             SSFK++KMDIHT+LMSKY QVPEWWFWCILVANI LTVFACEYY EQLQLPWWGV+LACV
Sbjct  416   SSFKEKKMDIHTKLMSKYNQVPEWWFWCILVANITLTVFACEYYNEQLQLPWWGVILACV  475

Query  1467  IAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQ  1646
             IAI FTLPIGIITAITNQTPGLNIITEYIIGY+YPGYPVANMCFKVYGYISM QAI FLQ
Sbjct  476   IAIFFTLPIGIITAITNQTPGLNIITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQ  535

Query  1647  DFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDH  1826
             DFKLGHYMKIPPRTMFMAQ+VGT+IAGFVYLGTAWWLMETIP+IC  T +NTVWTCPSDH
Sbjct  536   DFKLGHYMKIPPRTMFMAQIVGTLIAGFVYLGTAWWLMETIPDICNKTLSNTVWTCPSDH  595

Query  1827  VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMP  2006
             VFYDASVIWGLI PRRIFGDLGTYE VNWFFL GAIAPVLVWLA +AFP QEWI+LINMP
Sbjct  596   VFYDASVIWGLIAPRRIFGDLGTYEMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLINMP  655

Query  2007  VLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVL  2186
             VLI AT  MPPATAVNY TWIIVGFLSGYVV+RYRPD WQRHNYVLSGALDAGLAFM VL
Sbjct  656   VLIGATGMMPPATAVNYATWIIVGFLSGYVVYRYRPDWWQRHNYVLSGALDAGLAFMAVL  715

Query  2187  LYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LY+CLGLENVS+NWWGNDLDGCPYASCP+AKGI+ +GCPV+Y
Sbjct  716   LYMCLGLENVSVNWWGNDLDGCPYASCPTAKGIVKQGCPVVY  757



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =  1289 bits (3335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/762 (86%), Positives = 700/762 (92%), Gaps = 10/762 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKV-ESLP----EAAEEENSPIREVALTVP  206
             ME SA EIKTPLL  ++     HG ASSSKSKV +SL     E  EEENSPI++VALTVP
Sbjct  1     MEESASEIKTPLLSNLD-----HGIASSSKSKVNDSLELKKQEEDEEENSPIKQVALTVP  55

Query  207   TTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAR  386
              TDDPSLPVLTFRMW LGT+SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA+
Sbjct  56    ITDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAK  115

Query  387   ITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFF  566
             IT RVFF+G+KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY K+ITFF
Sbjct  116   ITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYQKNITFF  175

Query  567   VSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQ  746
             VSLI+V+TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQ
Sbjct  176   VSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGLTRTQ  235

Query  747   FFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSS  926
             FF+IAFICSFAYYVFPGYLF MLTSLSWICW FP+SV  QQLGSGL GLGIGAIGLDWSS
Sbjct  236   FFLIAFICSFAYYVFPGYLFSMLTSLSWICWIFPKSVFVQQLGSGLNGLGIGAIGLDWSS  295

Query  927   ISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTY  1106
             ISSYLGSPLASPWFATAN+AVGFF I+Y+ TPI YW DVF AKTFPIFS  LFTSSGQ Y
Sbjct  296   ISSYLGSPLASPWFATANVAVGFFFIMYILTPICYWLDVFKAKTFPIFSSGLFTSSGQVY  355

Query  1107  NISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSK  1286
             NIS+IIDSNFHLD+ AY+Q+G LYLSTFF +TYGVGFAAL+AT++HV+LFHGREIWEQSK
Sbjct  356   NISSIIDSNFHLDIAAYEQQGHLYLSTFFVITYGVGFAALSATVMHVLLFHGREIWEQSK  415

Query  1287  SSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACV  1466
             SSFK++K DIHTRLMSKY QVPEWWFWCILVANI LTVFACEYY EQLQLPWWGV+LACV
Sbjct  416   SSFKEKKTDIHTRLMSKYNQVPEWWFWCILVANITLTVFACEYYNEQLQLPWWGVILACV  475

Query  1467  IAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQ  1646
             IAI FTLPIG+ITAITNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM QAI FLQ
Sbjct  476   IAIFFTLPIGVITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQ  535

Query  1647  DFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDH  1826
             DFKLGHYMKIPPRTMFMAQVVGT+IAGFVYLGTAWWLMETIP+IC  T +NTVWTCPSDH
Sbjct  536   DFKLGHYMKIPPRTMFMAQVVGTLIAGFVYLGTAWWLMETIPDICIKTLSNTVWTCPSDH  595

Query  1827  VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMP  2006
             VFYDASVIWGLI PRRIFGDLGTY  VNWFFL GAIAPV+VWLA +AFP QEWI+LINMP
Sbjct  596   VFYDASVIWGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVVVWLAARAFPKQEWIKLINMP  655

Query  2007  VLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVL  2186
             VLI AT  MPPATAVNYTTWIIVGFLSGYVV+RYRPD WQRHNYVLSGALDAGLAFM VL
Sbjct  656   VLIGATGMMPPATAVNYTTWIIVGFLSGYVVYRYRPDWWQRHNYVLSGALDAGLAFMAVL  715

Query  2187  LYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LYLCLG EN+S+NWWGNDLDGCPYASCP+AKGII +GCPV+Y
Sbjct  716   LYLCLGSENISVNWWGNDLDGCPYASCPTAKGIIKQGCPVVY  757



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =  1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/757 (84%), Positives = 698/757 (92%), Gaps = 8/757 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             ME SA EIKTPLL   +     HG ASSS  KV    +  E+ENSP+ +VALTVPTTDDP
Sbjct  1     MEESASEIKTPLLSNFD-----HGIASSSNVKVH---KDDEDENSPVEQVALTVPTTDDP  52

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMW LGT+SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA+IT RV
Sbjct  53    SLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKITKRV  112

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             F +G+KWEF+LNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY K ITFFVSLI+
Sbjct  113   FLQGSKWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYKKDITFFVSLIV  172

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             ++TTQVLGFGWAGIFR+YLVEPAAMWWP+NLVQVSLFRALHEKEER KGG+TRTQFF++A
Sbjct  173   IITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERCKGGLTRTQFFIVA  232

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYY+FPGYLF MLTSLSWICW FP+SV AQQLGSGL+GLGIGAIGLDWSSISSYL
Sbjct  233   FICSFAYYIFPGYLFSMLTSLSWICWIFPKSVFAQQLGSGLKGLGIGAIGLDWSSISSYL  292

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GF  ++YV TPI YW D+F AKTFPIFSDE+FTS+GQ YNIS+I
Sbjct  293   GSPLASPWFATANVAAGFIFVMYVLTPICYWLDIFKAKTFPIFSDEMFTSNGQVYNISSI  352

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLD++AY+++G LYLSTFFA+TYGVGFAAL+AT++HV+LFHGREIWEQSKSSFKD
Sbjct  353   IDSNFHLDVDAYERQGHLYLSTFFAVTYGVGFAALSATVMHVLLFHGREIWEQSKSSFKD  412

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHTRLMSKY QVPEWWFWCILVANI LT+FACEYY EQLQLPWWGV+LACVIA  F
Sbjct  413   QKMDIHTRLMSKYNQVPEWWFWCILVANITLTIFACEYYNEQLQLPWWGVILACVIAFFF  472

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISMTQAI FLQDFKLG
Sbjct  473   TLPIGIITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMTQAITFLQDFKLG  532

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPR MFMAQVVGT+IAGFVYLGTAWWLMETIP+IC  T +NTVWTCPSDHVFYDA
Sbjct  533   HYMKIPPRIMFMAQVVGTLIAGFVYLGTAWWLMETIPDICDKTLSNTVWTCPSDHVFYDA  592

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLI PRRIFGDLGTY  VNWFFL GAIAPVLVWLA +AFP QEWI+LINMPVLI A
Sbjct  593   SVIWGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLINMPVLIGA  652

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNYTTWIIVGFLSG+VV+RYRPD WQRHNYVLSGALDAGLAFM VL+YLCL
Sbjct  653   TGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDWWQRHNYVLSGALDAGLAFMAVLIYLCL  712

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             GLEN+++NWWGNDLDGCPYA+CP+A+GI++EGCPV+Y
Sbjct  713   GLENITINWWGNDLDGCPYAACPTARGIVIEGCPVVY  749



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =  1270 bits (3287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/757 (84%), Positives = 695/757 (92%), Gaps = 8/757 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             ME SA EIKTPLL   +     HG ASSS  K     +  E+ENSPI +VALTVPTTDDP
Sbjct  1     MEESAYEIKTPLLSNFD-----HGIASSSNVKFN---KDDEDENSPIEQVALTVPTTDDP  52

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMW LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA+IT RV
Sbjct  53    SLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKITKRV  112

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             F +G+KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY K ITFFVSLI+
Sbjct  113   FLQGSKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYKKDITFFVSLIV  172

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             ++TTQVLGFGWAGIFR+YLVEPAAMWWP+NLVQVSLFRALHEKEER KGG+TRTQFF++A
Sbjct  173   IITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERSKGGLTRTQFFIVA  232

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYY+FPGYLF MLTSLSW+CW FP+SV AQQLGSGL+GLGIGAIGLDWSSISSYL
Sbjct  233   FICSFAYYIFPGYLFSMLTSLSWVCWIFPKSVFAQQLGSGLKGLGIGAIGLDWSSISSYL  292

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GF  ++YV TPI YW D+F AKTFPIFSD ++TS+GQ YNIS+I
Sbjct  293   GSPLASPWFATANVAAGFIFVMYVLTPICYWLDIFKAKTFPIFSDGMYTSNGQVYNISSI  352

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLD++AY+Q+G LYLSTFFA+TYGVGFAAL+AT++HV+LFHGREIWEQSKSSFKD
Sbjct  353   IDSNFHLDIDAYEQQGHLYLSTFFAVTYGVGFAALSATVMHVLLFHGREIWEQSKSSFKD  412

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHTRLMSKY QVPEWWFWCILVANI LT+FACEYY EQLQLPWWGV+LACVIA  F
Sbjct  413   QKMDIHTRLMSKYNQVPEWWFWCILVANITLTIFACEYYNEQLQLPWWGVILACVIAFFF  472

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISMTQAI FLQDFKLG
Sbjct  473   TLPIGIITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMTQAITFLQDFKLG  532

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPR MFMAQVVGT+IAGFVYLGTAWWLMETIP++C  T +NTVWTCPSDHVFYDA
Sbjct  533   HYMKIPPRIMFMAQVVGTLIAGFVYLGTAWWLMETIPDMCNKTLSNTVWTCPSDHVFYDA  592

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLI PRRIFGDLGTY  VNWFFL GAIAPVLVWLA +AFP QEWI+LI+MPVLI A
Sbjct  593   SVIWGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLISMPVLIGA  652

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNYTTWIIVGFLSG+VV+RYRPD WQRHNYVLSGALDAGLAFM VL+YLCL
Sbjct  653   TGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDWWQRHNYVLSGALDAGLAFMAVLIYLCL  712

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             GLEN+++NWWGNDLDGCPYA+CP+A+GI+ EGCPV+Y
Sbjct  713   GLENITVNWWGNDLDGCPYAACPTARGIVTEGCPVVY  749



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =  1262 bits (3265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/753 (84%), Positives = 698/753 (93%), Gaps = 5/753 (1%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             S+D+I  PL+ + E+    +    SS S+V   P     ENSPI++VALTVPTTDDP+LP
Sbjct  5     SSDQITAPLISRPEKEYEHYSSPESSSSQVNEEPG----ENSPIKQVALTVPTTDDPTLP  60

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
             VLTFRMW LGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA+ITDRVFFR
Sbjct  61    VLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFR  120

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
             GT+WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY +HI+FFVSLI+V+T
Sbjct  121   GTRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYKQHISFFVSLIVVIT  180

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAGI+RRYLVEPAAMWWPANLVQVSLFRALHEK+ERPKGG+TRTQFF+IAFIC
Sbjct  181   TQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSLFRALHEKDERPKGGVTRTQFFIIAFIC  240

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYY+FPGYLFQMLTSLSWICW FP+SV+AQQLGSGL+GLGIGAIGLDWS+ISSYLGSP
Sbjct  241   SFAYYIFPGYLFQMLTSLSWICWIFPKSVIAQQLGSGLKGLGIGAIGLDWSTISSYLGSP  300

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFATAN+AVGFF ++YV TP+ YW +++ AKTFPIFSD+LFTSSGQ YNIS+IID 
Sbjct  301   LASPWFATANVAVGFFFVMYVVTPLSYWLNIYEAKTFPIFSDDLFTSSGQIYNISSIIDL  360

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
             NFHLD  AY +EG L+LSTFFA+TYGVGFAAL+AT++HV+LFHGREIWEQSKSSF  +KM
Sbjct  361   NFHLDAAAYQREGPLHLSTFFAMTYGVGFAALSATVMHVLLFHGREIWEQSKSSFNQKKM  420

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             DIHT+LMSKYRQVPEWWFWCILVAN+ALT+FACEYYKEQLQLPWWGV+LACVIAI FTLP
Sbjct  421   DIHTKLMSKYRQVPEWWFWCILVANVALTIFACEYYKEQLQLPWWGVILACVIAIFFTLP  480

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             IGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGHYM
Sbjct  481   IGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYM  540

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVI  1850
             KIPPR MFMAQVVGT+IAGFVYLGTAWWLMETIP+IC  + +++VWTCP DHVFYDASVI
Sbjct  541   KIPPRMMFMAQVVGTLIAGFVYLGTAWWLMETIPDICDKS-SDSVWTCPGDHVFYDASVI  599

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPR+IFGD GTY  VNWFFL GAIAP+LVWLATKAFP QEWIRLINMPVLI A   
Sbjct  600   WGLIGPRKIFGDQGTYGMVNWFFLGGAIAPLLVWLATKAFPNQEWIRLINMPVLIGACGQ  659

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYTTWIIVGFLSGYVV+RYRPDLWQRHNYVLSGALDAGLAFMGVLLY+CLGLE
Sbjct  660   MPPATAVNYTTWIIVGFLSGYVVYRYRPDLWQRHNYVLSGALDAGLAFMGVLLYMCLGLE  719

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             N+S++WWGNDLDGCPYASCP+AKGI+ E CPVI
Sbjct  720   NISIDWWGNDLDGCPYASCPTAKGILFESCPVI  752



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =  1259 bits (3258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/760 (84%), Positives = 699/760 (92%), Gaps = 5/760 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEG-----RHGFASSSKSKVESLPEAAEEENSPIREVALTVP  206
             ME S DEI  PL+PK E+            + +  SK E      EEENSP+R+VALTVP
Sbjct  1     MEESKDEIIAPLIPKDEKDRDVSNPSSSSSSRAMASKSEVKEVQEEEENSPVRQVALTVP  60

Query  207   TTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAR  386
             TTDDPSLPVLTFRMWVLGT+SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA+
Sbjct  61    TTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAK  120

Query  387   ITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFF  566
             ITDRVFF+GT+WEF+LNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VKVFY KHITFF
Sbjct  121   ITDRVFFKGTRWEFSLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKVFYKKHITFF  180

Query  567   VSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQ  746
             VSLI+++TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQ
Sbjct  181   VSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERAKGGVTRTQ  240

Query  747   FFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSS  926
             FF+IA ICSFAYYVFPGYLFQMLTSLSWICW FP+SVLAQQLGSGL GLGIGAIGLDWS+
Sbjct  241   FFLIALICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLYGLGIGAIGLDWST  300

Query  927   ISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTY  1106
             ISSYLGSPLASPWFATAN+A GF LI+YV TPI YW +V+NAKTFPIFSD LFTS+GQ Y
Sbjct  301   ISSYLGSPLASPWFATANVAAGFILIMYVLTPITYWLNVYNAKTFPIFSDALFTSTGQEY  360

Query  1107  NISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSK  1286
             NI+AIIDSNFHLD+ AY++EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSK
Sbjct  361   NITAIIDSNFHLDIAAYEKEGPLYLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSK  420

Query  1287  SSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACV  1466
             +SF+++KMD+HTRLM KY+QVPEWWF CIL+ NIA T+ ACEYY +QLQLPWWGVLLAC 
Sbjct  421   ASFQEKKMDVHTRLMRKYKQVPEWWFVCILLVNIAATILACEYYNDQLQLPWWGVLLACG  480

Query  1467  IAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQ  1646
             IAI+FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQ
Sbjct  481   IAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQ  540

Query  1647  DFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDH  1826
             DFKLGHYMKIPPRTMFMAQVVGT+IA FVYLGTAWWLMETIP+IC TTA+N+VWTCPSD 
Sbjct  541   DFKLGHYMKIPPRTMFMAQVVGTLIACFVYLGTAWWLMETIPDICDTTASNSVWTCPSDT  600

Query  1827  VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMP  2006
             VFYDASVIWGL+ PRRIFGDLGTYEA+NWFFLAGAIAP+LVWLATKAFP QEWI+LINMP
Sbjct  601   VFYDASVIWGLVAPRRIFGDLGTYEAINWFFLAGAIAPLLVWLATKAFPHQEWIKLINMP  660

Query  2007  VLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVL  2186
             VLI AT  MPPATAVNYTTWIIVGFLSG+VV+RYRPDLWQR+NYVLSG+LDAGLAFMGVL
Sbjct  661   VLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYNYVLSGSLDAGLAFMGVL  720

Query  2187  LYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +YLCLGLEN+SL+WWGNDLDGCP ASCP+AKGI VEGCPV
Sbjct  721   IYLCLGLENISLDWWGNDLDGCPLASCPTAKGIEVEGCPV  760



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =  1257 bits (3253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/762 (84%), Positives = 699/762 (92%), Gaps = 10/762 (1%)
 Frame = +3

Query  39    AMEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEE------NSPIREVALT  200
             AM+ S DEI+ PL+ K E+        SSS+SK  +    AE +      NSP+R+VALT
Sbjct  24    AMQESKDEIRAPLISKDEDDSN----LSSSRSKALASKSEAEIKEVEEEENSPVRQVALT  79

Query  201   VPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA  380
             VPTTDDPSLPVLTFRMWVLGT+SC LLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA
Sbjct  80    VPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA  139

Query  381   ARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHIT  560
             A+IT RVFF+G++WEFTLNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VKVFY +HIT
Sbjct  140   AKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKVFYKQHIT  199

Query  561   FFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITR  740
             FFVSLI++LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER  GG+TR
Sbjct  200   FFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERANGGVTR  259

Query  741   TQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDW  920
             TQFF+IAFICSFAYYVFPGYLFQMLTSLSWICW FP+SVLAQQLGSGL GLGIGAIGLDW
Sbjct  260   TQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLYGLGIGAIGLDW  319

Query  921   SSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQ  1100
             S+ISSYLGSPLASPWFATAN+A G+  ++YV TPI YW +V++AKTFPIFSD LFTS+GQ
Sbjct  320   STISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYWLNVYSAKTFPIFSDTLFTSTGQ  379

Query  1101  TYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQ  1280
              YNI+AIIDSNFHLD+ AY++EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQ
Sbjct  380   EYNITAIIDSNFHLDVAAYEKEGPLYLSTFFAMTYGVGFAALTATIVHVGLFHGREIWEQ  439

Query  1281  SKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLA  1460
             SK+SF+++KMDIHTRLM KY+QVPEWWF CIL+ NIA TVFAC+YY +QLQLPWWGVLLA
Sbjct  440   SKASFQEKKMDIHTRLMRKYKQVPEWWFVCILLVNIAATVFACQYYNDQLQLPWWGVLLA  499

Query  1461  CVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAF  1640
             C IAI+FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI F
Sbjct  500   CGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITF  559

Query  1641  LQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPS  1820
             LQDFKLGHYMKIPPRTMFMAQ+VGT+IA FVYLGTAWWLME IP+IC TTA+N+VWTCPS
Sbjct  560   LQDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWLMENIPDICDTTASNSVWTCPS  619

Query  1821  DHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLIN  2000
             D VFYDASVIWGLI PRRIFGDLGTYEAVNWFFLAGA+AP+LVWLA+KAFP QEWIRLIN
Sbjct  620   DTVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAVAPLLVWLASKAFPSQEWIRLIN  679

Query  2001  MPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMG  2180
             MPVLI AT  MPPATAVNYTTWIIVGFLSG+VV+RYRPDLWQR+NYVLSGALDAGLAFMG
Sbjct  680   MPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYNYVLSGALDAGLAFMG  739

Query  2181  VLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             VLLYLCLGLEN+SL+WWGNDLDGCP ASCP+A+GI VEGCP+
Sbjct  740   VLLYLCLGLENISLDWWGNDLDGCPLASCPTAQGIKVEGCPL  781



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =  1255 bits (3247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/761 (84%), Positives = 698/761 (92%), Gaps = 10/761 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEE------NSPIREVALTV  203
             M+ S DEI+ PL+ K E+        SSS+SK  +    AE +      NSP+R+VALTV
Sbjct  1     MQESKDEIRAPLISKDEDDSN----LSSSRSKALASKSEAEIKEVEEEENSPVRQVALTV  56

Query  204   PTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA  383
             PTTDDPSLPVLTFRMWVLGT+SC LLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA
Sbjct  57    PTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAA  116

Query  384   RITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITF  563
             +IT RVFF+G++WEFTLNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VKVFY +HITF
Sbjct  117   KITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKVFYKQHITF  176

Query  564   FVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRT  743
             FVSLI++LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER  GG+TRT
Sbjct  177   FVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERANGGVTRT  236

Query  744   QFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWS  923
             QFF+IAFICSFAYYVFPGYLFQMLTSLSWICW FP+SVLAQQLGSGL GLGIGAIGLDWS
Sbjct  237   QFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLYGLGIGAIGLDWS  296

Query  924   SISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQT  1103
             +ISSYLGSPLASPWFATAN+A G+  ++YV TPI YW +V++AKTFPIFSD LFTS+GQ 
Sbjct  297   TISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYWLNVYSAKTFPIFSDTLFTSTGQE  356

Query  1104  YNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQS  1283
             YNI+AIIDSNFHLD+ AY++EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQS
Sbjct  357   YNITAIIDSNFHLDVAAYEKEGPLYLSTFFAMTYGVGFAALTATIVHVGLFHGREIWEQS  416

Query  1284  KSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLAC  1463
             K+SF+++KMDIHTRLM KY+QVPEWWF CIL+ NIA TVFAC+YY +QLQLPWWGVLLAC
Sbjct  417   KASFQEKKMDIHTRLMRKYKQVPEWWFVCILLVNIAATVFACQYYNDQLQLPWWGVLLAC  476

Query  1464  VIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFL  1643
              IAI+FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FL
Sbjct  477   GIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFL  536

Query  1644  QDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSD  1823
             QDFKLGHYMKIPPRTMFMAQ+VGT+IA FVYLGTAWWLME IP+IC TTA+N+VWTCPSD
Sbjct  537   QDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWLMENIPDICDTTASNSVWTCPSD  596

Query  1824  HVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINM  2003
              VFYDASVIWGLI PRRIFGDLGTYEAVNWFFLAGA+AP+LVWLA+KAFP QEWIRLINM
Sbjct  597   TVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAVAPLLVWLASKAFPSQEWIRLINM  656

Query  2004  PVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGV  2183
             PVLI AT  MPPATAVNYTTWIIVGFLSG+VV+RYRPDLWQR+NYVLSGALDAGLAFMGV
Sbjct  657   PVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYNYVLSGALDAGLAFMGV  716

Query  2184  LLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LLYLCLGLEN+SL+WWGNDLDGCP ASCP+A+GI VEGCP+
Sbjct  717   LLYLCLGLENISLDWWGNDLDGCPLASCPTAQGIKVEGCPL  757



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =  1251 bits (3236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/755 (84%), Positives = 696/755 (92%), Gaps = 8/755 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             ME S+ EI +PL+ K        G  SS +    SL    +EENSPI++VALTVPTTDDP
Sbjct  1     MEESSHEITSPLISK--------GGDSSLEPSSSSLKPDPDEENSPIKQVALTVPTTDDP  52

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMWVLGT+SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLG+LMAA+ITDRV
Sbjct  53    SLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMAAKITDRV  112

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+GT WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT VKVFY KHI+FFVSLI+
Sbjct  113   FFKGTPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTVVKVFYKKHISFFVSLIV  172

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             V+TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TRTQFF+IA
Sbjct  173   VITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRTQFFLIA  232

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYYVFPGY+F+MLTSLSWICW FP SVLAQQLGSGL GLGI A+GLDWS+IS+YL
Sbjct  233   FICSFAYYVFPGYMFEMLTSLSWICWIFPTSVLAQQLGSGLYGLGIAAVGLDWSTISAYL  292

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+AVGF  ++YV TPI YW +V+ AKTFPIFSD+LFTS+GQ YNIS+I
Sbjct  293   GSPLASPWFATANVAVGFVFVMYVLTPICYWLNVYKAKTFPIFSDDLFTSTGQEYNISSI  352

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             I SNFHL++ AY++EG LYLSTFFA+TYGVGFAAL+AT VHV+LFHGREIWEQSKSSFKD
Sbjct  353   ITSNFHLNITAYEEEGPLYLSTFFAMTYGVGFAALSATAVHVLLFHGREIWEQSKSSFKD  412

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             + MDIHTRLM++Y+QVPEWWFW IL+ANIA T+FAC+YY +QLQLPWWGVLLAC IAI+F
Sbjct  413   KGMDIHTRLMTRYKQVPEWWFWSILIANIAFTIFACQYYNDQLQLPWWGVLLACAIAIVF  472

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQDFKLG
Sbjct  473   TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLG  532

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMFMAQVVGT+IAGFVYLGTAWW+METIP+IC+TTA+++ WTCPSD VFYDA
Sbjct  533   HYMKIPPRTMFMAQVVGTLIAGFVYLGTAWWMMETIPDICETTASSSPWTCPSDRVFYDA  592

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFGD G YEAVNWFFLAGA+APVLVWLA KAFP QEWI LINMPVLIS+
Sbjct  593   SVIWGLIGPRRIFGDEGVYEAVNWFFLAGAVAPVLVWLAHKAFPKQEWIGLINMPVLISS  652

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNYTTW+I GFLSG+VV+RYRPD WQRHNYVLSGALDAGLAFMGVLLYLCL
Sbjct  653   TGMMPPATAVNYTTWVIAGFLSGFVVYRYRPDWWQRHNYVLSGALDAGLAFMGVLLYLCL  712

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             GLE++S++WWGNDLDGCPYA+CP+AKG+ VEGCPV
Sbjct  713   GLEDISVDWWGNDLDGCPYATCPTAKGVFVEGCPV  747



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =  1249 bits (3233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/756 (82%), Positives = 692/756 (92%), Gaps = 2/756 (0%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGR--HGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDD  218
             E +   I+TPL+ + E+ E    +   SSSKS+   + +A +EENSP+++VALTVPTTDD
Sbjct  43    ETTHHGIRTPLMSRDEKDEDNTDNNLPSSSKSQTSEINQAHDEENSPVKQVALTVPTTDD  102

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
             PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA+ITDR
Sbjct  103   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDR  162

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
             VFF+GT+ EFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+VT VK FY K+ITFFVS I
Sbjct  163   VFFKGTRCEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKAFYKKNITFFVSFI  222

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             +++TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQFF+I
Sbjct  223   VIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLI  282

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AF CSFAYYVFPGYLF+MLTSLSWICW FP+S+LAQQLGSGL GLGIGA GLDWS+ISSY
Sbjct  283   AFTCSFAYYVFPGYLFEMLTSLSWICWIFPKSILAQQLGSGLYGLGIGAFGLDWSTISSY  342

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFATAN+A GF  ++YV TP+ YW +V+ AKTFPIFSD+LFT++GQ YNISA
Sbjct  343   LGSPLASPWFATANVAAGFVFVMYVLTPLCYWFNVYKAKTFPIFSDDLFTATGQEYNISA  402

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             IIDSNFHLDL AYD+EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQS +SF+
Sbjct  403   IIDSNFHLDLAAYDREGPLYLSTFFAVTYGVGFAALTATIVHVALFHGREIWEQSMASFQ  462

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             ++ MDIHTR M KY QVPEWWF CIL+ NIALT+FACEYYK+QLQLPWWGVLLAC IAI 
Sbjct  463   EKTMDIHTRHMRKYNQVPEWWFVCILLVNIALTIFACEYYKDQLQLPWWGVLLACGIAIT  522

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKL
Sbjct  523   FTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKL  582

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYD  1838
             GHYMKIPPRTMFMAQVVGT+IA   YLGTAWWL+ETI +IC +TA+++VWTCPSDHVFYD
Sbjct  583   GHYMKIPPRTMFMAQVVGTIIACITYLGTAWWLLETITDICDSTASDSVWTCPSDHVFYD  642

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFG+LGTYEAVNWFFL GAIAP+LVWLA KAFP QEWIRLINMPVLI 
Sbjct  643   ASVIWGLIGPRRIFGNLGTYEAVNWFFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIG  702

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             AT  MPPATAVNYTTW++VGFLSG+VV+RY+PDLWQR+NYVLSG+LDAGLAFMGVLLY C
Sbjct  703   ATGMMPPATAVNYTTWVLVGFLSGFVVYRYKPDLWQRYNYVLSGSLDAGLAFMGVLLYFC  762

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LGLEN+S+NWWGNDLDGCP ASCP+AKG+ VEGCPV
Sbjct  763   LGLENISINWWGNDLDGCPLASCPTAKGVSVEGCPV  798



>ref|XP_002518892.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF43425.1| Oligopeptide transporter, putative [Ricinus communis]
Length=760

 Score =  1243 bits (3217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/758 (82%), Positives = 695/758 (92%), Gaps = 3/758 (0%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGF--ASSSKSKVESLPEAAE-EENSPIREVALTVPTT  212
             ME    EI+ PL+ K E+ E  +    +SS+ SK E   +  E EENSP+++VALTV TT
Sbjct  1     MEEETLEIRAPLITKDEKIEDYNDTPPSSSANSKQEIYQQLQETEENSPVKQVALTVSTT  60

Query  213   DDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARIT  392
             DD SLPVLTFRMW LG +SC+LLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA+IT
Sbjct  61    DDTSLPVLTFRMWFLGAISCILLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKIT  120

Query  393   DRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVS  572
             DRVFF+GT+ EFTLNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VKVFY KHITFFVS
Sbjct  121   DRVFFKGTRCEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKVFYKKHITFFVS  180

Query  573   LIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFF  752
              I+++TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TR QFF
Sbjct  181   FIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRIQFF  240

Query  753   VIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSIS  932
             +IAFICSFAYY FPGYLFQMLTSLSWICW FP+SVLAQQLGSGL GLGIGA+G+DWS+IS
Sbjct  241   LIAFICSFAYYFFPGYLFQMLTSLSWICWIFPQSVLAQQLGSGLYGLGIGALGIDWSTIS  300

Query  933   SYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNI  1112
             SYLGSPLASPWFATAN+A GF +++Y  TP+ YW +V+ AKTFPIFSD+LFTS+GQ Y+I
Sbjct  301   SYLGSPLASPWFATANVAAGFIVVMYFLTPLSYWLNVYKAKTFPIFSDDLFTSTGQEYDI  360

Query  1113  SAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSS  1292
             S+IIDSNFHLD+ AY++EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGRE+WEQSK+S
Sbjct  361   SSIIDSNFHLDIAAYEKEGPLYLSTFFAMTYGVGFAALTATIVHVALFHGREVWEQSKAS  420

Query  1293  FKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIA  1472
             FK+ KMDIHT+LM KY+QVPEWWF CIL+ANIA T+FACEYY EQLQLPWWGVLLAC IA
Sbjct  421   FKETKMDIHTKLMRKYKQVPEWWFLCILLANIAATIFACEYYNEQLQLPWWGVLLACGIA  480

Query  1473  IIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDF  1652
             I+FTLPIGIITAITNQTPGLNIITEY+IGYIYPGYPVANMCFKVYGYISMTQAI FLQDF
Sbjct  481   IVFTLPIGIITAITNQTPGLNIITEYVIGYIYPGYPVANMCFKVYGYISMTQAITFLQDF  540

Query  1653  KLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVF  1832
             KLGHYMKIPPRTMFMAQ+VGT+IA   YLGTAWWLMETIP+IC+TTA+N+VWTCPSD VF
Sbjct  541   KLGHYMKIPPRTMFMAQIVGTIIACLTYLGTAWWLMETIPDICETTASNSVWTCPSDTVF  600

Query  1833  YDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVL  2012
             YDASVIWGLIGPRRIFGDLGTYEA+NWFFL GAIAP+LVWLA KAFP QEWIRLINMPVL
Sbjct  601   YDASVIWGLIGPRRIFGDLGTYEAINWFFLGGAIAPILVWLAAKAFPHQEWIRLINMPVL  660

Query  2013  ISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLY  2192
             I AT  MPPATAVNYT+WII+GFLSG+VV+RYRPDLWQR+NYVLSG+LDAGLAFMGVL+Y
Sbjct  661   IGATGMMPPATAVNYTSWIIMGFLSGFVVYRYRPDLWQRYNYVLSGSLDAGLAFMGVLIY  720

Query  2193  LCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LCLG+E++S++WWGNDLDGCP A+CP+A+G++V+GCPV
Sbjct  721   LCLGIEDISVDWWGNDLDGCPLATCPTAQGVVVDGCPV  758



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =  1242 bits (3214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/756 (82%), Positives = 690/756 (91%), Gaps = 2/756 (0%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGR--HGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDD  218
             E +   I+TPL+ + E+ E    +   SSSKS+   + +A +EENSP+++VALTVPTTDD
Sbjct  3     ETTHHGIRTPLMSRDEKDEDNTDNNLPSSSKSQTSEINQAHDEENSPVKQVALTVPTTDD  62

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
             PSLPVLTFRMWVLGT+SCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA+ITDR
Sbjct  63    PSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDR  122

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
             VFF+GT+ EFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+VT VK FY K+IT FVS I
Sbjct  123   VFFKGTRCEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKAFYKKNITLFVSFI  182

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             +++TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQFF+I
Sbjct  183   VIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLI  242

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AF CSFAYYVFPGYLF+MLTSLSWICW FP+S+LAQQLGSGL GLGIGA GLDWS+ISSY
Sbjct  243   AFTCSFAYYVFPGYLFEMLTSLSWICWIFPKSILAQQLGSGLYGLGIGAFGLDWSTISSY  302

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFATAN+A GF  ++Y+ TP+ YW +V+ AKTFPIFSD+LFT++GQ YNISA
Sbjct  303   LGSPLASPWFATANVAAGFVFVMYILTPLCYWFNVYKAKTFPIFSDDLFTATGQEYNISA  362

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             IIDSNFHLDL AYD++G LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQS +SF+
Sbjct  363   IIDSNFHLDLAAYDRQGPLYLSTFFAVTYGVGFAALTATIVHVALFHGREIWEQSMASFQ  422

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             +R MDIHTR M KY QVPEWWF CIL+ NIALT+FACEYYK+QLQLPWWGVLLAC IAI 
Sbjct  423   ERTMDIHTRHMRKYNQVPEWWFVCILLVNIALTIFACEYYKDQLQLPWWGVLLACGIAIT  482

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQDFKL
Sbjct  483   FTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKL  542

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYD  1838
             GHYMKIPPRTMFMAQVVGT+IA   YLGTAWWL+ETI +IC  +A+++VWTCPSDHVFYD
Sbjct  543   GHYMKIPPRTMFMAQVVGTIIACITYLGTAWWLLETITDICDASASDSVWTCPSDHVFYD  602

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFG+LGTYEAVNWFFL GAIAP+LVWLA KAFP QEWIRLINMPVLI 
Sbjct  603   ASVIWGLIGPRRIFGNLGTYEAVNWFFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIG  662

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             AT  MPPATAVNYTTW++VGFLSG+VV+RY+PDLWQR+NYVLSG+LDAGLAFMGVLLY C
Sbjct  663   ATGMMPPATAVNYTTWVLVGFLSGFVVYRYKPDLWQRYNYVLSGSLDAGLAFMGVLLYFC  722

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LGLEN+S+NWWGNDLDGCP ASCP+AKG+ VEGCPV
Sbjct  723   LGLENISINWWGNDLDGCPLASCPTAKGVSVEGCPV  758



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =  1236 bits (3197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/756 (82%), Positives = 691/756 (91%), Gaps = 5/756 (1%)
 Frame = +3

Query  39    AMEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDD  218
             +ME S  EI +P + K ++ E  +G  SSS+ K+++ PE  EEENSP+ +VALTVPTTDD
Sbjct  7     SMEESTHEITSPFISKDKKDEDFYGQPSSSQPKLQN-PE--EEENSPVEQVALTVPTTDD  63

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
             PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMA++IT  
Sbjct  64    PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMASKITTH  123

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
              FF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT VKVFY KHITFFVSL+
Sbjct  124   AFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTVVKVFYKKHITFFVSLL  183

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             ++LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE RPKGG+TRTQFF+I
Sbjct  184   VILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGLTRTQFFLI  243

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AF+CSFAYYVFPGYLF+MLTSLSWICW FP +VLAQQLGSGL GLGIGAIGLDWS+ISSY
Sbjct  244   AFMCSFAYYVFPGYLFEMLTSLSWICWIFPNNVLAQQLGSGLYGLGIGAIGLDWSTISSY  303

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFATAN+A GFF ++Y+ TP+ YW +V+ AKTFPIFSD LFTS GQ YNI+A
Sbjct  304   LGSPLASPWFATANVAAGFFFVMYILTPLCYWLNVYKAKTFPIFSDTLFTSDGQEYNITA  363

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             IIDSNFHLD  AYD+EG LYLSTFFA+TYGVGFAALTAT++HV LFHGREIWEQSK+SFK
Sbjct  364   IIDSNFHLDSAAYDREGPLYLSTFFAITYGVGFAALTATIIHVALFHGREIWEQSKASFK  423

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             +++MDIHTRLM +Y QVPEWWF  IL+ NIA+T+F C+YY +QLQLPWWGVLLAC IAI 
Sbjct  424   EKQMDIHTRLMQRYNQVPEWWFVAILLVNIAVTIFTCQYYNDQLQLPWWGVLLACAIAIF  483

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKL
Sbjct  484   FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKL  543

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYD  1838
             GHYMKIPPRTMFMAQVVGT+IAG VYLGTAWWLMETIP+IC+  +  +VWTCPSD VFYD
Sbjct  544   GHYMKIPPRTMFMAQVVGTLIAGIVYLGTAWWLMETIPDICEDKS--SVWTCPSDTVFYD  601

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFG+LGTYEAVNWFFL GA+AP++VW A KAFP QEWIRLINMPVLI 
Sbjct  602   ASVIWGLIGPRRIFGNLGTYEAVNWFFLGGAVAPLVVWAAAKAFPKQEWIRLINMPVLIG  661

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             +T NMPPATAVNYT+WII+GFLSG+VV+RYRPD W+RHNYVLSGALDAGLAFMGVLLY  
Sbjct  662   STGNMPPATAVNYTSWIILGFLSGFVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFS  721

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LGLE++SL+WWGNDLDGCP A+CP+AKG+IVEGCPV
Sbjct  722   LGLEDISLSWWGNDLDGCPLATCPTAKGVIVEGCPV  757



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =  1232 bits (3188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/756 (82%), Positives = 694/756 (92%), Gaps = 3/756 (0%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGF-ASSSKSKVESLPEAAEEENSPIREVALTVPTTDD  218
             ME    EI+ PL+   E+ +  +   +SSS S++  L E   EENSP+++VALTVPTTDD
Sbjct  1     MEEETHEIRAPLISTDEKVKDPNDIPSSSSSSEINKLQET--EENSPVKQVALTVPTTDD  58

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
             PSLPVLTFRMWVLGT+SCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA+ITDR
Sbjct  59    PSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDR  118

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
             VF +GT+WEFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+VT VK+FY KHITFFVSLI
Sbjct  119   VFLKGTRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKMFYKKHITFFVSLI  178

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             +++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TR QFFVI
Sbjct  179   VIITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKEERAKGGVTRIQFFVI  238

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AFICSFAYYVFPGYLFQMLTSLSW+CW FP+SVL QQLGSGL GLGIGAIG+DWS+ISSY
Sbjct  239   AFICSFAYYVFPGYLFQMLTSLSWVCWIFPKSVLTQQLGSGLYGLGIGAIGIDWSTISSY  298

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFATAN+A GF  ++Y+ TP+ YW +V+ AKTFPIFSD+LFTSSGQ YNISA
Sbjct  299   LGSPLASPWFATANVAAGFIFVMYILTPLCYWFNVYKAKTFPIFSDDLFTSSGQEYNISA  358

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             I+DSNFHLDL AY+++G LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSK+SF+
Sbjct  359   IVDSNFHLDLAAYEKQGPLYLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSKASFQ  418

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             ++KMDIHT+LM KY+QVPE WF  IL+ NIA T+FACEYY +QLQLPWWGVLLAC IAI+
Sbjct  419   EKKMDIHTKLMRKYKQVPESWFVGILLCNIAATIFACEYYNDQLQLPWWGVLLACGIAIL  478

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIG ITAITNQTPGLN+ITEYIIGYIYPGYPVANMCFKVYGYISMTQAIAFLQDFKL
Sbjct  479   FTLPIGTITAITNQTPGLNVITEYIIGYIYPGYPVANMCFKVYGYISMTQAIAFLQDFKL  538

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYD  1838
             GHYMKIPPRTMFMAQ+VG++IA   YLGTAWWLMETI +IC TTA+N+VWTCPSD VFYD
Sbjct  539   GHYMKIPPRTMFMAQIVGSLIACLTYLGTAWWLMETITDICDTTASNSVWTCPSDTVFYD  598

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFGDLGTYEA+NWFFLAGA+APVLVWLA KAFP QEWI LINMPVLI 
Sbjct  599   ASVIWGLIGPRRIFGDLGTYEAINWFFLAGAVAPVLVWLAAKAFPKQEWITLINMPVLIG  658

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             AT  MPPATAVNYT+WII+GFLSG+VV+RYRPDLWQR+NYVLSG+LDAGLAFMGVL+YLC
Sbjct  659   ATGMMPPATAVNYTSWIILGFLSGFVVYRYRPDLWQRYNYVLSGSLDAGLAFMGVLIYLC  718

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LG+EN+S++WWGNDLDGCP A+CP+AKGI+V+GCPV
Sbjct  719   LGIENISVDWWGNDLDGCPLATCPTAKGIVVDGCPV  754



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =  1227 bits (3174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/754 (82%), Positives = 685/754 (91%), Gaps = 11/754 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E S  EIKTPLL   +E E   G ++S + +         EENSPI++VALTVPTTDDPS
Sbjct  5     ESSVHEIKTPLLSSNKE-EDEVGSSTSHRQQ--------NEENSPIKQVALTVPTTDDPS  55

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMWVLGTLSCVLLSFLNQFFWYR +PLTITAISAQIAVVPLGQLMAA IT RVF
Sbjct  56    LPVLTFRMWVLGTLSCVLLSFLNQFFWYRIQPLTITAISAQIAVVPLGQLMAATITKRVF  115

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             FRGT+WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVK+FY KHI+FFVSL++V
Sbjct  116   FRGTRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKIFYHKHISFFVSLLVV  175

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK+ERPKGG+TR+QFFVIAF
Sbjct  176   ITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKDERPKGGLTRSQFFVIAF  235

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             +CSFAYYVFPGY+FQMLTSLSWICW +P +VLAQQLGSGL GLGIGAIGLDWS+ISSYLG
Sbjct  236   LCSFAYYVFPGYIFQMLTSLSWICWLYPNNVLAQQLGSGLNGLGIGAIGLDWSTISSYLG  295

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+AVGF  ++YV TP+ YW D++NAKTFPIFSDELFT  GQ YNI+AII
Sbjct  296   SPLASPWFATANVAVGFVFVMYVLTPLCYWLDLYNAKTFPIFSDELFTEKGQVYNITAII  355

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             DSNFHLDL AY+++G+LY+STFFA+TYGVGFAALTAT++HV LFHGREIWEQSKSSFK++
Sbjct  356   DSNFHLDLAAYERQGRLYISTFFAMTYGVGFAALTATIMHVALFHGREIWEQSKSSFKEK  415

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
              +DIHT+LM +Y+QVPEWWF CIL+A IA TVF CEYY +QLQLPWWGVLLAC IAI FT
Sbjct  416   SVDIHTKLMRRYKQVPEWWFVCILMATIAATVFTCEYYNDQLQLPWWGVLLACAIAIFFT  475

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGH
Sbjct  476   LPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGH  535

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDAS  1844
             YMKIPPRTMFM QVVGT++AGFVYLGTAWWLMETIP+IC+ T+  +VWTCPSD VFYDAS
Sbjct  536   YMKIPPRTMFMGQVVGTLVAGFVYLGTAWWLMETIPDICKDTS--SVWTCPSDTVFYDAS  593

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGDLGTYE VNWFFL GAIAP+LVWLA ++FP QEWIRLINMPVLI AT
Sbjct  594   VIWGLIGPRRIFGDLGTYEKVNWFFLGGAIAPLLVWLAARSFPQQEWIRLINMPVLIGAT  653

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
               MPPATAVNYT+WII GFLSG+VVFRY+P+ W+RHNYVLSGALDAGLAFMGVLLYLCLG
Sbjct  654   GMMPPATAVNYTSWIIAGFLSGFVVFRYKPEWWKRHNYVLSGALDAGLAFMGVLLYLCLG  713

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LE++SLNWWGNDLDGC  A CP+AK + V+GC V
Sbjct  714   LEDISLNWWGNDLDGCTLAHCPTAKVVEVQGCAV  747



>ref|XP_010053083.1| PREDICTED: oligopeptide transporter 7 [Eucalyptus grandis]
Length=751

 Score =  1226 bits (3172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/754 (82%), Positives = 686/754 (91%), Gaps = 7/754 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E   +EI+ PL+ K   +    G ASSS   ++ + E   EENSP+ +VALTV TTDDPS
Sbjct  3     ESPGEEIRAPLISK---HGDTIGPASSSSPALDRVVEE-PEENSPVPQVALTVQTTDDPS  58

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLG+LMAARITDRVF
Sbjct  59    LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMAARITDRVF  118

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
              +GT+WEFTLNPGPFNVKEHVLITIFANSGAGTVYAI+VVT VKVFY K ITFFVSLI+V
Sbjct  119   LKGTRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIYVVTVVKVFYKKQITFFVSLIVV  178

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TRTQFF+IAF
Sbjct  179   ITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRTQFFLIAF  238

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             ICSFAYYVFPGY+F+MLTS+SWICW FP+SVLAQQLGSGL GLGI A GLDWS+ISSYLG
Sbjct  239   ICSFAYYVFPGYIFEMLTSMSWICWIFPKSVLAQQLGSGLYGLGITAFGLDWSTISSYLG  298

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+AVGF  ++YV TPI YW +V+ AKTFPIFSD+LFTS+GQ YNIS+II
Sbjct  299   SPLASPWFATANVAVGFVFVMYVLTPICYWLNVYKAKTFPIFSDDLFTSTGQEYNISSII  358

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             D+NFHLDL AY++EG LYLSTFFA+TYGVGFA+LTAT+VHV LFHGREIW QSK+SF+D+
Sbjct  359   DANFHLDLAAYEKEGPLYLSTFFAMTYGVGFASLTATVVHVALFHGREIWAQSKASFQDK  418

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
               DIHTR+M +Y+QVPEWWFWCILV NIA T+FACEYY  QLQLPWWGVLLAC+IAI+FT
Sbjct  419   TADIHTRMMRRYQQVPEWWFWCILVVNIAATIFACEYYNSQLQLPWWGVLLACLIAIVFT  478

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQDFKLGH
Sbjct  479   LPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGH  538

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDAS  1844
             YMKIPP+TMFMAQVVGT+IAG VYL TAWWLMETIP+IC+T+   +VWTCPSD VFYDAS
Sbjct  539   YMKIPPKTMFMAQVVGTLIAGVVYLSTAWWLMETIPDICETS---SVWTCPSDTVFYDAS  595

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGD GTYEA+NWFFL GAIAP+LVWLA KAFP QEWI LINMPVLI AT
Sbjct  596   VIWGLIGPRRIFGDEGTYEAINWFFLGGAIAPILVWLAHKAFPEQEWISLINMPVLIGAT  655

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
               MPPATAVNYTTWII GFLSG+VV+RYRP+LW+++NYVLSGALDAGLAFMGVLLYLCLG
Sbjct  656   GYMPPATAVNYTTWIIAGFLSGFVVYRYRPELWKKYNYVLSGALDAGLAFMGVLLYLCLG  715

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LE++ L+WWGNDLDGCP A+CP+A G++VEGCPV
Sbjct  716   LESIDLDWWGNDLDGCPLATCPTAVGVVVEGCPV  749



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =  1226 bits (3172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/760 (81%), Positives = 689/760 (91%), Gaps = 5/760 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEY---EGRHGFASSSKSKVESLPEAAEEE--NSPIREVALTVPT  209
             E SADEI+ PL+   +E    +  +  +SS  ++V  + +  EEE  NSPI +VALTVPT
Sbjct  3     ESSADEIRAPLIISKDEDINDDDVYAISSSKSNEVHHVYDEEEEEEENSPIPQVALTVPT  62

Query  210   TDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARI  389
             TDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTITAISAQ+AVVPLGQLMAA++
Sbjct  63    TDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQVAVVPLGQLMAAKL  122

Query  390   TDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFV  569
                 FF+G++WEF+LNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VK FY +HITFFV
Sbjct  123   PKGAFFKGSRWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKAFYKRHITFFV  182

Query  570   SLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQF  749
             SLI+VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TRTQF
Sbjct  183   SLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRTQF  242

Query  750   FVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSI  929
             F+IAFI SFAYYVFPGYLFQMLTSLSW+CW FP S+LAQQLGSGL GLGIGAIGLDWS+I
Sbjct  243   FLIAFISSFAYYVFPGYLFQMLTSLSWLCWIFPTSILAQQLGSGLNGLGIGAIGLDWSTI  302

Query  930   SSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYN  1109
             SSYLGSPLASPWFATAN+A GF L++YV TP+ YW D++ AKTFPIFSDELF + GQ Y+
Sbjct  303   SSYLGSPLASPWFATANVAAGFVLVMYVLTPLAYWLDLYKAKTFPIFSDELFNARGQVYD  362

Query  1110  ISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKS  1289
             I+AIIDSNFHLD+ AY+++G LYLSTFFA+TYG+GFAALTAT+ HV LFHG EIWEQSKS
Sbjct  363   IAAIIDSNFHLDIAAYERQGPLYLSTFFAMTYGIGFAALTATITHVCLFHGSEIWEQSKS  422

Query  1290  SFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVI  1469
             SFK++KMDIHTRLMSKY QVPEWWFWCILVANIAL +F CEYY EQLQLPWWGVLLAC+I
Sbjct  423   SFKEKKMDIHTRLMSKYNQVPEWWFWCILVANIALAIFVCEYYNEQLQLPWWGVLLACLI  482

Query  1470  AIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQD  1649
             AI FTLPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISM+QAI FLQD
Sbjct  483   AIFFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMSQAITFLQD  542

Query  1650  FKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHV  1829
             FKLGHYMK+PPRTMFMAQVVGT+IA  VYLGTAWWL+ETIP+IC+TT++ +VWTCP D V
Sbjct  543   FKLGHYMKVPPRTMFMAQVVGTLIAAIVYLGTAWWLLETIPDICETTSSQSVWTCPGDRV  602

Query  1830  FYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPV  2009
             FYDASVIWGLIGPRRIFGDLGTY  VNWFFL GAIAP+LVWLA +AFP Q WI+LINMPV
Sbjct  603   FYDASVIWGLIGPRRIFGDLGTYAMVNWFFLGGAIAPLLVWLAARAFPNQHWIKLINMPV  662

Query  2010  LISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLL  2189
             LI AT +MPPATAVNYTTWIIVGFLSGYV +RYRP+ W+R NYVLSGALDAGLAFMGVLL
Sbjct  663   LIGATGSMPPATAVNYTTWIIVGFLSGYVWYRYRPESWRRFNYVLSGALDAGLAFMGVLL  722

Query  2190  YLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             Y+ LGLE++SL+WWGNDLDGCPYA+CP+AKG++VEGCPVI
Sbjct  723   YMALGLEDISLSWWGNDLDGCPYATCPTAKGVVVEGCPVI  762



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =  1222 bits (3162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/755 (82%), Positives = 690/755 (91%), Gaps = 11/755 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEE-YEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             E S+ EI +PL+PK E+ +EG HG +SSS S  E          SP+++VALTVPTTDDP
Sbjct  11    EASSHEITSPLIPKEEKKHEGFHGQSSSSGSTEEEN--------SPVKQVALTVPTTDDP  62

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMA++IT+RV
Sbjct  63    SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMASKITNRV  122

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VKVFY +HITFFVSL++
Sbjct  123   FFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKRHITFFVSLLV  182

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             +LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE RPKGG+TRTQFF+I+
Sbjct  183   ILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGLTRTQFFLIS  242

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F+CSFAYYVFPGYLFQMLTSLSWICW FP +VLAQQLGSGL GLGIGA+GLDWS+ISSYL
Sbjct  243   FMCSFAYYVFPGYLFQMLTSLSWICWIFPNNVLAQQLGSGLYGLGIGAVGLDWSTISSYL  302

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GFF ++Y+ TPI YW +++ AKTFPIFSD LFTS GQ YNI+AI
Sbjct  303   GSPLASPWFATANVAAGFFFVMYILTPICYWFNIYKAKTFPIFSDTLFTSDGQEYNITAI  362

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLD EAYD+EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSK+SFK+
Sbjct  363   IDSNFHLDSEAYDREGPLYLSTFFAVTYGVGFAALTATVVHVALFHGREIWEQSKASFKE  422

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHTRLM +Y QVPEWWF  IL+ NIA+T+F+C+YY EQLQLPWWGVLLAC IAI+F
Sbjct  423   KKMDIHTRLMQRYNQVPEWWFVIILLVNIAVTIFSCQYYIEQLQLPWWGVLLACAIAIVF  482

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLG
Sbjct  483   TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLG  542

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMFMAQVVGT+IA  VYL TAWWLMETIP+IC+ T+  +VWTCPSD VFYDA
Sbjct  543   HYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLMETIPDICEDTS--SVWTCPSDKVFYDA  600

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFGDLG YEA+NWFFL GAIAP+ VWLA KAFP QEWIRLINMPVLI A
Sbjct  601   SVIWGLIGPRRIFGDLGIYEAINWFFLVGAIAPIFVWLAAKAFPQQEWIRLINMPVLIGA  660

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNYT+WII+GFLSG+VV+RYRP+ W+RHNYVLSGALDAGLAFMGVLLY  L
Sbjct  661   TGYMPPATAVNYTSWIILGFLSGFVVYRYRPEWWRRHNYVLSGALDAGLAFMGVLLYFSL  720

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             GLE++SL+WWGNDLDGCP A+CP+AKG++VEGCP+
Sbjct  721   GLEDISLSWWGNDLDGCPLATCPTAKGVVVEGCPI  755



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/762 (80%), Positives = 685/762 (90%), Gaps = 10/762 (1%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAA--------EEENSPIREVALTVP  206
             S D    PL+ K  +    H   S+S S  + L  ++        E E SPI++VALTVP
Sbjct  3     SQDLSTIPLISKTRDDAEDHSRPSTSYSLSQVLASSSQSSAHDFSESEISPIKQVALTVP  62

Query  207   TTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAR  386
             TTDD +LPVLTFRMWVLGT+SC+LLSFLNQFFWYRTEPLTITAISAQIAVVPLG+LMA+ 
Sbjct  63    TTDDHTLPVLTFRMWVLGTVSCILLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMASM  122

Query  387   ITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFF  566
             IT+RVFF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VTAVK+FY K+ITFF
Sbjct  123   ITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTAVKIFYKKNITFF  182

Query  567   VSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQ  746
             VSLI+V+TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQ
Sbjct  183   VSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERGKGGLTRTQ  242

Query  747   FFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSS  926
             FF+IAFICSFAYY+FPGYLF MLTSLSW+CW FP+S+LAQQLGSGL GLG+GAIG+DWS+
Sbjct  243   FFLIAFICSFAYYIFPGYLFPMLTSLSWVCWIFPKSILAQQLGSGLYGLGLGAIGVDWST  302

Query  927   ISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTY  1106
             ISSYLGSPLASPWFATAN+  GFF+++Y+ TPI YW +V+ AKTFPIFS++LFTSSGQTY
Sbjct  303   ISSYLGSPLASPWFATANVGAGFFIVMYILTPIMYWLNVYKAKTFPIFSEDLFTSSGQTY  362

Query  1107  NISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSK  1286
             NIS+IIDSNFHLD++AYD+ G LYLSTFFA+TYGVGFAALTAT+VHV+LFHG EIWEQSK
Sbjct  363   NISSIIDSNFHLDIQAYDKNGPLYLSTFFAMTYGVGFAALTATIVHVLLFHGSEIWEQSK  422

Query  1287  SSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACV  1466
             S+FK++KMDIHTRLM +Y QVPEWWF CILVANIA T+FACEYY +QLQLPWWGVLLAC 
Sbjct  423   SAFKEKKMDIHTRLMRRYNQVPEWWFVCILVANIAATIFACEYYNDQLQLPWWGVLLACG  482

Query  1467  IAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQ  1646
             +AI+FTLPIGIITA TNQTPGLNIITEYIIGY+YPG PVAN+CFKVYGYISMTQA+ FLQ
Sbjct  483   LAILFTLPIGIITATTNQTPGLNIITEYIIGYLYPGRPVANICFKVYGYISMTQAVTFLQ  542

Query  1647  DFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPS  1820
             DFKLGHYMKIPPRTMFMAQVVGT+IAG VYLGT WWLMETIP IC T+   +++ WTCPS
Sbjct  543   DFKLGHYMKIPPRTMFMAQVVGTLIAGLVYLGTGWWLMETIPNICDTSVLPSDSPWTCPS  602

Query  1821  DHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLIN  2000
             D VFYDASVIWGLIGPRRIFGDLGTYEA+NWFFLAGA+APVLVW A KAFP Q WIRLIN
Sbjct  603   DRVFYDASVIWGLIGPRRIFGDLGTYEAINWFFLAGAVAPVLVWFAHKAFPEQNWIRLIN  662

Query  2001  MPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMG  2180
             MP+LI AT  MPPATAVNYT+W+IVGFLSG++++RYR D WQRHNYVLSGALDAGLAFM 
Sbjct  663   MPILIGATGMMPPATAVNYTSWVIVGFLSGFLLYRYRQDWWQRHNYVLSGALDAGLAFMA  722

Query  2181  VLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             VLLYLCLGLE ++L+WWG+DLDGCP ASCP+AKG++VEGCPV
Sbjct  723   VLLYLCLGLEGITLSWWGSDLDGCPLASCPTAKGVVVEGCPV  764



>ref|XP_006476309.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Citrus 
sinensis]
Length=759

 Score =  1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/759 (80%), Positives = 689/759 (91%), Gaps = 6/759 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVE--EYEGRHGFASSSKSKVESLPEAA--EEENSPIREVALTVPT  209
             ME SA EI+TPL+ + +  + EG   ++S ++S+ E + EAA  EEENSP+++VALTV T
Sbjct  1     MEESAHEIRTPLISRDDGGDNEGEE-YSSMAESQSE-ITEAAVEEEENSPVKQVALTVST  58

Query  210   TDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARI  389
              DD  LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA++
Sbjct  59    EDDSCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKL  118

Query  390   TDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFV  569
             TDRVFF+ T  EFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+VT VKVFY +H TFFV
Sbjct  119   TDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKVFYKQHFTFFV  178

Query  570   SLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQF  749
             SL++V TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE+E+R  GG+TRTQF
Sbjct  179   SLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEREKRASGGVTRTQF  238

Query  750   FVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSI  929
             F+I F+CSFAYYVFPGYL +MLTSLSWICW FP+SV+AQQ+GSGL GLG+ A+G+DWS+I
Sbjct  239   FMIGFVCSFAYYVFPGYLLEMLTSLSWICWIFPKSVVAQQVGSGLFGLGVAAVGIDWSTI  298

Query  930   SSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYN  1109
             SSYLGSPLASPWFATAN+A GF L++YV TP+ YW +++NAKTFPIFSD+LFT++G+ YN
Sbjct  299   SSYLGSPLASPWFATANVAAGFVLVMYVLTPLCYWLNIYNAKTFPIFSDQLFTTTGREYN  358

Query  1110  ISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKS  1289
             I+AIIDSNFH+D+ AY +EG LYLS FFA+TYG+GFAALTAT+VHV LFHGREIWEQS++
Sbjct  359   ITAIIDSNFHIDIAAYQREGPLYLSIFFAMTYGLGFAALTATIVHVALFHGREIWEQSRA  418

Query  1290  SFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVI  1469
             SF+++ +DIHT+LM KY++VPE WF  IL+ NIA TVFACEYY +QLQLPWWGVLLAC I
Sbjct  419   SFQEKGIDIHTKLMRKYKRVPESWFVIILLINIAATVFACEYYNDQLQLPWWGVLLACAI  478

Query  1470  AIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQD  1649
             AI FTLPIGIITAITNQTPGLNIITEYIIGY+YPGYPVANMCFKVYGYISMTQA+ FLQD
Sbjct  479   AITFTLPIGIITAITNQTPGLNIITEYIIGYVYPGYPVANMCFKVYGYISMTQAVTFLQD  538

Query  1650  FKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHV  1829
             FKLGHYMKIPPRTMFMAQ+VGTVIA FVYLGTAWWLME+I +IC T A N+VWTCPSD V
Sbjct  539   FKLGHYMKIPPRTMFMAQIVGTVIACFVYLGTAWWLMESITDICDTKAANSVWTCPSDKV  598

Query  1830  FYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPV  2009
             FYDASVIWGLIGPRRIFGDLGTYEA+NWFFLAGAIAP LVWL +KAFP QEWI LINMPV
Sbjct  599   FYDASVIWGLIGPRRIFGDLGTYEAINWFFLAGAIAPSLVWLGSKAFPNQEWITLINMPV  658

Query  2010  LISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLL  2189
             LI AT+ MPPATAVNYTTWI+ GFLSG+VV+RYRPDLWQR+NYVLSGALDAGLAFMGVLL
Sbjct  659   LIGATAMMPPATAVNYTTWIVAGFLSGFVVYRYRPDLWQRYNYVLSGALDAGLAFMGVLL  718

Query  2190  YLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             YLCLGLE+V+L+WWGNDLDGCPYA+CP+A+GI VEGCPV
Sbjct  719   YLCLGLEDVTLDWWGNDLDGCPYATCPTARGIAVEGCPV  757



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =  1216 bits (3147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/756 (81%), Positives = 684/756 (90%), Gaps = 4/756 (1%)
 Frame = +3

Query  39    AMEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDD  218
             +ME S  EI +PL+ K ++ E  +G  SSS+ K+++     EEENSP+ +VALTVPTTDD
Sbjct  7     SMEESTHEITSPLISKDKKDEDFYGQPSSSQPKLKN--PEEEEENSPVEQVALTVPTTDD  64

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
             PSLPVLTFRMWVLGTLSC+LLSFLNQFFWYR EPL+ITAISAQIAVVPLGQLMA++IT  
Sbjct  65    PSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQIAVVPLGQLMASKITTH  124

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
              FF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VKVFY KHITFFVSL+
Sbjct  125   AFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKKHITFFVSLL  184

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             ++LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE RPKGG+TRTQFF+I
Sbjct  185   VILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGVTRTQFFLI  244

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AFICSFAYYVFPGYLF+MLTSLSWICW FP+SVLAQQLGSGL GLGIG +G+DWS+ISSY
Sbjct  245   AFICSFAYYVFPGYLFEMLTSLSWICWIFPKSVLAQQLGSGLYGLGIGTVGIDWSTISSY  304

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFATAN+A GFFL++Y+ TP  YW +V+ AKTFPIFS  +F S G+ YNI+A
Sbjct  305   LGSPLASPWFATANVAAGFFLVMYILTPFCYWFNVYKAKTFPIFSSTMFKSDGEEYNITA  364

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             IIDSNFHLD  AY++EG LYLS  FA+TYGVGFAALTAT+VHV LFHGREIWEQSK+SFK
Sbjct  365   IIDSNFHLDSAAYNREGPLYLSIIFAITYGVGFAALTATIVHVALFHGREIWEQSKASFK  424

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             +++MDIHTRLM +Y+QVPEWWF  IL+ NIA+T+F C+YY +QLQLPWWGVLLAC IAI 
Sbjct  425   EKQMDIHTRLMQRYKQVPEWWFVVILLVNIAVTIFTCQYYNDQLQLPWWGVLLACAIAIF  484

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKL
Sbjct  485   FTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKL  544

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYD  1838
             GHYMKIPPRTMFMAQVVGT+IA  VYLGTAWWLMETIP+IC+ T+  +VWTCP D VFYD
Sbjct  545   GHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMETIPDICEDTS--SVWTCPGDTVFYD  602

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFG+ GTYEA+NWFFL GA+AP++VW A KAFP QEWIRLINMPVLI 
Sbjct  603   ASVIWGLIGPRRIFGNKGTYEAINWFFLGGAVAPLVVWAAAKAFPKQEWIRLINMPVLIG  662

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             AT NMPPATAVNYT+WII+GFLSG+VV+RYRPD W+RHNYVLSGALDAGLAFMGVLLY  
Sbjct  663   ATGNMPPATAVNYTSWIILGFLSGFVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFS  722

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LGLE++SLNWWGNDLDGCP A+CP+AKG+IVEGCPV
Sbjct  723   LGLEDISLNWWGNDLDGCPLATCPTAKGVIVEGCPV  758



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =  1215 bits (3143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/754 (82%), Positives = 689/754 (91%), Gaps = 11/754 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEE-YEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             E S+ EI + L+PK E+ +EG HG +SSS S  E          SP+ +VALTVPTTDDP
Sbjct  11    EASSHEITSLLIPKEEKKHEGFHGQSSSSGSTEEEN--------SPVEQVALTVPTTDDP  62

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMA++IT+RV
Sbjct  63    SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMASKITNRV  122

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VKVFY KHITFFVSL++
Sbjct  123   FFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKKHITFFVSLLV  182

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             +LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE RPKGG+TRTQFF+I+
Sbjct  183   ILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGLTRTQFFLIS  242

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F+CSFAYYVFPGYLFQMLTSLSWICW FP +VLAQQLGSGL GLGIGA+G+DWS+ISSYL
Sbjct  243   FMCSFAYYVFPGYLFQMLTSLSWICWIFPNNVLAQQLGSGLYGLGIGAVGIDWSTISSYL  302

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GFF ++Y+ TPI YW +++ AKTFPIFSD LFTS+GQ YNI+AI
Sbjct  303   GSPLASPWFATANVAAGFFFVMYILTPICYWFNIYKAKTFPIFSDTLFTSNGQEYNITAI  362

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLDLEAY++EG LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSK+SFK+
Sbjct  363   IDSNFHLDLEAYEREGPLYLSTFFAITYGVGFAALTATVVHVALFHGREIWEQSKASFKE  422

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMD+HTRLM +Y QVPEWWF  IL+ NIA+T+F+C+YY EQLQLPWWGVLLACVIAI+F
Sbjct  423   KKMDVHTRLMQRYNQVPEWWFVIILLVNIAVTIFSCQYYIEQLQLPWWGVLLACVIAIVF  482

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYG ISMTQAI FLQDFKLG
Sbjct  483   TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGXISMTQAITFLQDFKLG  542

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMF AQVVGT+IA  VYLGTAWWLMETIP+IC+ T+  ++WTCPSD VFYDA
Sbjct  543   HYMKIPPRTMFTAQVVGTLIAAIVYLGTAWWLMETIPDICEDTS--SIWTCPSDTVFYDA  600

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFGDLG YEA+NWFFL GAIAP+ VWLA KAFP QEWIRLINMPVLI A
Sbjct  601   SVIWGLIGPRRIFGDLGIYEAINWFFLVGAIAPIFVWLAAKAFPQQEWIRLINMPVLIGA  660

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNYT+WII+GFLSG+VV+RYRP+ W+RHNYVLSGALDAGLAFMGVLLY  L
Sbjct  661   TGLMPPATAVNYTSWIILGFLSGFVVYRYRPNWWRRHNYVLSGALDAGLAFMGVLLYFSL  720

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             GLE++SL+WWGNDLDGCP A+CP+AKG++VEGCP
Sbjct  721   GLEDISLSWWGNDLDGCPLATCPTAKGVVVEGCP  754



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7-like [Fragaria vesca subsp. 
vesca]
Length=749

 Score =  1215 bits (3143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/754 (82%), Positives = 678/754 (90%), Gaps = 15/754 (2%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E + DEI  PL+ + EE     G  SSS       PE  EEENSP+++VALTVPT DDPS
Sbjct  9     EHNQDEITAPLISRDEE-----GQTSSSP------PE--EEENSPVKQVALTVPTGDDPS  55

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAA IT RVF
Sbjct  56    LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAANITTRVF  115

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             F+GT+WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VKVFY +HITFFVSL+++
Sbjct  116   FKGTRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKQHITFFVSLLVI  175

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE+EERPKGG+TRTQFF+IAF
Sbjct  176   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEREERPKGGVTRTQFFLIAF  235

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             +CSFAYYVFPGYLF MLTSLSWICW FP SVLAQQ+GSGL GLG+GA+GLDWS+ISSYLG
Sbjct  236   MCSFAYYVFPGYLFTMLTSLSWICWIFPSSVLAQQIGSGLYGLGLGAVGLDWSTISSYLG  295

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+A GF  ++YV TPI YW +++ AKTFPIFSDELFT  GQ Y+I+AII
Sbjct  296   SPLASPWFATANVAAGFVFVMYVLTPICYWLNLYKAKTFPIFSDELFTEDGQEYDITAII  355

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             DSNFHL++ AY++EG LY+STFFA+TYGVGFAALTAT+VHV LFHGREIWEQSKSSFK++
Sbjct  356   DSNFHLNITAYEEEGPLYISTFFAMTYGVGFAALTATVVHVALFHGREIWEQSKSSFKEK  415

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
             +MDIHTRLM +Y  VPEWWF  IL+ NIALT+F CEYY +QLQLPWWGVLLAC IAI+FT
Sbjct  416   RMDIHTRLMQRYNPVPEWWFVAILLTNIALTIFTCEYYNDQLQLPWWGVLLACAIAILFT  475

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGH
Sbjct  476   LPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGH  535

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDAS  1844
             YMKIPPRTMFMAQVVGT+IA FVYL TAWWLMETIP IC  T T +VWTCP D VFYDAS
Sbjct  536   YMKIPPRTMFMAQVVGTLIAAFVYLCTAWWLMETIPGIC--TDTTSVWTCPMDTVFYDAS  593

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             V+WGLIGPRRIFGDLGTY AVNWFFLAGAIAPVLVWLA KAFP QEWIRLINMPVLI AT
Sbjct  594   VLWGLIGPRRIFGDLGTYAAVNWFFLAGAIAPVLVWLAAKAFPQQEWIRLINMPVLIGAT  653

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              +MPPATAVNYT+WII+GFLSG+VV+RYRPD W+RHNYVLSGALDAGLAFMGVLLY  +G
Sbjct  654   GSMPPATAVNYTSWIILGFLSGFVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFTVG  713

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LE +S++WWGNDLDGCP A CP+A G+IV GCPV
Sbjct  714   LEEISVDWWGNDLDGCPLAECPTAVGVIVAGCPV  747



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =  1214 bits (3142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/717 (83%), Positives = 664/717 (93%), Gaps = 0/717 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
              +ENSP+++VA+TVPT DDP LPVLTFRMW LGTLSCV+LSFLNQFFWYRTEPL+ITAIS
Sbjct  46    NKENSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSITAIS  105

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLGQLMAA++  R F RGT+WEFTLNPGPFN+KEHVLITIFAN+GAG+VYAIHV
Sbjct  106   AQIAVVPLGQLMAAKLPSRPFLRGTRWEFTLNPGPFNIKEHVLITIFANAGAGSVYAIHV  165

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             VT VK+FY K ITFFVSLI+VLTTQVLGFGWAGIFRRYLVEPA MWWPANLVQVSLFRAL
Sbjct  166   VTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRAL  225

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKEER KGG+TRTQFF+I+FICSFAYYVFPGYLFQMLTSLSWICW +P+S+LAQQLGSG
Sbjct  226   HEKEERAKGGLTRTQFFLISFICSFAYYVFPGYLFQMLTSLSWICWLWPKSILAQQLGSG  285

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             L GLGI A GLDWS+ISSYLGSPLASPWFATAN+A GF  ++YV TPI YW +V+ AKTF
Sbjct  286   LYGLGITAFGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYVLTPISYWLNVYKAKTF  345

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFSD+LFTS+G  YNISAI+DSNFH++ EAY+++G LYLSTFF++TYGVGFAAL+AT+V
Sbjct  346   PIFSDDLFTSNGSIYNISAIVDSNFHINQEAYEKQGPLYLSTFFSMTYGVGFAALSATVV  405

Query  1242  HVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYK  1421
             HV LFHGREIWEQSK+SFKD+KMDIHT+LM++Y++ PEWWFW ILV NIA T+FACEYYK
Sbjct  406   HVALFHGREIWEQSKASFKDKKMDIHTKLMTRYKEAPEWWFWVILVINIAATIFACEYYK  465

Query  1422  EQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFK  1601
             EQLQLPWWGVLLAC IA IFTLPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFK
Sbjct  466   EQLQLPWWGVLLACAIAFIFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFK  525

Query  1602  VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC  1781
             VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGT+I+ FVYLGTAWWLME+IP++C
Sbjct  526   VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTLISAFVYLGTAWWLMESIPDMC  585

Query  1782  QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
             + TA NTVWTCPSD VFYDASVIWGLIGPRRIFG+ G YE +NWFFL GAIAP+LVWLAT
Sbjct  586   EKTARNTVWTCPSDTVFYDASVIWGLIGPRRIFGNEGVYETINWFFLGGAIAPILVWLAT  645

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             K FP QEWIRLINMPVLI+AT  MPPATAVNYTTWI+VGFLSGYV FRY P+ W+RHNY+
Sbjct  646   KTFPNQEWIRLINMPVLIAATGMMPPATAVNYTTWILVGFLSGYVAFRYAPEWWERHNYL  705

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LSGALDAGLAFMGV LYLCLGLE VSL+WWGNDLDGCPYASCP+ KGI+V+GCPV+Y
Sbjct  706   LSGALDAGLAFMGVALYLCLGLEEVSLSWWGNDLDGCPYASCPTEKGIMVQGCPVVY  762



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =  1209 bits (3129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/755 (80%), Positives = 682/755 (90%), Gaps = 11/755 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGR-HGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             E S+ EI +PL+P+ ++  G  HG +SS +S         +EENSP+ +VALTVPTTDDP
Sbjct  3     EASSHEITSPLIPEEDKKHGDFHGQSSSFQS--------TDEENSPVEQVALTVPTTDDP  54

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA++IT+RV
Sbjct  55    SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMASKITNRV  114

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VTAVKVFY KHITFFVSL++
Sbjct  115   FFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTAVKVFYKKHITFFVSLLV  174

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             +LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE R KGG+TRTQFF+IA
Sbjct  175   ILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEVRHKGGLTRTQFFLIA  234

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F+CSFAYYVFPGYLFQMLTSLSWICW FP +VLAQQLGSGL GLGIGA+G+DWS+IS+YL
Sbjct  235   FMCSFAYYVFPGYLFQMLTSLSWICWIFPTNVLAQQLGSGLHGLGIGAVGVDWSTISAYL  294

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GFF ++Y+ TP+ YW +++ AKTFPIFS+ +FTS GQ YNI+AI
Sbjct  295   GSPLASPWFATANVAAGFFFVMYILTPLSYWFNIYKAKTFPIFSNSMFTSDGQEYNITAI  354

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLD +AY+QEG LY+S  F +TYGV FAALTAT+VHV LFHGREIWEQSK+SFK+
Sbjct  355   IDSNFHLDYDAYEQEGHLYISIIFTITYGVSFAALTATIVHVALFHGREIWEQSKASFKE  414

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHTRLM +Y QVPEWWF  IL+ANIALT+F C+YY +QLQLPWWGVLLAC IAI F
Sbjct  415   KKMDIHTRLMQRYNQVPEWWFVVILLANIALTIFTCQYYNDQLQLPWWGVLLACGIAIFF  474

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQ PGLN+ITEYIIGYIYPGYPVANMCFKV GYISM+QA+ FLQDFKLG
Sbjct  475   TLPIGIITAITNQGPGLNVITEYIIGYIYPGYPVANMCFKVXGYISMSQAVTFLQDFKLG  534

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMFMAQVVGT+IA  VYL TAWWLMETIP+IC+   T +VWTCP D VFYDA
Sbjct  535   HYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLMETIPDICED--TTSVWTCPGDTVFYDA  592

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFGDLG YEAVNWFFL GAIAP+ VWLA KAFP QEWI LINMPVL+ A
Sbjct  593   SVIWGLIGPRRIFGDLGRYEAVNWFFLVGAIAPIFVWLAVKAFPRQEWIGLINMPVLMGA  652

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             TS+MPPATAVNYT+WII+GFLSG+VV+RYRP+ W+RHNYVLSGALDAGLAFMGVLLY  L
Sbjct  653   TSSMPPATAVNYTSWIILGFLSGFVVYRYRPNWWKRHNYVLSGALDAGLAFMGVLLYFSL  712

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             GLE++SL+WWGNDLDGCP A+CP+AKG++VEGCP+
Sbjct  713   GLEDISLSWWGNDLDGCPLATCPTAKGVVVEGCPI  747



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =  1204 bits (3114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/746 (80%), Positives = 675/746 (90%), Gaps = 2/746 (0%)
 Frame = +3

Query  72    PLLPKVEEYEGRHGFASSSKSKVESLP-EAAEEENSPIREVALTVPTTDDPSLPVLTFRM  248
             PLL K ++        +  +++  SLP    EEENSPIR+VALTVPTTDDPSLPVLTFRM
Sbjct  9     PLLTKPKDENSASSCENRDETEDLSLPISEEEEENSPIRQVALTVPTTDDPSLPVLTFRM  68

Query  249   WVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEF  428
             WVLGTLSC+LLSFLNQFFWYRTEPLTI+AISAQIAVVPLG+LMAA+I+DRVF +G+ WEF
Sbjct  69    WVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVFLQGSYWEF  128

Query  429   TLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGF  608
             TLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT VK FY K+ITFFVSLI+++TTQVLGF
Sbjct  129   TLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTVVKAFYMKNITFFVSLIVIVTTQVLGF  188

Query  609   GWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYV  788
             GWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TRTQFF+IAF+CSFAYYV
Sbjct  189   GWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKEERAKGGVTRTQFFLIAFVCSFAYYV  248

Query  789   FPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWF  968
             FPGYLFQM+TSLSW+CWFFP SV+AQQ+GSGL GLG+GAIGLDWS+ISSYLGSPLASPWF
Sbjct  249   FPGYLFQMMTSLSWVCWFFPTSVMAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWF  308

Query  969   ATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDL  1148
             ATAN+ VGF L +YV  PI YW DV+ AKTFP+FS  LFT+ G  YNI+ IIDSNFHLDL
Sbjct  309   ATANVGVGFVLAIYVLIPICYWLDVYQAKTFPLFSSSLFTNQGSKYNITTIIDSNFHLDL  368

Query  1149  EAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRL  1328
             +AY++EG LYLSTFFA++YG+GFAAL+AT++HV LFHGREIWEQSK SFK++K+D+H RL
Sbjct  369   QAYEREGPLYLSTFFAISYGIGFAALSATIMHVALFHGREIWEQSKESFKEKKLDVHARL  428

Query  1329  MSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITA  1508
             M +Y+QVP+WWFWCILV N+  T+FACEYY +QLQLPWWGVLLAC IAIIFTLPIGIITA
Sbjct  429   MKRYKQVPDWWFWCILVTNVGATIFACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITA  488

Query  1509  ITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRT  1688
             ITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGYISM QAI FLQDFKLGHYMKIPPRT
Sbjct  489   ITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRT  548

Query  1689  MFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGP  1868
             MFMAQ+VGT+I+  VYL TAWWLMETIP IC +  TN++WTCP D VFYDASVIWGLIGP
Sbjct  549   MFMAQIVGTLISCLVYLVTAWWLMETIPNICDSV-TNSLWTCPGDKVFYDASVIWGLIGP  607

Query  1869  RRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATA  2048
             RRIFGDLG Y++VNWFFL GAIAP+LVW+A++ FP QEWI+L+NMPVLISA S+MPPATA
Sbjct  608   RRIFGDLGLYKSVNWFFLVGAIAPILVWIASRMFPRQEWIKLVNMPVLISAISSMPPATA  667

Query  2049  VNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNW  2228
             VNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSGALDAGLAFMGVLLY+CLGLEN+SL+W
Sbjct  668   VNYTTWLLAGFLSGFVVFRYRPNLWQRYNYVLSGALDAGLAFMGVLLYMCLGLENISLDW  727

Query  2229  WGNDLDGCPYASCPSAKGIIVEGCPV  2306
             WGNDLDGCP A+CP+A GI VEGCP+
Sbjct  728   WGNDLDGCPLAACPTAPGISVEGCPL  753



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =  1203 bits (3113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/749 (81%), Positives = 678/749 (91%), Gaps = 4/749 (1%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI +PL+ K ++ E  +G  SSS+ K+++     EEENSP+ +VALTVPTTDDPSLPVLT
Sbjct  14    EITSPLISKDKKDEDFYGQPSSSQPKLQN--PEEEEENSPVEQVALTVPTTDDPSLPVLT  71

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FRMWVLGTLSCVLLSFLNQFFWYR EPL+ITAISAQIAVVPLGQLMA++IT   FF+G++
Sbjct  72    FRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQIAVVPLGQLMASKITTHAFFKGSR  131

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VT VKVFY KHITFFVSL+++LTTQV
Sbjct  132   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKKHITFFVSLLVILTTQV  191

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE RPKGG+TRTQFF+IAFICSFA
Sbjct  192   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGLTRTQFFLIAFICSFA  251

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYLF+MLTSLSWICW FP+SVLAQQLGSGL GLGIG IGLDWS+ISSYLGSPLAS
Sbjct  252   YYVFPGYLFEMLTSLSWICWIFPKSVLAQQLGSGLYGLGIGTIGLDWSTISSYLGSPLAS  311

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+A GF L++Y+ TP  YW +V+ AKTFPIFS  +F S G+ YNI+AIIDSNFH
Sbjct  312   PWFATANVAAGFVLVMYILTPFCYWFNVYKAKTFPIFSSTMFKSDGEEYNITAIIDSNFH  371

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
             LD  AY++EG LYLS  F +TYGVGFAALTAT+VHV LFHGREIWEQSK+SFK+++MDIH
Sbjct  372   LDSAAYNREGPLYLSIIFVITYGVGFAALTATIVHVALFHGREIWEQSKASFKEKEMDIH  431

Query  1320  TRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGI  1499
             TRLM +Y+QVPEWWF  IL+ NIA+T+F C+YY +QLQLPWWGVLLAC IAI FTLPIGI
Sbjct  432   TRLMQRYKQVPEWWFVVILLVNIAVTIFTCQYYNDQLQLPWWGVLLACAIAIFFTLPIGI  491

Query  1500  ITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIP  1679
             ITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGHYMKIP
Sbjct  492   ITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIP  551

Query  1680  PRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGL  1859
             PRTMFMAQVVGT+IA  VYLGTAWWLMETIP+IC+ T+  +VWTCP D VFYDASVIWGL
Sbjct  552   PRTMFMAQVVGTLIAAIVYLGTAWWLMETIPDICEDTS--SVWTCPGDTVFYDASVIWGL  609

Query  1860  IGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPP  2039
             IGPRRIFG+ GTYEAVNWFFL GA+AP++VW A KAFP QEWIRLINMPVLI AT +MPP
Sbjct  610   IGPRRIFGNEGTYEAVNWFFLGGAVAPLVVWAAAKAFPKQEWIRLINMPVLIGATGSMPP  669

Query  2040  ATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVS  2219
             ATAVNYT+WII+GFLSG+VV+RYRPD W+RHNYVLSGALDAGLAFMGVLLY  LGLE++S
Sbjct  670   ATAVNYTSWIILGFLSGFVVYRYRPDWWRRHNYVLSGALDAGLAFMGVLLYFSLGLEDIS  729

Query  2220  LNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LNWWGNDLDGCP A+CP+AKG+IVEGCPV
Sbjct  730   LNWWGNDLDGCPLATCPTAKGVIVEGCPV  758



>ref|XP_006439250.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
 gb|ESR52490.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
Length=764

 Score =  1202 bits (3111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/762 (79%), Positives = 686/762 (90%), Gaps = 7/762 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVE--EYEGRHGFASSSKSKVES---LPEAA--EEENSPIREVALT  200
             ME SA EI+TPL+ + +  + EG    + +S S  ES   + EA   EEENSP+++VALT
Sbjct  1     MEESAHEIRTPLISRDDGGDNEGEEYSSMASSSSSESQSEITEAVVEEEENSPVKQVALT  60

Query  201   VPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA  380
             V T DD  LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMA
Sbjct  61    VSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMA  120

Query  381   ARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHIT  560
             A++TDRVFF+ T  EFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+VT VKVFY +H T
Sbjct  121   AKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKVFYKQHFT  180

Query  561   FFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITR  740
             FFVSL++V TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE+E+R  GG+TR
Sbjct  181   FFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEREKRASGGVTR  240

Query  741   TQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDW  920
             TQFF++ F+CSFAYYVFPGYL +MLTSLSWICW FP+SV+AQQ+GSGL GLG+ A+G+DW
Sbjct  241   TQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICWIFPKSVVAQQVGSGLYGLGVAAVGIDW  300

Query  921   SSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQ  1100
             S+ISSYLGSPLASPWFATAN+A GF L++YV TP+ YW +++NAKTFPIFSD+LFT++G+
Sbjct  301   STISSYLGSPLASPWFATANVAAGFVLVMYVLTPLCYWLNIYNAKTFPIFSDQLFTTTGR  360

Query  1101  TYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQ  1280
              YNI+AIIDS+FH+D+ AY +EG LYLS FFA TYG+GFAALTAT+VHV LFHGREIWEQ
Sbjct  361   EYNITAIIDSSFHIDIAAYQREGPLYLSIFFATTYGLGFAALTATIVHVALFHGREIWEQ  420

Query  1281  SKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLA  1460
             S++SF+++ MDIHT+LM KY++VPE WF  IL+ NIA TVFACEYY +QLQLPWWGVLLA
Sbjct  421   SRASFQEKGMDIHTKLMRKYKRVPESWFVIILLINIAATVFACEYYNDQLQLPWWGVLLA  480

Query  1461  CVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAF  1640
             C IAI FTLPIGIITAITNQTPGLNIITEYIIGY+YPGYPVANMCFKVYGYISMTQA+ F
Sbjct  481   CAIAITFTLPIGIITAITNQTPGLNIITEYIIGYVYPGYPVANMCFKVYGYISMTQAVTF  540

Query  1641  LQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPS  1820
             LQDFKLGHYMKIPPRTMFMAQ+VGTVIA FVYLGTAWWLME+I +IC T A N+VWTCPS
Sbjct  541   LQDFKLGHYMKIPPRTMFMAQIVGTVIACFVYLGTAWWLMESITDICDTKAANSVWTCPS  600

Query  1821  DHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLIN  2000
             D VFYDASVIWGLIGPRR FGDLGTYEA+NWFFLAGAIAP+LVWL +KAFP QEWIRLIN
Sbjct  601   DKVFYDASVIWGLIGPRRTFGDLGTYEAINWFFLAGAIAPLLVWLGSKAFPNQEWIRLIN  660

Query  2001  MPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMG  2180
             MPVLI AT+ MPPATAVNYTTWI+ GFLSG+VV+RYRPDLWQR+NYVLSGALDAGLAFMG
Sbjct  661   MPVLIGATAMMPPATAVNYTTWIVAGFLSGFVVYRYRPDLWQRYNYVLSGALDAGLAFMG  720

Query  2181  VLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             VLLYLCLGLE+++L+WWGNDLDGCPYA+CP+A+GI VEGCPV
Sbjct  721   VLLYLCLGLEDITLDWWGNDLDGCPYATCPTARGIAVEGCPV  762



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =  1202 bits (3110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/715 (83%), Positives = 665/715 (93%), Gaps = 1/715 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             EEENSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+AIS
Sbjct  51    EEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAIS  110

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG+LMAA+I++RV+F+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHV
Sbjct  111   AQIAVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHV  170

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             VT VK FY K+ITFFVS ++++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRAL
Sbjct  171   VTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRAL  230

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKEER KGG+TRTQFFVIAF+CSFAYYVFPGYLFQ++TSLSW+CW FP SV+AQQ+GSG
Sbjct  231   HEKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWCFPSSVIAQQIGSG  290

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             L GLG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DVF AKTF
Sbjct  291   LHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTF  350

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS  LFT+ G  YNI++IIDSNFHLDL AY++EG LYLSTFFA++YGVGFAAL+AT+V
Sbjct  351   PIFSSSLFTNQGSKYNITSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIV  410

Query  1242  HVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYK  1421
             HV LFHGREIWEQS+ S K++KMDIH RLM +Y+QVPEWWFWCILV NI  T+F+CEYYK
Sbjct  411   HVALFHGREIWEQSRESLKEKKMDIHARLMQRYKQVPEWWFWCILVTNIGATIFSCEYYK  470

Query  1422  EQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFK  1601
             +QLQLPWWGVLLAC IAIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFK
Sbjct  471   DQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFK  530

Query  1602  VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC  1781
             VYGYISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP IC
Sbjct  531   VYGYISMRQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNIC  590

Query  1782  QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
               T +N+VWTCP+D VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAP+LVWLA+
Sbjct  591   D-TVSNSVWTCPTDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLAS  649

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             + FP QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYV
Sbjct  650   RMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYV  709

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LSGALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GI VEGCP+
Sbjct  710   LSGALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGISVEGCPL  764



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/712 (83%), Positives = 663/712 (93%), Gaps = 1/712 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+AISAQI
Sbjct  57    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  116

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+I++RV+F+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT 
Sbjct  117   AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  176

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK FY K+ITFFVS ++++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  177   VKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  236

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFFVIAF+CSFAYYVFPGYLFQ++TSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  237   EERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHG  296

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DVF AKTFPIF
Sbjct  297   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTFPIF  356

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFT  G  YNI++IIDSNFHLDL AY++EG LYLSTFFA++YGVGFAAL+AT++HV 
Sbjct  357   SSSLFTEQGSKYNITSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIMHVA  416

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQSK SFK++K+D+H RLM +Y+QVPEWWFWCILV NIA T+FACEYY +QL
Sbjct  417   LFHGREIWEQSKESFKEKKLDVHARLMKRYKQVPEWWFWCILVTNIAATIFACEYYNDQL  476

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  477   QLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  536

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP IC T 
Sbjct  537   YISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNICDTV  596

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAP+LVWLA++ F
Sbjct  597   -SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLASRMF  655

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSG
Sbjct  656   PRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYVLSG  715

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GI VEGCP+
Sbjct  716   ALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGISVEGCPL  767



>gb|AES71704.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=737

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/750 (81%), Positives = 674/750 (90%), Gaps = 24/750 (3%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             D I +PLL K  +                       EENSPI++VALTVPTTDDPSLPVL
Sbjct  10    DNITSPLLSKKND----------------------SEENSPIKQVALTVPTTDDPSLPVL  47

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA++IT RVFF+G 
Sbjct  48    TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMASKITKRVFFKGK  107

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
              WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VTAVKVFY +HITF VS ++++TTQ
Sbjct  108   SWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTAVKVFYHQHITFCVSFLVIITTQ  167

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEER KGG+TR+QFFVI+F+CSF
Sbjct  168   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERTKGGLTRSQFFVISFLCSF  227

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYYVFPGYLFQMLTSLSWICW FP SVLAQQLGSGL+GLGIGAIGLDWS+IS+YLGSPLA
Sbjct  228   AYYVFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLKGLGIGAIGLDWSAISAYLGSPLA  287

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATAN+AVGF  ++Y+ TP+ YW +V+NAKTFPIFS++LFTS G+ YNI+ IIDSNF
Sbjct  288   SPWFATANVAVGFVFVMYILTPLCYWFNVYNAKTFPIFSNQLFTSKGEIYNITEIIDSNF  347

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             H+DL AY+++G+L+LSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSKSSF ++ MDI
Sbjct  348   HMDLAAYEKQGRLHLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDI  407

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM +Y+QVPEWWF CIL+A IA T+FACEYY EQLQLPWWGVLLAC IAI FTLPIG
Sbjct  408   HTKLMRRYKQVPEWWFVCILIATIATTIFACEYYNEQLQLPWWGVLLACGIAIFFTLPIG  467

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGHYMKI
Sbjct  468   IITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKI  527

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWG  1856
             PPRTMFMAQVVGT+IAG VYL TAWWLME+IP+IC+ T+  +VWTCP D VFYDASVIWG
Sbjct  528   PPRTMFMAQVVGTLIAGLVYLSTAWWLMESIPDICKDTS--SVWTCPGDTVFYDASVIWG  585

Query  1857  LIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMP  2036
             LIGPRRIFG+LGTYE +NWFFL GAIAP+LVWLAT+AFP QEWI+LINMPVLI AT  MP
Sbjct  586   LIGPRRIFGNLGTYENINWFFLGGAIAPLLVWLATRAFPQQEWIKLINMPVLIGATGMMP  645

Query  2037  PATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENV  2216
             PATAVNYT+WIIVGFLSG+VV+RY+P+ WQRHNYVLSGALDAGLAFMGV+LYLCLGLE +
Sbjct  646   PATAVNYTSWIIVGFLSGFVVYRYKPEWWQRHNYVLSGALDAGLAFMGVVLYLCLGLEEI  705

Query  2217  SLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             S++WWGN+LDGCP A CP+AKG  V+GCPV
Sbjct  706   SIDWWGNNLDGCPLAHCPTAKGFEVQGCPV  735



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/718 (82%), Positives = 666/718 (93%), Gaps = 1/718 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
                +EENSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+
Sbjct  46    SGEDEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTIS  105

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             AISAQIAVVPLG+LMAA+I+DRVF +G+KWEFTLNPGPFNVKEHVLITIFAN+GAG+VYA
Sbjct  106   AISAQIAVVPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYA  165

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
             IH+VT V+ FY K++TFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLF
Sbjct  166   IHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLF  225

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKEER KGG+TRTQFF+IAF+CSFAYYVFPGYLFQ+LTSLSWICWFFP SV+AQQ+
Sbjct  226   RALHEKEERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQILTSLSWICWFFPASVMAQQI  285

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL GLG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DV+ A
Sbjct  286   GSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLLVYVLVPICYWLDVYKA  345

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFP+FS  LFT+ G  YNI++IIDS FHLDL+AY++EG LYLSTFFA++YGVGFAAL+A
Sbjct  346   KTFPLFSSSLFTNEGSKYNITSIIDSKFHLDLQAYEREGPLYLSTFFAISYGVGFAALSA  405

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             T++HV LFHGREIWEQSK SFK++K+DIH +LM +Y+QVPEWWFWCIL  NI +T+FACE
Sbjct  406   TIMHVALFHGREIWEQSKESFKEKKLDIHAKLMKRYKQVPEWWFWCILATNIGVTIFACE  465

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YYK+QLQLPWWGVLLAC IAIIFTLPIGI+TAITNQ PGLNIITEYIIGYIYPGYPVANM
Sbjct  466   YYKDQLQLPWWGVLLACTIAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANM  525

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFKVYGYISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP
Sbjct  526   CFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLITAWWLMETIP  585

Query  1773  EICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
              IC +  +N+VWTCP D VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAPVLVW
Sbjct  586   NICDSV-SNSVWTCPGDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVW  644

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             LA++ FP QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+
Sbjct  645   LASRTFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRY  704

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             NYVLSGALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GIIVEGCP+
Sbjct  705   NYVLSGALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGIIVEGCPL  762



>ref|XP_003601453.1| Oligopeptide transporter [Medicago truncatula]
Length=741

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/729 (82%), Positives = 674/729 (92%), Gaps = 3/729 (0%)
 Frame = +3

Query  123   SSKSKVESLPEAAE-EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             +S  + ++L +  + EENSPI++VALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF
Sbjct  13    TSPLRKQTLSKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  72

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYRTEPLTITAISAQIAVVPLGQLMA++IT RVFF+G  WEFTLNPGPFNVKEHVLITI
Sbjct  73    FWYRTEPLTITAISAQIAVVPLGQLMASKITKRVFFKGKSWEFTLNPGPFNVKEHVLITI  132

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAGTVYAIH+VTAVKVFY +HITF VS ++++TTQVLGFGWAGIFRRYLVEPAAMW
Sbjct  133   FANSGAGTVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMW  192

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WPANLVQVSLFRALHEKEER KGG+TR+QFFVI+F+CSFAYYVFPGYLFQMLTSLSWICW
Sbjct  193   WPANLVQVSLFRALHEKEERTKGGLTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSWICW  252

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
              FP SVLAQQLGSGL+GLGIGAIGLDWS+IS+YLGSPLASPWFATAN+AVGF  ++Y+ T
Sbjct  253   VFPHSVLAQQLGSGLKGLGIGAIGLDWSAISAYLGSPLASPWFATANVAVGFVFVMYILT  312

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             P+ YW +V+NAKTFPIFS++LFTS G+ YNI+ IIDSNFH+DL AY+++G+L+LSTFFA+
Sbjct  313   PLCYWFNVYNAKTFPIFSNQLFTSKGEIYNITEIIDSNFHMDLAAYEKQGRLHLSTFFAM  372

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILV  1379
             TYGVGFAALTAT+VHV LFHGREIWEQSKSSF ++ MDIHT+LM +Y+QVPEWWF CIL+
Sbjct  373   TYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRRYKQVPEWWFVCILI  432

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
             A IA T+FACEYY EQLQLPWWGVLLAC IAI FTLPIGIITAITNQ+PGLNIITEYIIG
Sbjct  433   ATIATTIFACEYYNEQLQLPWWGVLLACGIAIFFTLPIGIITAITNQSPGLNIITEYIIG  492

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             YIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGHYMKIPPRTMFMAQVVGT+IAG VYL
Sbjct  493   YIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGLVYL  552

Query  1740  GTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
              TAWWLME+IP+IC+ T+  +VWTCP D VFYDASVIWGLIGPRRIFG+LGTYE +NWFF
Sbjct  553   STAWWLMESIPDICKDTS--SVWTCPGDTVFYDASVIWGLIGPRRIFGNLGTYENINWFF  610

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GAIAP+LVWLAT+AFP QEWI+LINMPVLI AT  MPPATAVNYT+WIIVGFLSG+VV
Sbjct  611   LGGAIAPLLVWLATRAFPQQEWIKLINMPVLIGATGMMPPATAVNYTSWIIVGFLSGFVV  670

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAK  2279
             +RY+P+ WQRHNYVLSGALDAGLAFMGV+LYLCLGLE +S++WWGN+LDGCP A CP+AK
Sbjct  671   YRYKPEWWQRHNYVLSGALDAGLAFMGVVLYLCLGLEEISIDWWGNNLDGCPLAHCPTAK  730

Query  2280  GIIVEGCPV  2306
             G  V+GCPV
Sbjct  731   GFEVQGCPV  739



>ref|XP_004502063.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=740

 Score =  1199 bits (3103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/754 (80%), Positives = 672/754 (89%), Gaps = 22/754 (3%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             +   D I +PLL K E+               E L     EENSPI++VALTVPTTDDPS
Sbjct  7     QQEKDSITSPLLSKEED---------------EKL-----EENSPIKQVALTVPTTDDPS  46

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMA++IT RVF
Sbjct  47    LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMASKITKRVF  106

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             F+GT WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH+VTAVKVFY KHI+F VSL++V
Sbjct  107   FKGTSWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTAVKVFYHKHISFSVSLLVV  166

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TR+QFFVIAF
Sbjct  167   ITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGLTRSQFFVIAF  226

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
              CSFAYYVFPGY+FQMLTSLSWICW FP SVLA QLGSGL GLGIGAIGLDWS+IS+YLG
Sbjct  227   FCSFAYYVFPGYIFQMLTSLSWICWIFPNSVLAHQLGSGLNGLGIGAIGLDWSAISAYLG  286

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+A GF  ++Y+ TP+ YW +++NAKTFPIFS++LFTS G  YNI+ II
Sbjct  287   SPLASPWFATANVAAGFVFVMYILTPLCYWFNIYNAKTFPIFSNKLFTSKGHVYNITDII  346

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             DSNFHLD  AY+++G+LYLSTFFA+TYGVGFAALTAT+VHV LFHGREIWEQSKSSF ++
Sbjct  347   DSNFHLDHAAYERQGRLYLSTFFAMTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEK  406

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
              MDIHT+LM KY QVPEWWF CIL+A IA TVFACEYY EQLQLPWWGVLLAC IAI FT
Sbjct  407   SMDIHTKLMRKYNQVPEWWFVCILIATIATTVFACEYYNEQLQLPWWGVLLACSIAIFFT  466

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGH
Sbjct  467   LPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGH  526

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDAS  1844
             YMKIPPRTMFMAQVVGT+IA  VYL TAWWL+ +IP+IC+ T+  +VWTCP D VFYDAS
Sbjct  527   YMKIPPRTMFMAQVVGTLIAALVYLSTAWWLLGSIPDICKDTS--SVWTCPGDTVFYDAS  584

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGDLGTYE +NWFFL GAIAP+LV+LAT+AFP QEWI+LINMPVLI AT
Sbjct  585   VIWGLIGPRRIFGDLGTYEKINWFFLGGAIAPLLVYLATRAFPEQEWIKLINMPVLIGAT  644

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
               MPPATAVNYT+WI+VGFLSG+VV+RY+PD W+RHNYVLSGALDAGLAFMGV+LYLCLG
Sbjct  645   GMMPPATAVNYTSWIVVGFLSGFVVYRYKPDWWRRHNYVLSGALDAGLAFMGVVLYLCLG  704

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LE++S++WWGN+LDGCP A CP+AKG   +GCPV
Sbjct  705   LEDISIDWWGNNLDGCPLAHCPTAKGFEFQGCPV  738



>ref|XP_006476310.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Citrus 
sinensis]
Length=731

 Score =  1198 bits (3100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/730 (81%), Positives = 666/730 (91%), Gaps = 2/730 (0%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A S     E+  E  EEENSP+++VALTV T DD  LPVLTFRMWVLGTLSCVLLSFLNQ
Sbjct  2     AESQSEITEAAVE--EEENSPVKQVALTVSTEDDSCLPVLTFRMWVLGTLSCVLLSFLNQ  59

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLIT  476
             FFWYRTEPL+ITAISAQIAVVPLGQLMAA++TDRVFF+ T  EFTLNPGPFNVKEHVLIT
Sbjct  60    FFWYRTEPLSITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLIT  119

Query  477   IFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAM  656
             IFANSGAG+VYAIH+VT VKVFY +H TFFVSL++V TTQVLGFGWAGIFRRYLVEPAAM
Sbjct  120   IFANSGAGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAM  179

Query  657   WWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWIC  836
             WWPANLVQVSLFRALHE+E+R  GG+TRTQFF+I F+CSFAYYVFPGYL +MLTSLSWIC
Sbjct  180   WWPANLVQVSLFRALHEREKRASGGVTRTQFFMIGFVCSFAYYVFPGYLLEMLTSLSWIC  239

Query  837   WFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVF  1016
             W FP+SV+AQQ+GSGL GLG+ A+G+DWS+ISSYLGSPLASPWFATAN+A GF L++YV 
Sbjct  240   WIFPKSVVAQQVGSGLFGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVL  299

Query  1017  TPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFA  1196
             TP+ YW +++NAKTFPIFSD+LFT++G+ YNI+AIIDSNFH+D+ AY +EG LYLS FFA
Sbjct  300   TPLCYWLNIYNAKTFPIFSDQLFTTTGREYNITAIIDSNFHIDIAAYQREGPLYLSIFFA  359

Query  1197  LTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCIL  1376
             +TYG+GFAALTAT+VHV LFHGREIWEQS++SF+++ +DIHT+LM KY++VPE WF  IL
Sbjct  360   MTYGLGFAALTATIVHVALFHGREIWEQSRASFQEKGIDIHTKLMRKYKRVPESWFVIIL  419

Query  1377  VANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyii  1556
             + NIA TVFACEYY +QLQLPWWGVLLAC IAI FTLPIGIITAITNQTPGLNIITEYII
Sbjct  420   LINIAATVFACEYYNDQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYII  479

Query  1557  gyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVY  1736
             GY+YPGYPVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPPRTMFMAQ+VGTVIA FVY
Sbjct  480   GYVYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVY  539

Query  1737  LGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             LGTAWWLME+I +IC T A N+VWTCPSD VFYDASVIWGLIGPRRIFGDLGTYEA+NWF
Sbjct  540   LGTAWWLMESITDICDTKAANSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGTYEAINWF  599

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FLAGAIAP LVWL +KAFP QEWI LINMPVLI AT+ MPPATAVNYTTWI+ GFLSG+V
Sbjct  600   FLAGAIAPSLVWLGSKAFPNQEWITLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGFV  659

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             V+RYRPDLWQR+NYVLSGALDAGLAFMGVLLYLCLGLE+V+L+WWGNDLDGCPYA+CP+A
Sbjct  660   VYRYRPDLWQRYNYVLSGALDAGLAFMGVLLYLCLGLEDVTLDWWGNDLDGCPYATCPTA  719

Query  2277  KGIIVEGCPV  2306
             +GI VEGCPV
Sbjct  720   RGIAVEGCPV  729



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =  1198 bits (3100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/712 (83%), Positives = 662/712 (93%), Gaps = 1/712 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+AISAQI
Sbjct  54    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  113

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+I++RV+F+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT 
Sbjct  114   AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  173

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK FY K+ITFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  174   VKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  233

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFF+IAFICSFAYYVFPGYLFQ++TSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  234   EERTKGGLTRTQFFLIAFICSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHG  293

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DVF AKTFPIF
Sbjct  294   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTFPIF  353

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFT+ G  YNI++IIDSNFHLDL AY++EG LYLSTFFA++YGVGFAAL+AT++HV 
Sbjct  354   SSSLFTNQGSKYNITSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIMHVA  413

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQSK SF ++K+D+H RLM +Y+QVPEWWFW ILV NIA T+FACEYY +QL
Sbjct  414   LFHGREIWEQSKESFNEKKLDVHARLMKRYKQVPEWWFWSILVTNIAATIFACEYYNDQL  473

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  474   QLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  533

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP IC  T
Sbjct  534   YISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNICD-T  592

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              TN+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAPVLVWLA++ F
Sbjct  593   VTNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWLASRTF  652

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSG
Sbjct  653   PRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYVLSG  712

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GI VEGCP+
Sbjct  713   ALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGISVEGCPL  764



>ref|XP_002874647.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50906.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
Length=764

 Score =  1196 bits (3095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/712 (83%), Positives = 662/712 (93%), Gaps = 1/712 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLS +LLSFLNQFFWYRTEPLTI+AISAQI
Sbjct  52    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSGILLSFLNQFFWYRTEPLTISAISAQI  111

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+I+DRVFF+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT 
Sbjct  112   AVVPLGRLMAAKISDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  171

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK FY K+ITFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  172   VKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  231

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFFVIAF+CSFAYYVFPGYLFQ++TSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  232   EERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHG  291

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DV+ AKTFPIF
Sbjct  292   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVYKAKTFPIF  351

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFTS G  YNI++IIDSNFHLDL +Y++EG LYL TFFA++YGVGFAAL+AT++HV 
Sbjct  352   SSSLFTSQGSKYNITSIIDSNFHLDLPSYEREGPLYLCTFFAISYGVGFAALSATIMHVA  411

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQSK SFK++K+D+H RLM +Y+QVPEWWFWCILV N+  T+FACEYY +QL
Sbjct  412   LFHGREIWEQSKESFKEKKLDVHARLMQRYKQVPEWWFWCILVTNVGATIFACEYYNDQL  471

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  472   QLPWWGVLLACTVAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  531

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP IC + 
Sbjct  532   YISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNICDSV  591

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAPVLVWLA++ F
Sbjct  592   -SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWLASRMF  650

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSG
Sbjct  651   PRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYVLSG  710

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GIIVEGCP+
Sbjct  711   ALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGIIVEGCPL  762



>ref|XP_006439249.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
 gb|ESR52489.1| hypothetical protein CICLE_v10018971mg [Citrus clementina]
Length=756

 Score =  1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/715 (82%), Positives = 661/715 (92%), Gaps = 0/715 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             EEENSP+++VALTV T DD  LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL+ITAIS
Sbjct  40    EEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAIS  99

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLGQLMAA++TDRVFF+ T  EFTLNPGPFNVKEHVLITIFANSGAG+VYAIH+
Sbjct  100   AQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHI  159

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             VT VKVFY +H TFFVSL++V TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL
Sbjct  160   VTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  219

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HE+E+R  GG+TRTQFF++ F+CSFAYYVFPGYL +MLTSLSWICW FP+SV+AQQ+GSG
Sbjct  220   HEREKRASGGVTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICWIFPKSVVAQQVGSG  279

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             L GLG+ A+G+DWS+ISSYLGSPLASPWFATAN+A GF L++YV TP+ YW +++NAKTF
Sbjct  280   LYGLGVAAVGIDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLTPLCYWLNIYNAKTF  339

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFSD+LFT++G+ YNI+AIIDS+FH+D+ AY +EG LYLS FFA TYG+GFAALTAT+V
Sbjct  340   PIFSDQLFTTTGREYNITAIIDSSFHIDIAAYQREGPLYLSIFFATTYGLGFAALTATIV  399

Query  1242  HVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYK  1421
             HV LFHGREIWEQS++SF+++ MDIHT+LM KY++VPE WF  IL+ NIA TVFACEYY 
Sbjct  400   HVALFHGREIWEQSRASFQEKGMDIHTKLMRKYKRVPESWFVIILLINIAATVFACEYYN  459

Query  1422  EQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFK  1601
             +QLQLPWWGVLLAC IAI FTLPIGIITAITNQTPGLNIITEYIIGY+YPGYPVANMCFK
Sbjct  460   DQLQLPWWGVLLACAIAITFTLPIGIITAITNQTPGLNIITEYIIGYVYPGYPVANMCFK  519

Query  1602  VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC  1781
             VYGYISMTQA+ FLQDFKLGHYMKIPPRTMFMAQ+VGTVIA FVYLGTAWWLME+I +IC
Sbjct  520   VYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTVIACFVYLGTAWWLMESITDIC  579

Query  1782  QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
              T A N+VWTCPSD VFYDASVIWGLIGPRR FGDLGTYEA+NWFFLAGAIAP+LVWL +
Sbjct  580   DTKAANSVWTCPSDKVFYDASVIWGLIGPRRTFGDLGTYEAINWFFLAGAIAPLLVWLGS  639

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             KAFP QEWIRLINMPVLI AT+ MPPATAVNYTTWI+ GFLSG+VV+RYRPDLWQR+NYV
Sbjct  640   KAFPNQEWIRLINMPVLIGATAMMPPATAVNYTTWIVAGFLSGFVVYRYRPDLWQRYNYV  699

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LSGALDAGLAFMGVLLYLCLGLE+++L+WWGNDLDGCPYA+CP+A+GI VEGCPV
Sbjct  700   LSGALDAGLAFMGVLLYLCLGLEDITLDWWGNDLDGCPYATCPTARGIAVEGCPV  754



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =  1194 bits (3088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/714 (83%), Positives = 658/714 (92%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDP++PVLTFRMWVLGT SCVLLSFLNQFFWYR EPL+IT+ISAQI
Sbjct  45    NSPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA+ ITDRVFF+G++WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIHVVTA
Sbjct  105   AVVPLGHLMASTITDRVFFKGSRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVTA  164

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK+FYGKHITFFVSL++V+TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHE+
Sbjct  165   VKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHER  224

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E+R KGG+TR QFF++AFICSFAYYVFPGYLF MLTSLSWICW FP S+LAQQLGSGL G
Sbjct  225   EDRAKGGMTRNQFFMMAFICSFAYYVFPGYLFSMLTSLSWICWIFPHSILAQQLGSGLYG  284

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+A GF LI+YV TP  YW D+++AKTFPIF
Sbjct  285   LGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVVTPTAYWLDLYDAKTFPIF  344

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD LFTS+GQ+YNIS+IIDSNFHLD+EAYD+ G LYLSTFFA+TYGVGFA+LTAT+ HV+
Sbjct  345   SDGLFTSTGQSYNISSIIDSNFHLDIEAYDKNGPLYLSTFFAVTYGVGFASLTATISHVL  404

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHG EIW+ SKS+F+++KMDIHT+LMS+Y QVP+WWF  ILVANIALT+FACEYY +QL
Sbjct  405   LFHGSEIWQMSKSAFEEKKMDIHTKLMSRYTQVPQWWFIVILVANIALTIFACEYYIDQL  464

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAI FTLPIGIITA TNQTPGLNIITEY++GY+YPG PVANMCFKVYG
Sbjct  465   QLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYVMGYLYPGRPVANMCFKVYG  524

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGT++A  VYLGTAWWLMETIP IC T 
Sbjct  525   YISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLVAAIVYLGTAWWLMETIPNICNTE  584

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
               ++++ WTCPSDHVFYDASVIWGLIGPRRIFGDLGTY A+NWFFL GA+AP+LVWLA K
Sbjct  585   LLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLVGAVAPLLVWLAHK  644

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFPGQ+WIRLINMPVLI AT  MPPATAVNYTTWIIVGF SGYVV+RYR D W RHNYVL
Sbjct  645   AFPGQDWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFFSGYVVYRYRRDWWTRHNYVL  704

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFM VLLYLCLGLE++SLNWWGNDLDGC  ASCP+AKG+I+EGCPV
Sbjct  705   SGALDAGLAFMAVLLYLCLGLEDISLNWWGNDLDGCSLASCPTAKGVIIEGCPV  758



>gb|EPS60258.1| hypothetical protein M569_14546, partial [Genlisea aurea]
Length=705

 Score =  1194 bits (3088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/703 (85%), Positives = 656/703 (93%), Gaps = 1/703 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             EEENSPI+EVALTV T+DD S+PVLTFRMW LGT+SCVLLSFLNQFFWYRTEPL+ITAIS
Sbjct  3     EEENSPIKEVALTVSTSDDASIPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLSITAIS  62

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG+LMAAR+  RVFFR T WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV
Sbjct  63    AQIAVVPLGRLMAARLPARVFFRNTGWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  122

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             VTAVKVFY KHI FFVSL++V+TTQVLGFGWAGIFRRYLVEPA MWWPANLVQVSLFRAL
Sbjct  123   VTAVKVFYRKHINFFVSLVVVITTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRAL  182

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKEER KGG+TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW FP+S+LAQQLGSG
Sbjct  183   HEKEERRKGGVTRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSILAQQLGSG  242

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             L+GLGIGA+GLDWS++SSYLGSPLASPWFATAN+AVGFF ++YV TP+ YW +V++AK F
Sbjct  243   LKGLGIGAVGLDWSTVSSYLGSPLASPWFATANVAVGFFFVMYVVTPLSYWFNVYDAKKF  302

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFSDELFTSSG+ YNIS IIDSNFHLD+++Y+++G L+LSTFFA+TYGVGFAAL+AT+V
Sbjct  303   PIFSDELFTSSGEVYNISGIIDSNFHLDMDSYNRQGTLHLSTFFAMTYGVGFAALSATIV  362

Query  1242  HVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYK  1421
             HV+LFHGREIWE S+SSFK++KMDIHTRLM +YRQVPEWWFWCIL+ NI+LT+FACEYYK
Sbjct  363   HVILFHGREIWELSRSSFKEKKMDIHTRLMRRYRQVPEWWFWCILLVNISLTIFACEYYK  422

Query  1422  EQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFK  1601
             +QLQLPWWGVLLAC IA +FTLPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFK
Sbjct  423   DQLQLPWWGVLLACFIAFVFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFK  482

Query  1602  VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC  1781
             VYGYISMTQAI FLQDFKLGHYMKIPPRTMFMAQVVGT+IAG VYL TAWWLMETIP IC
Sbjct  483   VYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGVVYLSTAWWLMETIPGIC  542

Query  1782  QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
                A++ VWTCP DHVFYDASVIWGLIGPR+IFGD GTY AVNWFFL GA+APVLVWL T
Sbjct  543   DKAASD-VWTCPGDHVFYDASVIWGLIGPRKIFGDEGTYAAVNWFFLLGAVAPVLVWLGT  601

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             KAFP +EWIRLINMPVLI AT +MPPATAVNYTTWI VGF+SGYVV+ YRPDLW+RHNYV
Sbjct  602   KAFPDREWIRLINMPVLIGATGSMPPATAVNYTTWIAVGFVSGYVVYNYRPDLWERHNYV  661

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCP  2270
             LSGALDAGLAFMGV++YL LGLENV + WWGNDLDGCP ASCP
Sbjct  662   LSGALDAGLAFMGVVMYLSLGLENVGVEWWGNDLDGCPLASCP  704



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =  1192 bits (3084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/712 (83%), Positives = 658/712 (92%), Gaps = 1/712 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+AISAQI
Sbjct  55    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  114

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+I++RV+F+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT 
Sbjct  115   AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  174

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK FY K+ITFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  175   VKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  234

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFF+IAF+CSFAYYVFPGYLFQ++TSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  235   EERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHG  294

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DVF AKTFPIF
Sbjct  295   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTFPIF  354

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFT  G  YNI +IIDSNFHLDL AY++EG LYLSTFFA++YGVGFAAL+AT++HV 
Sbjct  355   SSSLFTEQGSKYNIKSIIDSNFHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIMHVA  414

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQS  SFK++K+D+H RLM  Y+QVPEWWFWCILV NI  T+FACEYY +QL
Sbjct  415   LFHGREIWEQSTESFKEKKLDVHARLMKSYKQVPEWWFWCILVTNIGATIFACEYYNDQL  474

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  475   QLPWWGVLLACAIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  534

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWLMETIP IC   
Sbjct  535   YISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNICDMV  594

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCP+D VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAP+LVWLA++ F
Sbjct  595   -SNSVWTCPTDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLASRMF  653

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSG
Sbjct  654   PRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYVLSG  713

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GI VEGCP+
Sbjct  714   ALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGISVEGCPL  765



>emb|CBI34570.3| unnamed protein product [Vitis vinifera]
Length=689

 Score =  1192 bits (3083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/687 (86%), Positives = 651/687 (95%), Gaps = 0/687 (0%)
 Frame = +3

Query  246   MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWE  425
             MWVLGT+SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLG+LMAA+ITDRVFF+GT WE
Sbjct  1     MWVLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMAAKITDRVFFKGTPWE  60

Query  426   FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLG  605
             FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT VKVFY KHI+FFVSLI+V+TTQVLG
Sbjct  61    FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTVVKVFYKKHISFFVSLIVVITTQVLG  120

Query  606   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYY  785
             FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TRTQFF+IAFICSFAYY
Sbjct  121   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRTQFFLIAFICSFAYY  180

Query  786   VFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPW  965
             VFPGY+F+MLTSLSWICW FP SVLAQQLGSGL GLGI A+GLDWS+IS+YLGSPLASPW
Sbjct  181   VFPGYMFEMLTSLSWICWIFPTSVLAQQLGSGLYGLGIAAVGLDWSTISAYLGSPLASPW  240

Query  966   FATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLD  1145
             FATAN+AVGF  ++YV TPI YW +V+ AKTFPIFSD+LFTS+GQ YNIS+II SNFHL+
Sbjct  241   FATANVAVGFVFVMYVLTPICYWLNVYKAKTFPIFSDDLFTSTGQEYNISSIITSNFHLN  300

Query  1146  LEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTR  1325
             + AY++EG LYLSTFFA+TYGVGFAAL+AT VHV+LFHGREIWEQSKSSFKD+ MDIHTR
Sbjct  301   ITAYEEEGPLYLSTFFAMTYGVGFAALSATAVHVLLFHGREIWEQSKSSFKDKGMDIHTR  360

Query  1326  LMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIIT  1505
             LM++Y+QVPEWWFW IL+ANIA T+FAC+YY +QLQLPWWGVLLAC IAI+FTLPIGIIT
Sbjct  361   LMTRYKQVPEWWFWSILIANIAFTIFACQYYNDQLQLPWWGVLLACAIAIVFTLPIGIIT  420

Query  1506  AITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPR  1685
             AITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPPR
Sbjct  421   AITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPR  480

Query  1686  TMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIG  1865
             TMFMAQVVGT+IAGFVYLGTAWW+METIP+IC+TTA+++ WTCPSD VFYDASVIWGLIG
Sbjct  481   TMFMAQVVGTLIAGFVYLGTAWWMMETIPDICETTASSSPWTCPSDRVFYDASVIWGLIG  540

Query  1866  PRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPAT  2045
             PRRIFGD G YEAVNWFFLAGA+APVLVWLA KAFP QEWI LINMPVLIS+T  MPPAT
Sbjct  541   PRRIFGDEGVYEAVNWFFLAGAVAPVLVWLAHKAFPKQEWIGLINMPVLISSTGMMPPAT  600

Query  2046  AVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN  2225
             AVNYTTW+I GFLSG+VV+RYRPD WQRHNYVLSGALDAGLAFMGVLLYLCLGLE++S++
Sbjct  601   AVNYTTWVIAGFLSGFVVYRYRPDWWQRHNYVLSGALDAGLAFMGVLLYLCLGLEDISVD  660

Query  2226  WWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             WWGNDLDGCPYA+CP+AKG+ VEGCPV
Sbjct  661   WWGNDLDGCPYATCPTAKGVFVEGCPV  687



>ref|XP_010538850.1| PREDICTED: oligopeptide transporter 7 [Tarenaya hassleriana]
Length=757

 Score =  1189 bits (3076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/717 (82%), Positives = 660/717 (92%), Gaps = 0/717 (0%)
 Frame = +3

Query  156   AAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITA  335
             + EEENSPIR+VALTVPTTDDPSLPVLTFRMWVLGT+SCV+LSFLNQFFWYRTEPLTI+A
Sbjct  39    SGEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTVSCVVLSFLNQFFWYRTEPLTISA  98

Query  336   ISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  515
             ISAQIAVVPLG+LMAA+++D+VF RG+KWEF+LNPGPFNVKEHVLITIFAN+GAG+VYAI
Sbjct  99    ISAQIAVVPLGRLMAAKLSDKVFLRGSKWEFSLNPGPFNVKEHVLITIFANAGAGSVYAI  158

Query  516   HVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  695
             HVVT VK FY K+ITFFVSLI+++TTQVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFR
Sbjct  159   HVVTVVKAFYMKNITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFR  218

Query  696   ALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlg  875
             ALHEKEER KGG+TRTQFF+IA  CSFAYYV PGYLFQMLTSLSW+CW FP SVLAQQ+G
Sbjct  219   ALHEKEERTKGGLTRTQFFLIALACSFAYYVLPGYLFQMLTSLSWLCWAFPGSVLAQQMG  278

Query  876   sglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAK  1055
             SGL GLGIGAIGLDWS+ISSYLGSPLASPWFATAN+A GF L++YV TPIFYW +V+ AK
Sbjct  279   SGLHGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLTPIFYWKNVYKAK  338

Query  1056  TFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTAT  1235
             TFPIFS  LFT  G  YNI++IIDSNFHLDL +Y+ +G LY++TFFA+TYGVGFAAL+AT
Sbjct  339   TFPIFSSSLFTKEGSKYNITSIIDSNFHLDLHSYELQGPLYITTFFAITYGVGFAALSAT  398

Query  1236  LVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEY  1415
             +VHV LFHGREIWEQSK+SFK++KMDIHTRLMS+Y+QVP+WWFW ILV N+  T+FACEY
Sbjct  399   IVHVALFHGREIWEQSKASFKEKKMDIHTRLMSRYKQVPDWWFWSILVINVGATIFACEY  458

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             YKEQLQLPWWGVLLAC IAI+FTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMC
Sbjct  459   YKEQLQLPWWGVLLACSIAILFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMC  518

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+  VYL TAWWL+ETIPE
Sbjct  519   FKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLVTAWWLLETIPE  578

Query  1776  ICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWL  1955
             IC TT +N+VWTCP D VF+DASVIWGLIGPRRIFGDLGTY++VNWFFL GAIAP+LVW 
Sbjct  579   ICDTTISNSVWTCPGDKVFFDASVIWGLIGPRRIFGDLGTYQSVNWFFLVGAIAPLLVWS  638

Query  1956  ATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHN  2135
               K FP QEWIRLINMPVLISATS MPPATAV  TTW++ GFLSG+VVFR+RPDLW R+N
Sbjct  639   LAKMFPRQEWIRLINMPVLISATSMMPPATAVXCTTWVMAGFLSGFVVFRFRPDLWVRYN  698

Query  2136  YVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             YVLSGALDAGLAFMGVL+YLCLGL+NVSL WWGN+LDGCP ASCP+A G+ V+GCP+
Sbjct  699   YVLSGALDAGLAFMGVLIYLCLGLQNVSLEWWGNELDGCPLASCPTAAGLSVDGCPL  755



>ref|NP_192815.1| oligopeptide transporter 7 [Arabidopsis thaliana]
 sp|O82485.1|OPT7_ARATH RecName: Full=Oligopeptide transporter 7; Short=AtOPT7 [Arabidopsis 
thaliana]
 gb|AAC35527.1| similar to Schizosaccharomyces pombe isp4 protein (GB:D14061) 
[Arabidopsis thaliana]
 emb|CAB81178.1| putative oligopeptide transporter [Arabidopsis thaliana]
 gb|AAK74026.1| AT4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AAO42765.1| At4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AEE82927.1| oligopeptide transporter 7 [Arabidopsis thaliana]
Length=766

 Score =  1186 bits (3069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/711 (83%), Positives = 663/711 (93%), Gaps = 1/711 (0%)
 Frame = +3

Query  174   SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIA  353
             SPIR+VALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYRTEPLTI+AISAQIA
Sbjct  55    SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIA  114

Query  354   VVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAV  533
             VVPLG+LMAA+ITDRVFF+G+KW+FTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT V
Sbjct  115   VVPLGRLMAAKITDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTVV  174

Query  534   KVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE  713
             K FY K+ITFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKE
Sbjct  175   KAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKE  234

Query  714   ERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqgl  893
             ER KGG+TRTQFFVIAF+CSFAYYVFPGYLFQ++TSLSW+CWFFP SV+AQQ+GSGL GL
Sbjct  235   ERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHGL  294

Query  894   gigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFS  1073
             G+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L++YV  PI YW DV+ AKTFPIFS
Sbjct  295   GVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVYKAKTFPIFS  354

Query  1074  DELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVL  1253
               LF+S G  YNI++IIDSNFHLDL AY+++G LYL TFFA++YGVGFAAL+AT++HV L
Sbjct  355   SSLFSSQGSKYNITSIIDSNFHLDLPAYERQGPLYLCTFFAISYGVGFAALSATIMHVAL  414

Query  1254  FHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQ  1433
             FHGREIWEQSK SFK++K+D+H RLM +Y+QVPEWWFWCILV N+  T+FACEYY +QLQ
Sbjct  415   FHGREIWEQSKESFKEKKLDVHARLMQRYKQVPEWWFWCILVTNVGATIFACEYYNDQLQ  474

Query  1434  LPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGY  1613
             LPWWGVLLAC +AIIFTLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGY
Sbjct  475   LPWWGVLLACTVAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGY  534

Query  1614  ISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA  1793
             ISM QAI FLQDFKLGHYMKIPPRTMFMAQ+VGT+I+ FVYL TAWWLMETIP IC +  
Sbjct  535   ISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCFVYLTTAWWLMETIPNICDSV-  593

Query  1794  TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFP  1973
             TN+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAP+LVWLA++ FP
Sbjct  594   TNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLASRMFP  653

Query  1974  GQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGA  2153
              QEWI+LINMPVLISATS+MPPATAVNYTTW++ GFLSG+VVFRYRP+LWQR+NYVLSGA
Sbjct  654   RQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNYVLSGA  713

Query  2154  LDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A GIIVEGCP+
Sbjct  714   LDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAPGIIVEGCPL  764



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =  1182 bits (3059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/752 (79%), Positives = 658/752 (88%), Gaps = 17/752 (2%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             DEI  P L                 S     PE  EEENSPI +VALTVP +D+P  PVL
Sbjct  20    DEITAPFL---------------RPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVL  64

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMWVLGT SC +LSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R FFRG 
Sbjct  65    TFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGR  124

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
              WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGKHI+FFVSL++VLTTQ
Sbjct  125   PWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQ  184

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             VLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TR QFF++AFICSF
Sbjct  185   VLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARSKGGLTRNQFFLVAFICSF  244

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYY+FPGYLFQMLTSLSWICW FP SVLAQQLGSGL GLGIGAIGLDWS++SSYLGSPLA
Sbjct  245   AYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTVSSYLGSPLA  304

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATAN+A GFF I+Y+ TPI YW + + A+ FPIFSD LFTS+GQ YNIS+I+DS+F
Sbjct  305   SPWFATANVAAGFFFIMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYNISSIVDSHF  364

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             H D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW+ SKS+F++++MDI
Sbjct  365   HFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQEKRMDI  424

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM +Y+QVPEWWF CIL+ANIA+T+FACEYY EQLQLPWWGVLLAC IA  FTLPIG
Sbjct  425   HTKLMRRYKQVPEWWFVCILIANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIG  484

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMKI
Sbjct  485   IITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKI  544

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PPRTMFMAQVVGT+IA FVY+GTAWWLMETIP IC T    +++ WTCP DHVFYDASVI
Sbjct  545   PPRTMFMAQVVGTLIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGDHVFYDASVI  604

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLI PRRIFGDLGTY AVNWFFL GAIAPVLVW A KAFP Q WI LINMPVLI AT  
Sbjct  605   WGLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINMPVLIGATGQ  664

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYTTWI+VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLE
Sbjct  665   MPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLE  724

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             N+SLNWWGNDLDGCP ASCP+AKG++V+GCPV
Sbjct  725   NISLNWWGNDLDGCPLASCPTAKGVVVDGCPV  756



>ref|XP_008806363.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=765

 Score =  1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/714 (82%), Positives = 657/714 (92%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDPS+PVLTFRMWVLGT+SC LLSFLNQFFWYR EPL+IT+ISAQI
Sbjct  51    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQI  110

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA  ITDRVFF+G +WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIHVVTA
Sbjct  111   AVVPLGHLMARTITDRVFFKGRRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVTA  170

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK+FY +HITFFVSL++VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEK
Sbjct  171   VKIFYRRHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHEK  230

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E RPK G+TR QFF++AFICSF+YYVFPGYLF MLTSLSWICW FPRSVLAQQLGSGL G
Sbjct  231   EARPKHGLTRNQFFMVAFICSFSYYVFPGYLFSMLTSLSWICWIFPRSVLAQQLGSGLYG  290

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSYLGSPLASPWFATAN+A GF LI+YV TP  YW +++ AKTFPIF
Sbjct  291   LGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYWLNLYKAKTFPIF  350

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD+LFTS+GQ YNIS+IIDS+FHLD+EAY++EG LYLSTFFA+TYGVGFA+LTAT+ HV+
Sbjct  351   SDDLFTSTGQEYNISSIIDSDFHLDVEAYEKEGPLYLSTFFAVTYGVGFASLTATVCHVL  410

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIW+ SKS+F+++KMD+HTRLM +Y+QVP+WWF CILVAN+ALT+FACEYY +QL
Sbjct  411   LFHGREIWQMSKSAFQEKKMDVHTRLMRQYKQVPQWWFICILVANVALTIFACEYYIDQL  470

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AI FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYG
Sbjct  471   QLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYG  530

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYLGTAWWLM+TIP IC T 
Sbjct  531   YISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNICDTD  590

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
               ++++ WTCPSD VF+DASVIWGLIGPRRIFGDLGTY A+NWFFLAGAIAP+L+WLA K
Sbjct  591   LLSSDSPWTCPSDQVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLIWLAHK  650

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP ++WI LINMPVLI AT  MPPATAVNYTTWIIVGFLSG+VV+RYR D WQRHNYVL
Sbjct  651   AFPNKKWISLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRRDWWQRHNYVL  710

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFM VLLYLCLGLE+VSLNWWGNDLDGC  ASCP+AKG++V+GCPV
Sbjct  711   SGALDAGLAFMAVLLYLCLGLEDVSLNWWGNDLDGCSLASCPTAKGVVVDGCPV  764



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =  1181 bits (3056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/712 (82%), Positives = 657/712 (92%), Gaps = 1/712 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYR EPL+I+AISAQI
Sbjct  53    NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQI  112

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+I+DRVF +G+KWEFTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT 
Sbjct  113   AVVPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  172

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK FY K+ITFFVS ++++TTQVLGFGWAGIFR+YLVEPA MWWPANLVQVSLFRALHEK
Sbjct  173   VKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALHEK  232

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFFVIAF+CSFAYYVFPGYLFQMLTSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  233   EERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMAQQIGSGLHG  292

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LG+GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L +YV  PI YW DVF AKTFP++
Sbjct  293   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYWLDVFKAKTFPLY  352

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFTS G  YNI++IIDS FHLDL+AY++EG LYLSTFFA++YG+GFAAL+AT+VHV 
Sbjct  353   SSSLFTSEGSKYNITSIIDSKFHLDLQAYEREGPLYLSTFFAISYGIGFAALSATIVHVS  412

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIW+QSK SFK++K+DIHTRLM +Y+ VPEWWFWCIL  NI++T+FACEYY +QL
Sbjct  413   LFHGREIWDQSKQSFKEKKIDIHTRLMRRYKAVPEWWFWCILAINISVTIFACEYYIDQL  472

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AIIFTLPIGI+TAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  473   QLPWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  532

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QA+ FLQDFKLGHYMKIPPR MFMAQ+VGT+++  VYL TAWWLMETIP IC + 
Sbjct  533   YISMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLVTAWWLMETIPNICDSI  592

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAPVLVWLA++ F
Sbjct  593   -SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWLASRMF  651

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P Q+WI+LINMPVLISA S+MPPATAVNYTTW++ GFLSG+VVFRYRP LWQR+NYVLSG
Sbjct  652   PRQQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPHLWQRYNYVLSG  711

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A  IIV+GCP+
Sbjct  712   ALDAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAANIIVDGCPL  763



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/710 (82%), Positives = 656/710 (92%), Gaps = 1/710 (0%)
 Frame = +3

Query  177   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAV  356
             PIREVALTVPTTDDPSLPVLTFRMWVLGTLSC+LLSFLNQFFWYR EPL+I+AISAQIAV
Sbjct  55    PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  357   VPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVK  536
             VPLG+LMAA+I+DRVF +G+KWEFTLNPGPFNVKEHVLITIFAN+GAG+VYAIHVVT VK
Sbjct  115   VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTVVK  174

Query  537   VFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEE  716
              FY K+ITFFVS ++++TTQVLGFGWAGIFR+YLVEPA MWWPANLVQVSLFRALHEKEE
Sbjct  175   AFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALHEKEE  234

Query  717   RPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglg  896
             R KGG+TRTQFFVIAF+CSFAYYVFPGYLFQMLTSLSW+CWFFP SV+AQQ+GSGL GLG
Sbjct  235   RTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMAQQIGSGLHGLG  294

Query  897   igaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSD  1076
             +GAIGLDWS+ISSYLGSPLASPWFATAN+ VGF L +YV  PI YW DVF AKTFP++S 
Sbjct  295   VGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYWLDVFKAKTFPLYSS  354

Query  1077  ELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLF  1256
              LFTS G  YNI++IIDS FHLDL+AY++EG LYLSTFFA++YG+GFAAL+AT+VHV LF
Sbjct  355   SLFTSEGSKYNITSIIDSKFHLDLQAYEREGPLYLSTFFAISYGIGFAALSATIVHVSLF  414

Query  1257  HGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQL  1436
             HGREIW+QSK SFK++K+DIHTRLM +Y++VPEWWFWCIL  NI++T+FACEYY +QLQL
Sbjct  415   HGREIWDQSKQSFKEKKIDIHTRLMRRYKEVPEWWFWCILAINISVTIFACEYYIDQLQL  474

Query  1437  PWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYI  1616
             PWWGVLLAC +AIIFTLPIGI+TAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGYI
Sbjct  475   PWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYI  534

Query  1617  SMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTAT  1796
             SM QA+ FLQDFKLGHYMKIPPR MFMAQ+VGT+++  VYL TAWWLMETIP IC +  +
Sbjct  535   SMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLATAWWLMETIPNICDSI-S  593

Query  1797  NTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPG  1976
             N+VWTCPSD VFYDASVIWGLIGPRRIFGDLG Y++VNWFFL GAIAPVLVWLA++ FP 
Sbjct  594   NSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWLASRMFPR  653

Query  1977  QEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGAL  2156
             Q+WI+LINMPVLISA S+MPPATAVNYTTW++ GFLSG+VVFRYRP LWQR+NYVLSGAL
Sbjct  654   QQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPHLWQRYNYVLSGAL  713

Query  2157  DAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             DAGLAFMGVLLY+CLGLENVSL+WWGN+LDGCP ASCP+A  IIV+GCP+
Sbjct  714   DAGLAFMGVLLYMCLGLENVSLDWWGNELDGCPLASCPTAANIIVDGCPL  763



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =  1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/755 (79%), Positives = 677/755 (90%), Gaps = 3/755 (0%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAE-EENSPIREVALTVPTTDDP  221
             E S+ +I +PL+PK E+++ +   +SSS      +PE +E +ENSPI +VALTVPTTDDP
Sbjct  3     EESSSQITSPLIPKHEQHQQQQQASSSSSISPPPVPEISESDENSPIPQVALTVPTTDDP  62

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMW LGTLSCVLLSFLNQFFWYR EPL+ITAISAQIAVVPLG+LMA++ITDRV
Sbjct  63    SLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSITAISAQIAVVPLGRLMASKITDRV  122

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+G +WEF+LNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VK FY +H+TFFVSLI+
Sbjct  123   FFKGKRWEFSLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKTFYKQHLTFFVSLIV  182

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             V+TTQVLGFGWAGIFR+YLVEPAAMWWP+NLVQVSLFRALHEKEER KG ++RTQFFVIA
Sbjct  183   VVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERIKGSLSRTQFFVIA  242

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYYV PGYLFQML SLSW+CW FP S+LAQQLGSGL GLG+G+IGLDWS+ISSYL
Sbjct  243   FICSFAYYVIPGYLFQMLISLSWVCWIFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYL  302

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+AVGF  I+Y+ TPI YW +V+ A+TFP+FSD LFT  GQ YNIS+I
Sbjct  303   GSPLASPWFATANVAVGFGFIMYILTPICYWFNVYKAQTFPMFSDGLFTGKGQKYNISSI  362

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFHLD  AY+ +G+LY+STFFA+TYGVGFAAL+AT+VHV LFHGREIWEQSKSSF++
Sbjct  363   IDSNFHLDFAAYETQGRLYISTFFAVTYGVGFAALSATIVHVALFHGREIWEQSKSSFEE  422

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHT+LM KY+QVPEWWF  IL+ NIALT+FACEYY +QLQLPWWGV+LAC IA+ F
Sbjct  423   KKMDIHTKLMRKYKQVPEWWFVLILLGNIALTIFACEYYNDQLQLPWWGVILACSIAVFF  482

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLG
Sbjct  483   TLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLG  542

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMFMAQVVGT+IA FVYLGTAWWL+ETIP+IC  +++ + WTCPSD VFYDA
Sbjct  543   HYMKIPPRTMFMAQVVGTLIASFVYLGTAWWLLETIPDIC--SSSQSFWTCPSDRVFYDA  600

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFGDLG Y +VNWFF+ GAIAPVLVWLA KAFP  EWI+LINMPVLI A
Sbjct  601   SVIWGLIGPRRIFGDLGFYSSVNWFFVVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGA  660

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNY TWI+VGFLSG+VV+RY+P+ W+RHNYVLSGALDAGLAFMGVLLY  L
Sbjct  661   TGYMPPATAVNYITWILVGFLSGFVVYRYKPEWWKRHNYVLSGALDAGLAFMGVLLYFTL  720

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             G + ++L+WWGN+LDGCP A CP+A GI VEGCP+
Sbjct  721   GSQEITLDWWGNELDGCPLAQCPTAPGIAVEGCPL  755



>ref|XP_004964383.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Setaria 
italica]
Length=775

 Score =  1177 bits (3046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/751 (79%), Positives = 662/751 (88%), Gaps = 11/751 (1%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             +I +PLLP            S+S+       E    ENSPI +VALTVP  DDPS PVLT
Sbjct  32    QITSPLLPPEP---------STSRGGSPEEDEEEVVENSPIEQVALTVPVGDDPSTPVLT  82

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FRMWVLGT SC LLSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R F RGT+
Sbjct  83    FRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGTR  142

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEF+LNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGKHITFFVSL++VLTTQV
Sbjct  143   WEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHITFFVSLLVVLTTQV  202

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE+R KGG+TR QFF++AFICSFA
Sbjct  203   LGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEQRVKGGLTRNQFFLVAFICSFA  262

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YY+FPGYLFQMLTSLSW+CW FP SV AQQLGSGL+GLGIGAIGLDWS++SSYLGSPLAS
Sbjct  263   YYIFPGYLFQMLTSLSWVCWVFPHSVFAQQLGSGLRGLGIGAIGLDWSTVSSYLGSPLAS  322

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+A GF  ++Y+ TPI YW + + A+ FPIFSD LFT++GQ YNIS+I+DS+FH
Sbjct  323   PWFATANVAAGFVFVMYIVTPIAYWFNFYKAQNFPIFSDGLFTTTGQKYNISSIVDSHFH  382

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
              D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV LFHG EIW+ SKS+F+++KMD+H
Sbjct  383   FDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVFLFHGSEIWQLSKSAFQEKKMDVH  442

Query  1320  TRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGI  1499
             T+LM +Y+QVPEWWF CILVANIA+T+FACEYY EQLQLPWWGVLLAC IA  FTLP+GI
Sbjct  443   TKLMRRYKQVPEWWFICILVANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPVGI  502

Query  1500  ITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIP  1679
             ITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMKIP
Sbjct  503   ITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIP  562

Query  1680  PRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIW  1853
             PRTMFMAQVVGT+IA FVY+GTAWWLMET+P IC T     ++ WTCP DHVFYDASVIW
Sbjct  563   PRTMFMAQVVGTLIAAFVYIGTAWWLMETVPNICNTELLPRDSPWTCPGDHVFYDASVIW  622

Query  1854  GLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNM  2033
             GLI PRRIFGDLGTY AVNWFFL GAIAP+LVWLA KAFPGQ WI LINMPVLI AT NM
Sbjct  623   GLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWLAHKAFPGQSWILLINMPVLIGATGNM  682

Query  2034  PPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLEN  2213
             PPATAVNYTTWI+VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLEN
Sbjct  683   PPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLEN  742

Query  2214  VSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +SLNWWGNDLDGCP ASCP+AKGI+VEGCPV
Sbjct  743   ISLNWWGNDLDGCPLASCPTAKGIVVEGCPV  773



>ref|XP_009412736.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =  1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/714 (82%), Positives = 652/714 (91%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDP+ PVLTFRMWVLGT SCVLLSFLNQFFWYR EPL+IT+ISAQI
Sbjct  45    NSPIEQVALTVPVEDDPTTPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA+ ITDRVFF+G++WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIHVVTA
Sbjct  105   AVVPLGHLMASTITDRVFFKGSRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHVVTA  164

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK+FY KHITFFVS ++V+TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEK
Sbjct  165   VKIFYQKHITFFVSFLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHEK  224

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TR QFF++AF+CSFAYYVFPGYL  MLTSLSW+CW FP+S+LAQQLGSGL G
Sbjct  225   EERVKGGMTRNQFFMVAFVCSFAYYVFPGYLVSMLTSLSWVCWIFPQSILAQQLGSGLYG  284

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSY+GSPLASPWFATAN+A GF LI+YV TPI YW +++ AKTFPIF
Sbjct  285   LGIGAIGLDWSTISSYIGSPLASPWFATANVAAGFVLIMYVITPISYWLNLYKAKTFPIF  344

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD LFTS+GQ YNIS+IIDSNFHLD+ AY++ G LYLSTFFA+TYG+GFA+LTAT+ HV+
Sbjct  345   SDGLFTSTGQGYNISSIIDSNFHLDIMAYEKNGPLYLSTFFAVTYGIGFASLTATISHVL  404

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHG EIW+ SKS+FK++KMDIHT+LMS+Y QVP+WWF  +L+ANIALT+FACEYY +QL
Sbjct  405   LFHGSEIWQMSKSAFKEKKMDIHTKLMSRYDQVPQWWFIAVLIANIALTIFACEYYIDQL  464

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAI FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYG
Sbjct  465   QLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYG  524

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--Q  1784
             YISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGTVIA  VYLGTAWWLMETIP+IC  +
Sbjct  525   YISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTVIAAMVYLGTAWWLMETIPDICNKE  584

Query  1785  TTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
                +++ WTCP DHVFYDASVIWGLIGPRRIFGDLGTY  VNWFFLAGA+APVLVW   K
Sbjct  585   LLPSDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSNVNWFFLAGALAPVLVWFGHK  644

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP QEWIRLINMPVLI AT +MPPATAVNY TWIIVGFLSGYVV+RYR D WQRHNYVL
Sbjct  645   AFPNQEWIRLINMPVLIGATGSMPPATAVNYITWIIVGFLSGYVVYRYRRDWWQRHNYVL  704

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFMGVLLYLCLGLENV+L+W GNDLDGCP ASCP+AKG+++EGCPV
Sbjct  705   SGALDAGLAFMGVLLYLCLGLENVNLSWPGNDLDGCPLASCPTAKGVVIEGCPV  758



>dbj|BAD67732.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=763

 Score =  1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/757 (78%), Positives = 658/757 (87%), Gaps = 22/757 (3%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             DEI  P L                 S     PE  EEENSPI +VALTVP +D+P  PVL
Sbjct  20    DEITAPFL---------------RPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVL  64

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMWVLGT SC +LSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R FFRG 
Sbjct  65    TFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGR  124

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
              WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGKHI+FFVSL++VLTTQ
Sbjct  125   PWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQ  184

Query  597   V-----LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             V     LGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TR QFF++A
Sbjct  185   VVDDQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARSKGGLTRNQFFLVA  244

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYY+FPGYLFQMLTSLSWICW FP SVLAQQLGSGL GLGIGAIGLDWS++SSYL
Sbjct  245   FICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTVSSYL  304

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GFF I+Y+ TPI YW + + A+ FPIFSD LFTS+GQ YNIS+I
Sbjct  305   GSPLASPWFATANVAAGFFFIMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYNISSI  364

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             +DS+FH D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW+ SKS+F++
Sbjct  365   VDSHFHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQE  424

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             ++MDIHT+LM +Y+QVPEWWF CIL+ANIA+T+FACEYY EQLQLPWWGVLLAC IA  F
Sbjct  425   KRMDIHTKLMRRYKQVPEWWFVCILIANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFF  484

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLG
Sbjct  485   TLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLG  544

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFY  1835
             HYMKIPPRTMFMAQVVGT+IA FVY+GTAWWLMETIP IC T    +++ WTCP DHVFY
Sbjct  545   HYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGDHVFY  604

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLI PRRIFGDLGTY AVNWFFL GAIAPVLVW A KAFP Q WI LINMPVLI
Sbjct  605   DASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINMPVLI  664

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
              AT  MPPATAVNYTTWI+VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YL
Sbjct  665   GATGQMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYL  724

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             CLGLEN+SLNWWGNDLDGCP ASCP+AKG++V+GCPV
Sbjct  725   CLGLENISLNWWGNDLDGCPLASCPTAKGVVVDGCPV  761



>ref|XP_008806360.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=766

 Score =  1175 bits (3040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/714 (82%), Positives = 653/714 (91%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDPS+PVLTFRMWVLGT+SC LLSFLNQFFWYR EPL+IT+ISAQI
Sbjct  52    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQI  111

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA  ITDRVFF+G +WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIHVVTA
Sbjct  112   AVVPLGHLMARTITDRVFFKGRRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVTA  171

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK+FY +HITFFVSL++VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEK
Sbjct  172   VKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHEK  231

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E RPK G+TR QFF++AFICSF YYVFPGYLF MLTSLSWICW FPRS+LAQQLGSGL G
Sbjct  232   EARPKHGLTRNQFFMVAFICSFGYYVFPGYLFSMLTSLSWICWIFPRSILAQQLGSGLYG  291

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSYLGSPLASPWFATAN+A GF LI+YV TP  YW +++ AKTFPIF
Sbjct  292   LGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYWLNLYKAKTFPIF  351

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD LF+S+GQ+YNIS+IIDSNFHLD++AY++EG LYLSTFFA+TYGVGFA+LTA + HV+
Sbjct  352   SDGLFSSTGQSYNISSIIDSNFHLDVDAYEKEGPLYLSTFFAVTYGVGFASLTAIVSHVL  411

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIW+ SKS+F+++KMD+HTRLM +Y+QVP+WWF CILVAN+ALT+FACEYY +QL
Sbjct  412   LFHGREIWQMSKSAFQEKKMDVHTRLMRQYKQVPQWWFICILVANVALTIFACEYYIDQL  471

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AI FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYG
Sbjct  472   QLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYG  531

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYLGTAWWLM+TIP IC T 
Sbjct  532   YISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNICDTE  591

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
               ++++ WTCPSDHVF+DASVIWGLIGPRRIFGDLGTY A+NWFFLAGAIAP+L+WLA K
Sbjct  592   LLSSDSPWTCPSDHVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLIWLAHK  651

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP ++WI LINMPVLI AT  MPPATA NY TWIIVGFLSG+VV+RYR D WQRHNYVL
Sbjct  652   AFPKKQWISLINMPVLIGATHKMPPATAANYATWIIVGFLSGFVVYRYRRDWWQRHNYVL  711

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALD+GLAFM VLLYLCLGLE+VSL WWGNDLDGC  ASCP+AKG++V+GCPV
Sbjct  712   SGALDSGLAFMAVLLYLCLGLEDVSLKWWGNDLDGCSLASCPTAKGVVVDGCPV  765



>ref|XP_008437437.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7 [Cucumis 
melo]
Length=752

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/754 (79%), Positives = 668/754 (89%), Gaps = 6/754 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E S+ +I +PL+PK E+       + S     E    +  +ENSPI +VALTVPT+DDPS
Sbjct  3     EESSSQITSPLIPKHEQQRQASSSSISPSPDPEI---SESDENSPIPQVALTVPTSDDPS  59

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMW LGTLSCVLLSFLNQFFWYR EPL+ITAISAQIAVVPLG+LMA++ITDRVF
Sbjct  60    LPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSITAISAQIAVVPLGRLMASKITDRVF  119

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
              +G +WEF+LNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VK FY +H+TFFVSLI+V
Sbjct  120   -KGKRWEFSLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKTFYKQHLTFFVSLIVV  178

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKEER KG ++RTQFFVIAF
Sbjct  179   VTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKEERSKGSLSRTQFFVIAF  238

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             ICSFAYYVFPGYLFQMLTSLSW+CW FP S+LAQQLGSGL GLG+G+IGLDWS+ISSYLG
Sbjct  239   ICSFAYYVFPGYLFQMLTSLSWVCWIFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYLG  298

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+AVGF  I+Y+ TPI YW +V+ A+TFPIFSD LFT  G  YNIS+II
Sbjct  299   SPLASPWFATANVAVGFGFIMYILTPICYWFNVYKAQTFPIFSDGLFTGKGHKYNISSII  358

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             D NFHLD  AY+ +G+LY+STFFA+TYGVGFAAL+AT+VHV LFHGREIWEQSKSSF+++
Sbjct  359   DPNFHLDFAAYETQGRLYISTFFAVTYGVGFAALSATIVHVALFHGREIWEQSKSSFEEK  418

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
             KMDIHT+LMSKY+QVPEWWF  IL+ NIALT+FACEYY +QLQLPWWGVLLAC IA+ FT
Sbjct  419   KMDIHTKLMSKYKQVPEWWFVLILLGNIALTIFACEYYNDQLQLPWWGVLLACSIAVFFT  478

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGH
Sbjct  479   LPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGH  538

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDAS  1844
             YMKIPPRTMFMAQVVGT+IA  VYLGTAWWL+ETIP+IC  +++ + WTCPSD VFYDAS
Sbjct  539   YMKIPPRTMFMAQVVGTLIASLVYLGTAWWLLETIPDIC--SSSQSFWTCPSDRVFYDAS  596

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGDLG Y +VNWFFL GAIAPVLVWLA KAFP  EWI+LINMPVLI AT
Sbjct  597   VIWGLIGPRRIFGDLGYYASVNWFFLVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGAT  656

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
               MPPATAVNY TWI++GFLSG+VV+RY+P+ W+RHNYVLSGALDAGLAFMGVLLY  LG
Sbjct  657   GYMPPATAVNYITWILMGFLSGFVVYRYKPEWWRRHNYVLSGALDAGLAFMGVLLYFTLG  716

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             L+  +L+WWGNDLDGCP A CP+A GI VEGCP+
Sbjct  717   LQETTLDWWGNDLDGCPLAQCPTAPGIAVEGCPL  750



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =  1174 bits (3038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/752 (78%), Positives = 662/752 (88%), Gaps = 3/752 (0%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             D+I TPLL  VE        + +          ++E ENSPI +VALTVP  DDP+ PVL
Sbjct  33    DQITTPLL-LVEATTSTSRSSPAGDEHYSDDLSSSEGENSPIEQVALTVPVGDDPTTPVL  91

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMWVLGT SC LLSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R F RGT
Sbjct  92    TFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGT  151

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             +WEF+LNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGK+ITFFVSL++VLTTQ
Sbjct  152   RWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKNITFFVSLLVVLTTQ  211

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             VLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHE+E R KGG+TR QFF++AFICSF
Sbjct  212   VLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHERERRVKGGMTRNQFFLVAFICSF  271

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYY+FPGYLFQMLTSLSWICW FP SVLAQQLGSGL GLGIGAIGLDWS+ISSYLGSPLA
Sbjct  272   AYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLTGLGIGAIGLDWSTISSYLGSPLA  331

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATAN+A GFF+I+YV TPI YW + + A+ FPIFSD LFT +GQTYNIS+I+DS+F
Sbjct  332   SPWFATANVAAGFFIIMYVITPIAYWFNFYKAQNFPIFSDGLFTLTGQTYNISSIVDSHF  391

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
               D EAY++ G LYLSTFFA+TYGVGFA+LTAT+VHV LFHG EI + SKS+F+++K+DI
Sbjct  392   QFDTEAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVFLFHGSEILQLSKSAFQEKKVDI  451

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM +Y+QVPEWWF CIL+ANIA+T+FACEYY EQLQLPWWGVLLAC IA  FTLPIG
Sbjct  452   HTKLMRRYKQVPEWWFICILIANIAVTIFACEYYIEQLQLPWWGVLLACAIAFTFTLPIG  511

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMKI
Sbjct  512   IITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKI  571

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PPRTMFMAQVVGT+IA FVYLGTAWWLM+T+P IC T    +++ WTCP DHVFYDASVI
Sbjct  572   PPRTMFMAQVVGTLIAAFVYLGTAWWLMDTVPNICNTELLPSDSPWTCPGDHVFYDASVI  631

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLI PRRIFGDLGTY AVNWFFL GA+AP+LVWLA KAFP Q WI LINMPV+I AT  
Sbjct  632   WGLISPRRIFGDLGTYSAVNWFFLGGAVAPLLVWLAHKAFPSQSWILLINMPVMIGATGM  691

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYTTWI+VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLE
Sbjct  692   MPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLE  751

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             N+SLNWWGNDLDGCP +SCP+AKGI+VEGCPV
Sbjct  752   NISLNWWGNDLDGCPLSSCPTAKGIVVEGCPV  783



>ref|XP_010934487.1| PREDICTED: oligopeptide transporter 7 [Elaeis guineensis]
Length=765

 Score =  1174 bits (3036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/714 (82%), Positives = 655/714 (92%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDPS+PVLTFRMWVLGT+SC LLSFLNQFFWYR EPL+IT+ISAQI
Sbjct  51    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTVSCALLSFLNQFFWYRKEPLSITSISAQI  110

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA  ITDRVFF+G +WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIHVVTA
Sbjct  111   AVVPLGHLMARTITDRVFFKGRRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHVVTA  170

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK+FY +HITFFVSL++VLTTQVLGFGWAGIFR++LVEPAAMWWP NLVQVSLFRALHEK
Sbjct  171   VKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRQHLVEPAAMWWPYNLVQVSLFRALHEK  230

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E RPK G+TR QFF++AF+CSFAYYVFPGYLF MLTSLSWICW FP SVLAQQLGSGL G
Sbjct  231   EVRPKHGLTRNQFFMVAFVCSFAYYVFPGYLFSMLTSLSWICWIFPGSVLAQQLGSGLYG  290

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSYLGSPLASPWFATAN+A GF +I+YV TP  YW +++ AKTFPIF
Sbjct  291   LGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVIIMYVITPTAYWLNLYKAKTFPIF  350

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD LFTS+GQ+YNIS+IIDS+FHLD+EAY++EG LYLS FFA+TYGVGFA+LTAT+ HV+
Sbjct  351   SDGLFTSTGQSYNISSIIDSDFHLDVEAYEKEGPLYLSAFFAVTYGVGFASLTATVSHVL  410

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIW+ SKS+F+++K+D+HT+LM +Y+QVP+WWF CILVAN+ALT+FACEYY +QL
Sbjct  411   LFHGREIWQMSKSAFQEKKIDVHTKLMRQYKQVPQWWFICILVANVALTIFACEYYIDQL  470

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IAI FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYG
Sbjct  471   QLPWWGVLLACGIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYG  530

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYLGTAWWLM+TIP IC T 
Sbjct  531   YISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNICNTE  590

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
               ++++ WTCPSDHVFYDASVIWGLIGPRRIFGDLGTY A+NWFFLAGAIAP+LVWLA K
Sbjct  591   LLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLVWLAHK  650

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP Q+WI LINMPVLI AT  MPPATAVNYTTWI VGFLSG+VV+RYR D WQRHNYVL
Sbjct  651   AFPNQKWISLINMPVLIGATGMMPPATAVNYTTWITVGFLSGFVVYRYRRDWWQRHNYVL  710

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFM VLLYLCLGLE+VSLNWWGNDLDGC  ASCP+AKG++V+GCPV
Sbjct  711   SGALDAGLAFMAVLLYLCLGLEDVSLNWWGNDLDGCALASCPTAKGVVVDGCPV  764



>ref|XP_004163578.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=835

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/750 (79%), Positives = 671/750 (89%), Gaps = 3/750 (0%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAE-EENSPIREVALTVPTTDDPSLPVL  236
             EI    +PK E+++ +   +SSS      +PE +E +ENSPI +VALTVPTTDDPSLPVL
Sbjct  86    EIAINGIPKHEQHQQQQQASSSSSISPPPVPEISESDENSPIPQVALTVPTTDDPSLPVL  145

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMW LGTLSCVLLSFLNQFFWYR EPL+ITAISAQIAVVPLG+LMA++ITDRVFF+G 
Sbjct  146   TFRMWFLGTLSCVLLSFLNQFFWYRKEPLSITAISAQIAVVPLGRLMASKITDRVFFKGK  205

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             +WEF+LNPGPFNVKEHVLITIFANSGAG+VYAIHVVT VK FY +H+TFFVSLI+V+TTQ
Sbjct  206   RWEFSLNPGPFNVKEHVLITIFANSGAGSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQ  265

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             VLGFGWAGIFR+YLVEPAAMWWP+NLVQVSLFRALHEKEER KG ++RTQFFVIAFICSF
Sbjct  266   VLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERIKGSLSRTQFFVIAFICSF  325

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYYV PGYLFQML SLSW+CW FP S+LAQQLGSGL GLG+G+IGLDWS+ISSYLGSPLA
Sbjct  326   AYYVIPGYLFQMLISLSWVCWIFPTSILAQQLGSGLYGLGLGSIGLDWSTISSYLGSPLA  385

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATAN+AVGF  I+Y+ TPI YW +V+ A+TFP+FSD LFT  GQ YNIS+IIDSNF
Sbjct  386   SPWFATANVAVGFGFIMYILTPICYWFNVYKAQTFPMFSDGLFTGKGQKYNISSIIDSNF  445

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             HLD  AY+ +G+LY+STFFA+TYGVGFAAL+AT+VHV LFHGREIWEQSKSSF+++KMDI
Sbjct  446   HLDFAAYETQGRLYISTFFAVTYGVGFAALSATIVHVALFHGREIWEQSKSSFEEKKMDI  505

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM KY+QVPEWWF  IL+ NIALT+FACEYY +QLQLPWWGV+LAC IA+ FTLPIG
Sbjct  506   HTKLMRKYKQVPEWWFVLILLGNIALTIFACEYYNDQLQLPWWGVILACSIAVFFTLPIG  565

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGHYMKI
Sbjct  566   IITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKI  625

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWG  1856
             PPRTMFMAQVVGT+IA FVYLGTAWWL+ETIP+IC  +++ + WTCPSD VFYDASVIWG
Sbjct  626   PPRTMFMAQVVGTLIASFVYLGTAWWLLETIPDIC--SSSQSFWTCPSDRVFYDASVIWG  683

Query  1857  LIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMP  2036
             LIGPRRIFGDLG Y +VNWFF+ GAIAPVLVWLA KAFP  EWI+LINMPVLI AT  MP
Sbjct  684   LIGPRRIFGDLGFYSSVNWFFVVGAIAPVLVWLAIKAFPQHEWIKLINMPVLIGATGYMP  743

Query  2037  PATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENV  2216
             PATAVNY TWI+VGFLSG+VV+RY+P+ W+RHNYVLSGALDAGLAFMGVLLY  LG + +
Sbjct  744   PATAVNYITWILVGFLSGFVVYRYKPEWWKRHNYVLSGALDAGLAFMGVLLYFTLGSQEI  803

Query  2217  SLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +L+WWGN+LDGCP A CP+A GI VEGCP+
Sbjct  804   TLDWWGNELDGCPLAQCPTAPGIAVEGCPL  833



>gb|KCW77331.1| hypothetical protein EUGRSUZ_D01692 [Eucalyptus grandis]
Length=686

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/687 (85%), Positives = 642/687 (93%), Gaps = 3/687 (0%)
 Frame = +3

Query  246   MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWE  425
             MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLG+LMAARITDRVF +GT+WE
Sbjct  1     MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMAARITDRVFLKGTRWE  60

Query  426   FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLG  605
             FTLNPGPFNVKEHVLITIFANSGAGTVYAI+VVT VKVFY K ITFFVSLI+V+TTQVLG
Sbjct  61    FTLNPGPFNVKEHVLITIFANSGAGTVYAIYVVTVVKVFYKKQITFFVSLIVVITTQVLG  120

Query  606   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYY  785
             FGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEKEERPKGG+TRTQFF+IAFICSFAYY
Sbjct  121   FGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGVTRTQFFLIAFICSFAYY  180

Query  786   VFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPW  965
             VFPGY+F+MLTS+SWICW FP+SVLAQQLGSGL GLGI A GLDWS+ISSYLGSPLASPW
Sbjct  181   VFPGYIFEMLTSMSWICWIFPKSVLAQQLGSGLYGLGITAFGLDWSTISSYLGSPLASPW  240

Query  966   FATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLD  1145
             FATAN+AVGF  ++YV TPI YW +V+ AKTFPIFSD+LFTS+GQ YNIS+IID+NFHLD
Sbjct  241   FATANVAVGFVFVMYVLTPICYWLNVYKAKTFPIFSDDLFTSTGQEYNISSIIDANFHLD  300

Query  1146  LEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTR  1325
             L AY++EG LYLSTFFA+TYGVGFA+LTAT+VHV LFHGREIW QSK+SF+D+  DIHTR
Sbjct  301   LAAYEKEGPLYLSTFFAMTYGVGFASLTATVVHVALFHGREIWAQSKASFQDKTADIHTR  360

Query  1326  LMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIIT  1505
             +M +Y+QVPEWWFWCILV NIA T+FACEYY  QLQLPWWGVLLAC+IAI+FTLPIGIIT
Sbjct  361   MMRRYQQVPEWWFWCILVVNIAATIFACEYYNSQLQLPWWGVLLACLIAIVFTLPIGIIT  420

Query  1506  AITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPR  1685
             AITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPP+
Sbjct  421   AITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHYMKIPPK  480

Query  1686  TMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIG  1865
             TMFMAQVVGT+IAG VYL TAWWLMETIP+IC+T+   +VWTCPSD VFYDASVIWGLIG
Sbjct  481   TMFMAQVVGTLIAGVVYLSTAWWLMETIPDICETS---SVWTCPSDTVFYDASVIWGLIG  537

Query  1866  PRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPAT  2045
             PRRIFGD GTYEA+NWFFL GAIAP+LVWLA KAFP QEWI LINMPVLI AT  MPPAT
Sbjct  538   PRRIFGDEGTYEAINWFFLGGAIAPILVWLAHKAFPEQEWISLINMPVLIGATGYMPPAT  597

Query  2046  AVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN  2225
             AVNYTTWII GFLSG+VV+RYRP+LW+++NYVLSGALDAGLAFMGVLLYLCLGLE++ L+
Sbjct  598   AVNYTTWIIAGFLSGFVVYRYRPELWKKYNYVLSGALDAGLAFMGVLLYLCLGLESIDLD  657

Query  2226  WWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             WWGNDLDGCP A+CP+A G++VEGCPV
Sbjct  658   WWGNDLDGCPLATCPTAVGVVVEGCPV  684



>ref|XP_007145948.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
 gb|ESW17942.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
Length=760

 Score =  1166 bits (3016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/764 (78%), Positives = 674/764 (88%), Gaps = 15/764 (2%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEG--------RHGFASSSKSKVESLPEAAEEENSPIREVAL  197
             ME S+ EI +PLL    E EG              + + + E   +  EEENSPI++VA+
Sbjct  1     MEQSSHEITSPLL----EDEGGSNRNRIRNRNKHRNGEGEKEEEDDEDEEENSPIKQVAM  56

Query  198   TVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLM  377
             TV TTDDPSLPVLTFRMWVLG+LSCV+LSFLNQFFWYR EPL ITAISAQIAVVPLGQLM
Sbjct  57    TVSTTDDPSLPVLTFRMWVLGSLSCVVLSFLNQFFWYRREPLAITAISAQIAVVPLGQLM  116

Query  378   AARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHI  557
             AA +T RVF RGT+WEF LNPGPFNVKEHVLITIFANSGAG VYAIH+VTAVK+FY +HI
Sbjct  117   AATMTKRVFLRGTRWEFRLNPGPFNVKEHVLITIFANSGAGNVYAIHIVTAVKIFYRQHI  176

Query  558   TFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGIT  737
             +FFVSL++V+TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK+ER KGG+T
Sbjct  177   SFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKDERAKGGLT  236

Query  738   RTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglD  917
             R+QFFV+AF+CSFAYYVFPGY+FQML SLSW+CW FP ++LAQQLGSGL GLGIGA+GLD
Sbjct  237   RSQFFVMAFVCSFAYYVFPGYIFQMLVSLSWVCWLFPNNILAQQLGSGLYGLGIGAVGLD  296

Query  918   WSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSG  1097
             WS+ISSYLGSPLASPWFATANIAVGF L++YV TP+ YW +V+ AKTFPIFS++LFT  G
Sbjct  297   WSTISSYLGSPLASPWFATANIAVGFVLVIYVLTPLCYWFNVYRAKTFPIFSNKLFTDQG  356

Query  1098  QTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWE  1277
             Q YNI+AIIDSNFHLDL AY ++ +LYLSTFFA+TYGVGFAALTAT++HV LFHGREIWE
Sbjct  357   QIYNITAIIDSNFHLDLAAYQRQDRLYLSTFFAITYGVGFAALTATVMHVALFHGREIWE  416

Query  1278  QSKSSFKDR-KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
             QSK SFK++  +DIHT+LM +Y+QVPEWWF CIL+A IA TVF CEYYK QLQLPWWGVL
Sbjct  417   QSKWSFKEKTSVDIHTKLMRRYKQVPEWWFVCILLATIAATVFTCEYYKAQLQLPWWGVL  476

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC IAI FTLPIGIITAITNQ+PGLN+ITEYIIGY+YPGYPVANMCFKVYGYISMTQAI
Sbjct  477   LACAIAIFFTLPIGIITAITNQSPGLNVITEYIIGYMYPGYPVANMCFKVYGYISMTQAI  536

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTC  1814
              FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYL TAWWLMETIP+IC+ ++  +VWTC
Sbjct  537   TFLQDFKLGHYMKIPPRTMFMAQVVGTLIASLVYLLTAWWLMETIPDICKDSS--SVWTC  594

Query  1815  PSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRL  1994
             PSD VFYDASVIWGLIGPRRIFGDLGTYE VNWFFL GAIAP+LVWL  ++FP QEWIRL
Sbjct  595   PSDTVFYDASVIWGLIGPRRIFGDLGTYENVNWFFLGGAIAPLLVWLVARSFPQQEWIRL  654

Query  1995  INMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAF  2174
             INMPVLI AT  MPPATAVNYT+WIIVGFLSG+VVFRY+P+ W+RHNYVLSGALDAGLAF
Sbjct  655   INMPVLIGATGMMPPATAVNYTSWIIVGFLSGFVVFRYKPEWWKRHNYVLSGALDAGLAF  714

Query  2175  MGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             M VLLYLCLGLE++S++WWGN+LD CP A CP+AKG+ + GCPV
Sbjct  715   MAVLLYLCLGLEDISMSWWGNELDACPLAHCPTAKGVHIPGCPV  758



>ref|NP_001130398.1| uncharacterized protein LOC100191494 [Zea mays]
 gb|ACG28837.1| oligopeptide transporter 9 [Zea mays]
 gb|ACL53218.1| unknown [Zea mays]
 gb|AFW86095.1| oligopeptide transporter 9 [Zea mays]
Length=781

 Score =  1165 bits (3015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/752 (78%), Positives = 660/752 (88%), Gaps = 15/752 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             +I TPLL +          A+++ S   S  E  + ENSPI +VALTVP  DDPS PVLT
Sbjct  40    QITTPLLVE----------AATTSSPSPS--EGDDPENSPIEQVALTVPVGDDPSTPVLT  87

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FRMWVLGT SC LLSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA +  R   RGT+
Sbjct  88    FRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPARAVLRGTR  147

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEF+LNPGPF+VKEHVL+TIFANSGAGTVYAIHV+TAV+VFYGKHITFFVSL++VLTTQV
Sbjct  148   WEFSLNPGPFSVKEHVLVTIFANSGAGTVYAIHVITAVRVFYGKHITFFVSLLVVLTTQV  207

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TR QFF++AF+CSFA
Sbjct  208   LGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRVKGGMTRNQFFLVAFVCSFA  267

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYLFQMLTSLSW+CW FPRSV+AQQLGSGL GLG+GA+GLDWS+ISSYLGSPLAS
Sbjct  268   YYVFPGYLFQMLTSLSWLCWAFPRSVVAQQLGSGLSGLGVGAVGLDWSTISSYLGSPLAS  327

Query  960   PWFATANIAVGFFLILYVFTP-IFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             PWFATAN+A GF LI+YV TP  +YW  ++ A++FPIFSD LFT++GQTYNIS+I+DSNF
Sbjct  328   PWFATANVAAGFVLIMYVITPAAYYWLGLYGARSFPIFSDGLFTAAGQTYNISSIVDSNF  387

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
               D EAY++ G LYLSTFFA+TYGVGFA+LTAT+VHV LFHG EIW+ S+S+F+++K+D+
Sbjct  388   RFDTEAYERNGPLYLSTFFAVTYGVGFASLTATVVHVFLFHGSEIWQLSRSAFQEKKVDV  447

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HTRLM +YRQVPEWWF CILVAN+A+T+FACEYY EQLQLPWWGVLLAC IA  FTLPIG
Sbjct  448   HTRLMRRYRQVPEWWFICILVANVAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIG  507

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISMTQA+AFLQDFKLGHYMKI
Sbjct  508   IITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMTQALAFLQDFKLGHYMKI  567

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PPRTMFMAQVVGT+IA  VY+GTAWWLM+++P IC T     ++ WTCP DHVFYDASVI
Sbjct  568   PPRTMFMAQVVGTLIAALVYIGTAWWLMDSVPNICSTELLPADSPWTCPMDHVFYDASVI  627

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRRIFGDLGTY AVNWFFL GA+AP+LVWLA + FP Q WI L+NMPVLI +T  
Sbjct  628   WGLIGPRRIFGDLGTYSAVNWFFLGGAVAPLLVWLAHRVFPSQSWILLVNMPVLIGSTGM  687

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYTTWII GFLSGYVV+RYR   W+RHNY+LSGALDAGLAFM VL+YLCLGLE
Sbjct  688   MPPATAVNYTTWIIAGFLSGYVVYRYRRHWWERHNYLLSGALDAGLAFMAVLIYLCLGLE  747

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             NV LNWWGNDLDGCP ASCP+AKGI+VEGCPV
Sbjct  748   NVGLNWWGNDLDGCPLASCPTAKGIVVEGCPV  779



>ref|XP_004964382.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Setaria 
italica]
Length=803

 Score =  1164 bits (3012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/779 (76%), Positives = 662/779 (85%), Gaps = 39/779 (5%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             +I +PLLP            S+S+       E    ENSPI +VALTVP  DDPS PVLT
Sbjct  32    QITSPLLPPEP---------STSRGGSPEEDEEEVVENSPIEQVALTVPVGDDPSTPVLT  82

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FRMWVLGT SC LLSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R F RGT+
Sbjct  83    FRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGTR  142

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEF+LNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGKHITFFVSL++VLTTQV
Sbjct  143   WEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHITFFVSLLVVLTTQV  202

Query  600   ----------------------------LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  695
                                         LGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFR
Sbjct  203   SEGCTEKAFASLLLRGVRDYSLSFDMQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFR  262

Query  696   ALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlg  875
             ALHEKE+R KGG+TR QFF++AFICSFAYY+FPGYLFQMLTSLSW+CW FP SV AQQLG
Sbjct  263   ALHEKEQRVKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWVCWVFPHSVFAQQLG  322

Query  876   sglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAK  1055
             SGL+GLGIGAIGLDWS++SSYLGSPLASPWFATAN+A GF  ++Y+ TPI YW + + A+
Sbjct  323   SGLRGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFVFVMYIVTPIAYWFNFYKAQ  382

Query  1056  TFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTAT  1235
              FPIFSD LFT++GQ YNIS+I+DS+FH D +AY++ G LYLSTFFA+TYGVGFA+LTAT
Sbjct  383   NFPIFSDGLFTTTGQKYNISSIVDSHFHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTAT  442

Query  1236  LVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEY  1415
             +VHV LFHG EIW+ SKS+F+++KMD+HT+LM +Y+QVPEWWF CILVANIA+T+FACEY
Sbjct  443   IVHVFLFHGSEIWQLSKSAFQEKKMDVHTKLMRRYKQVPEWWFICILVANIAVTIFACEY  502

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y EQLQLPWWGVLLAC IA  FTLP+GIITA TNQTPGLNIITEYI+GY+YPG PVANMC
Sbjct  503   YIEQLQLPWWGVLLACAIAFFFTLPVGIITATTNQTPGLNIITEYIMGYLYPGRPVANMC  562

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISM+QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA FVY+GTAWWLMET+P 
Sbjct  563   FKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETVPN  622

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             IC T     ++ WTCP DHVFYDASVIWGLI PRRIFGDLGTY AVNWFFL GAIAP+LV
Sbjct  623   ICNTELLPRDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLV  682

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLA KAFPGQ WI LINMPVLI AT NMPPATAVNYTTWI+VGFLSGYVV+RYR D W+R
Sbjct  683   WLAHKAFPGQSWILLINMPVLIGATGNMPPATAVNYTTWILVGFLSGYVVYRYRRDWWER  742

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             HNY+LSGALDAGLAFM VL+YLCLGLEN+SLNWWGNDLDGCP ASCP+AKGI+VEGCPV
Sbjct  743   HNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWGNDLDGCPLASCPTAKGIVVEGCPV  801



>ref|XP_010676881.1| PREDICTED: oligopeptide transporter 7 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =  1157 bits (2993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/756 (74%), Positives = 658/756 (87%), Gaps = 3/756 (0%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             ME   + + +P +P+ E ++      +    ++ S       ENSP+++VALTVP TDDP
Sbjct  1     MENEIENLHSPFIPRDEHHQDEK---NEESQRLISSSSTKSTENSPVKQVALTVPITDDP  57

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
              LPVLTFR WVLG +SC++LSFLNQFFWYRTEPL++T I+AQIAVVPLG  MA+ + +  
Sbjct  58    ELPVLTFRTWVLGMVSCIVLSFLNQFFWYRTEPLSVTGIAAQIAVVPLGHWMASNLPNGS  117

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
              FRGT+WEF++NPGPFNVKEHVLITIFAN+GAGTVYAIHVVTAVK+FY K+ITFFVSL++
Sbjct  118   LFRGTRWEFSMNPGPFNVKEHVLITIFANAGAGTVYAIHVVTAVKIFYKKNITFFVSLLV  177

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             VLTTQVLGFGWAG+FRRYLVEPA MWWPANLVQVSLFRALHEKEERPKGG+TRTQFF+IA
Sbjct  178   VLTTQVLGFGWAGVFRRYLVEPAEMWWPANLVQVSLFRALHEKEERPKGGLTRTQFFLIA  237

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F CSFAYYVFPGY+FQMLTSLSWICW +P+S+LAQQ+GSGL G+GIGA G+DWS+ISSYL
Sbjct  238   FTCSFAYYVFPGYIFQMLTSLSWICWAWPKSILAQQVGSGLHGIGIGAFGMDWSTISSYL  297

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A G+ L++YV  PI YW +++ AKTFPIFS+ LFTS+G  YN+SAI
Sbjct  298   GSPLASPWFATANVAAGYVLLMYVVVPITYWLNIYKAKTFPIFSNHLFTSTGSIYNVSAI  357

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             +DSNFH + EAYD++G LYLSTFF +TYGVGFAAL+AT+VHV LFHGREIW+QSK+S K+
Sbjct  358   VDSNFHFNQEAYDKQGPLYLSTFFTMTYGVGFAALSATIVHVALFHGREIWDQSKASLKE  417

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHT+LM +Y++ P+WWFW ILV NIA+ +FACEYYKEQLQLPWWGVLLAC IA IF
Sbjct  418   KKMDIHTKLMRRYKEAPDWWFWVILVVNIAVAIFACEYYKEQLQLPWWGVLLACAIAFIF  477

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIG+ITAI NQ P LN+ITEYIIGYIYPGYPVANMCFKVYG ISM QA+ FLQDFKLG
Sbjct  478   TLPIGVITAIANQAPHLNVITEYIIGYIYPGYPVANMCFKVYGNISMKQAVTFLQDFKLG  537

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPR+MF+AQVVGT+I+  VYL TAWWLMETIP+IC+   +++VWTCP D VFYDA
Sbjct  538   HYMKIPPRSMFIAQVVGTLISSLVYLSTAWWLMETIPDICERHNSSSVWTCPGDTVFYDA  597

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPR+IFG  G Y AVNWFFL GAI P+ VWLATK+FP QEWIRLINMP+LI A
Sbjct  598   SVIWGLIGPRKIFGGEGIYGAVNWFFLVGAIGPIFVWLATKSFPNQEWIRLINMPILIGA  657

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             TS+MPPATAVNYTTWI+VGFLSGYV FRY P+ W+RHNY+LSGALDAGLAFMGV LYLCL
Sbjct  658   TSSMPPATAVNYTTWILVGFLSGYVAFRYAPEWWKRHNYLLSGALDAGLAFMGVALYLCL  717

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             G E +SLNWWGN+LDGCPYASCP+ KG++V GCPV+
Sbjct  718   GSEQLSLNWWGNELDGCPYASCPTEKGVVVLGCPVV  753



>ref|XP_006655730.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=765

 Score =  1152 bits (2979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/757 (77%), Positives = 658/757 (87%), Gaps = 20/757 (3%)
 Frame = +3

Query  54    ADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPV  233
              DEI +PLL             S+S+    S     EEENSPI +VALTVP  D+P  PV
Sbjct  21    GDEIASPLLRP-----------STSR---RSPELEEEEENSPIEQVALTVPVGDEPGTPV  66

Query  234   LTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRG  413
             LTFRMWVLG +SC +LSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R FFRG
Sbjct  67    LTFRMWVLGVVSCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRG  126

Query  414   TKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTT  593
               WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGKHI+FFVSL++VLTT
Sbjct  127   RPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTT  186

Query  594   Q----VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             Q    VLG GWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE+R KGG+TR QFF++A
Sbjct  187   QLVDQVLGSGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEQRSKGGLTRNQFFLVA  246

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYY+FPGYLFQMLTSLSWICW FP SVLAQQLGSGL GLGIGAIGLDWS++SSYL
Sbjct  247   FICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTVSSYL  306

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+A GFF I+Y+ TPI YW + + A+ FPIFSD LFTS+GQ YNIS+I
Sbjct  307   GSPLASPWFATANVAAGFFFIMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYNISSI  366

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             +DS+FH D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW+ SKS+F++
Sbjct  367   VDSHFHFDTQAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQE  426

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             ++MDIHT+LM +Y+QVPE WF CIL+ANIA+T+F CEYY EQLQLPWWGVLLAC +A  F
Sbjct  427   KRMDIHTKLMRRYKQVPESWFVCILIANIAITIFTCEYYIEQLQLPWWGVLLACALAFFF  486

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLG
Sbjct  487   TLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLG  546

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFY  1835
             HYMKIPPRTMFMAQVVGT+IA FVY+GTAWWLMET+P IC T    +++ WTCP DHVFY
Sbjct  547   HYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETVPNICNTELLPSDSPWTCPGDHVFY  606

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLI PRRIFGDLGTY AVNWFFL GAIAPVLVW A KAFP Q WI LINMPVLI
Sbjct  607   DASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINMPVLI  666

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
              AT  MPPATAVNYTTWI+VGFLSGYVV++YR D W+RHNY+LSGALDAGLAFM VL+YL
Sbjct  667   GATGQMPPATAVNYTTWILVGFLSGYVVYKYRRDWWERHNYLLSGALDAGLAFMAVLIYL  726

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             CLGLEN+SLNW GNDLDGCP ASCP+AKG++VEGCPV
Sbjct  727   CLGLENISLNWSGNDLDGCPLASCPTAKGVVVEGCPV  763



>ref|XP_003564333.1| PREDICTED: oligopeptide transporter 7-like [Brachypodium distachyon]
Length=772

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/719 (79%), Positives = 641/719 (89%), Gaps = 2/719 (0%)
 Frame = +3

Query  156   AAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITA  335
              A EENSPI +VALTVP  DDP+ PVLTFRMWVLGT SCV+LSFLNQFFWYR EPLTITA
Sbjct  52    GASEENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCVVLSFLNQFFWYRKEPLTITA  111

Query  336   ISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  515
             ISAQIAVVP+G+LMAA +  R FF GT +EFTLNPGPFNVKEHVLITIFAN+GAG+VYAI
Sbjct  112   ISAQIAVVPMGRLMAALLPSRPFFSGTSYEFTLNPGPFNVKEHVLITIFANAGAGSVYAI  171

Query  516   HVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  695
             HVVTAV+VFYGK +TFFVSLI+VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFR
Sbjct  172   HVVTAVRVFYGKELTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPTNLVQVSLFR  231

Query  696   ALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlg  875
             ALHEKE+  KGG+TR+QFFV+AF+CSFAYYVFPGYLFQMLTSLSWICW +P SV AQQLG
Sbjct  232   ALHEKEKLSKGGLTRSQFFVVAFVCSFAYYVFPGYLFQMLTSLSWICWLYPNSVFAQQLG  291

Query  876   sglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAK  1055
             SGL+GLGIG IGLDW+S+SSYLGSPLASPWFATANIAVGF  I+YVFTPI YW + + A+
Sbjct  292   SGLKGLGIGTIGLDWASVSSYLGSPLASPWFATANIAVGFLTIMYVFTPIAYWFNFYKAR  351

Query  1056  TFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTAT  1235
              FPIFS  LFT SG  YNI+ I+D +FH D EAY++ G LYLSTFF++TYGVGFA+LTAT
Sbjct  352   NFPIFSSGLFTESGHKYNITTIVDEHFHFDTEAYEKNGPLYLSTFFSVTYGVGFASLTAT  411

Query  1236  LVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEY  1415
             +VHV+LFHG EI + SKS+F+ +K+D+HT+LM +Y+QVPEWWF CIL+ANIA+TVFACEY
Sbjct  412   IVHVLLFHGSEILQLSKSAFQGKKLDVHTKLMRRYKQVPEWWFICILIANIAITVFACEY  471

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y EQLQLPWWGVLLAC IA  FTLP+GIITA TNQTPGLNIITEYIIGY+YPG PVANMC
Sbjct  472   YIEQLQLPWWGVLLACAIAFFFTLPVGIITATTNQTPGLNIITEYIIGYLYPGRPVANMC  531

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA FVYLGTAWWLM+TIP 
Sbjct  532   FKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDTIPN  591

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             IC +   ++ + WTCP DHVFYDASVIWGLIGPRRIFGDLGTY A+NWFFL GAIAP+LV
Sbjct  592   ICNSELLSSGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLGGAIAPLLV  651

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             W A KAFP Q WI LINMPVLI +TS+MPPATAVNY  WI VGF+SGYVV+RYR + W+R
Sbjct  652   WFAHKAFPNQTWILLINMPVLIGSTSSMPPATAVNYIAWIFVGFMSGYVVYRYRRNWWER  711

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             HNY+LSGALDAGLAFM VL+YLCLGLEN+S++WWGNDLDGCP ASCP+AKG+ V+GCPV
Sbjct  712   HNYLLSGALDAGLAFMAVLIYLCLGLENISVDWWGNDLDGCPLASCPTAKGVFVKGCPV  770



>ref|XP_009128701.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Brassica rapa]
Length=760

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/711 (79%), Positives = 643/711 (90%), Gaps = 3/711 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIREVALTVPTTDD SLPVLTFRMW LG++SC+LLSFLNQFFWYR EPL I+AISAQI
Sbjct  50    NSPIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQI  109

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+ITDRVF +G+KWEFTLNPGPFNVKEHVLITIFAN+GAG+VYAIH++T 
Sbjct  110   AVVPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHIITV  169

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK +Y K++TFFVS I+++TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  170   VKAYYMKNMTFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  229

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFF+IAFICSFAYYVFPGYLFQMLTSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  230   EERAKGGLTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWVCWFFPSSVMAQQIGSGLHG  289

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSYLGSPLASPWFAT N+ VGF L +YV  PI YW DV+ AKTFP+F
Sbjct  290   LGIGAIGLDWSTISSYLGSPLASPWFATVNVGVGFVLAIYVLIPICYWLDVYKAKTFPLF  349

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFT+ G  YNI++IIDSNFHLDL+AY++EG LYL TFFA++YG+GFAAL++T++HV 
Sbjct  350   SSSLFTNEGSKYNIASIIDSNFHLDLQAYEREGPLYLCTFFAISYGIGFAALSSTIMHVA  409

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQS  SFK++KMD+HTRLM +Y+QVPEWWFWCIL  NI +T+FACEYYK+QL
Sbjct  410   LFHGREIWEQSMDSFKEKKMDVHTRLMQRYKQVPEWWFWCILAINIGVTIFACEYYKDQL  469

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AIIFTLPIGI+TAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  470   QLPWWGVLLACTVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  529

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QA+ FL+DFKLGHYMKIPPR MFMAQ+VGT+++  VYL TAWW +ETIP+IC   
Sbjct  530   YISMKQAVLFLEDFKLGHYMKIPPRIMFMAQIVGTLLSCLVYLVTAWWQLETIPDICN--  587

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCP D VFYDASVIWGLIGP RIFGDLG Y++VNWFFL GAIAP+LV LA++ F
Sbjct  588   -SNSVWTCPHDKVFYDASVIWGLIGPHRIFGDLGLYKSVNWFFLVGAIAPILVLLASRMF  646

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+L+NMP+LIS+   MP AT VNYT+W++ GF SG+VVFRYRP+LWQR+NYVLSG
Sbjct  647   PRQEWIKLVNMPILISSIRWMPSATTVNYTSWLLAGFFSGFVVFRYRPNLWQRYNYVLSG  706

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             ALDAGLA MGVLLY+CLG ENVS +WWGN+LDGCP ASCP+A GI+VEGCP
Sbjct  707   ALDAGLAXMGVLLYMCLGFENVSFDWWGNELDGCPLASCPTAAGIVVEGCP  757



>ref|XP_009391956.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391957.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391959.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=761

 Score =  1145 bits (2962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/714 (80%), Positives = 642/714 (90%), Gaps = 3/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDP+ PVLTFRMWVLGT SCVLL+FLNQFFWYR EPL+IT+ISAQI
Sbjct  48    NSPIEQVALTVPVNDDPATPVLTFRMWVLGTASCVLLAFLNQFFWYRKEPLSITSISAQI  107

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMA+ ITDRVFFRG++WEFTLNPGPFN+KEHVLITIFANSGAG+VYAIH+V+A
Sbjct  108   AVVPLGHLMASTITDRVFFRGSRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHIVSA  167

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             V++FY KHITFFVSL++V+TTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEK
Sbjct  168   VRIFYQKHITFFVSLLVVITTQVLGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALHEK  227

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E RPKGG+TR QFF++AF CSFAYYV PG+LF +LTSLSW+CW FPRSVLAQQLGSGL G
Sbjct  228   EGRPKGGMTRNQFFMVAFFCSFAYYVLPGHLFSVLTSLSWMCWIFPRSVLAQQLGSGLHG  287

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDW++ISSYL SPLASPWFATAN+A GF LI+YV TP  YW +++NAKTFPIF
Sbjct  288   LGIGAIGLDWATISSYLSSPLASPWFATANVAAGFALIMYVITPAAYWLNLYNAKTFPIF  347

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD LFTS+GQ+YNIS IID NFHLD++ Y++ G LYLS  FA+TYGVGFA+LTAT+ HV+
Sbjct  348   SDGLFTSTGQSYNISGIIDPNFHLDIKTYEKNGPLYLSALFAMTYGVGFASLTATISHVL  407

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHG +IW+ SKS+FK+ KMDIHTRLMS+Y QVP WWF  +LVAN+ALT+FACEY+ +QL
Sbjct  408   LFHGSQIWQMSKSAFKE-KMDIHTRLMSRYDQVPHWWFIILLVANVALTIFACEYFIDQL  466

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC IA+ FTLP GII A TNQTPGLN+ITEYIIGY+YPG PVANMCFKVYG
Sbjct  467   QLPWWGVLLACFIAVFFTLPFGIIKATTNQTPGLNVITEYIIGYLYPGRPVANMCFKVYG  526

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             +ISM QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYLGTAWWLMETIP+IC T 
Sbjct  527   FISMKQALLFLQDFKLGHYMKIPPRTMFMAQVVGTLIAALVYLGTAWWLMETIPDICNTK  586

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
                +++ WTCP DHVFYDASVIWGLIGPRRIFGDLGTY  +NWFFLAGA+AP+LVWLA K
Sbjct  587   LLPSDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSNINWFFLAGALAPLLVWLAHK  646

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP QEWIRLINMPVLI AT +MPPATAVNYTTW+ VGFLSGYVV+RYR + WQRHNYVL
Sbjct  647   AFPEQEWIRLINMPVLIGATGSMPPATAVNYTTWVFVGFLSGYVVYRYRREWWQRHNYVL  706

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFMGVLLY+CLGLE V LNWWGN LDGCP ASCP++ G++VEGCPV
Sbjct  707   SGALDAGLAFMGVLLYMCLGLEKVRLNWWGNHLDGCPLASCPTSPGVVVEGCPV  760



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/731 (78%), Positives = 652/731 (89%), Gaps = 4/731 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             +SS + +E        ENSPI +VALTVP TDDPSLPVLTFRMW LG LSCV+LSFLNQF
Sbjct  5     ASSSTTIEE--PNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQF  62

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYRTEPL+IT++SAQIAVVPLG LMAA +  R FF+G +WEFTLNPGPFNVKEHVLITI
Sbjct  63    FWYRTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITI  122

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAG+VYAIH+V+AVK+FY + ++FFV+ ++V+TTQVLGFGWAGIFR+YLVEPAAMW
Sbjct  123   FANSGAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAMW  182

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP NLVQVSLF ALHEKEER KG +TR QFF+IA +CSFAYYV PGYLF MLTSLSWICW
Sbjct  183   WPYNLVQVSLFGALHEKEERRKGSLTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWICW  242

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
              FP+SVLAQQLGSGL GLG+GAIGLDWS+ISSYLGSPLASPWFATAN+A GFF+++YV T
Sbjct  243   IFPKSVLAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIVMYVIT  302

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             P+ YW D+++AK FPIFS++LFT SGQ YNI+AIIDSNF++DLEAY++EGKLYLSTFFA+
Sbjct  303   PLSYWLDLYHAKRFPIFSEDLFTYSGQEYNITAIIDSNFNIDLEAYEKEGKLYLSTFFAM  362

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILV  1379
             TYGVGFA+L+AT+VHV LFHGREIW+ SKS+F+++KMDIHTRLMSKY+QVPEWWF  IL+
Sbjct  363   TYGVGFASLSATVVHVALFHGREIWQLSKSAFQEKKMDIHTRLMSKYKQVPEWWFITILI  422

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA T+FACEYY  QLQLPWWGVLLAC IAI FTLPIGIITA TNQ PGLNIITEYIIG
Sbjct  423   INIAATIFACEYYNAQLQLPWWGVLLACGIAISFTLPIGIITATTNQQPGLNIITEYIIG  482

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y+YPG PVAN+CFKVYGYISMTQA+ FLQDFKLGHYMKIPPR MFMAQ+VGT+IA  VYL
Sbjct  483   YLYPGRPVANICFKVYGYISMTQAVTFLQDFKLGHYMKIPPRAMFMAQIVGTLIAAMVYL  542

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
             GTAWWLM  IP IC T+  ++++ WTCP D VFYDASVIWGLIGPRRIFGDLGTY A+NW
Sbjct  543   GTAWWLMNAIPNICDTSVLSSDSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYSAINW  602

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFL GAIAP+LVWLA +AFP +EWIRLINMPVLI ATS MPPAT VNYT+WI++GF+  +
Sbjct  603   FFLGGAIAPLLVWLAHRAFPDKEWIRLINMPVLIGATSMMPPATVVNYTSWILMGFIFSF  662

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
             VV+RY+ D W RHNYVLSGALDAGLAFMGVLLYLCLGLE++S++WWG+DLDGCP ASCP+
Sbjct  663   VVYRYKRDWWTRHNYVLSGALDAGLAFMGVLLYLCLGLEDISISWWGSDLDGCPLASCPT  722

Query  2274  AKGIIVEGCPV  2306
             AKG++VEGCPV
Sbjct  723   AKGVVVEGCPV  733



>ref|NP_001056665.1| Os06g0127700 [Oryza sativa Japonica Group]
 dbj|BAD67748.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAD67928.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAF18579.1| Os06g0127700 [Oryza sativa Japonica Group]
 gb|EEC79910.1| hypothetical protein OsI_21457 [Oryza sativa Indica Group]
 gb|EEE65014.1| hypothetical protein OsJ_19965 [Oryza sativa Japonica Group]
Length=760

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/740 (77%), Positives = 648/740 (88%), Gaps = 2/740 (0%)
 Frame = +3

Query  93    EYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSC  272
             E E +     +S     S+   + EENSP+ +VALTVP  DDP+ PVLTFR+WVLGT SC
Sbjct  18    EEEEQDNSQITSPLLRSSMRLGSPEENSPVEQVALTVPVGDDPATPVLTFRIWVLGTASC  77

Query  273   VLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFN  452
             V+LSFLN FFWYR EPLT+TAISAQIAVVPLG+LMAA + +RVFFRG  WEFTLNPGPFN
Sbjct  78    VVLSFLNTFFWYRKEPLTVTAISAQIAVVPLGRLMAAALPERVFFRGRPWEFTLNPGPFN  137

Query  453   VKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRR  632
             VKEHVLITIFAN+GAG+V+AI+V+TAV+VFYGK I+FFVSL++VLT+QVLGFGWAGIFRR
Sbjct  138   VKEHVLITIFANAGAGSVFAINVITAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRR  197

Query  633   YLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQM  812
             YLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TRTQFF++AF+CSFAYY+FPGYLFQM
Sbjct  198   YLVEPAAMWWPSNLVQVSLFRALHEKERRSKGGMTRTQFFLVAFVCSFAYYIFPGYLFQM  257

Query  813   LTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVG  992
             LTSLSWICW FP+SVLAQQLGSGL GLGIGAIGLDWSSISSYLGSPLASPWFATANIA G
Sbjct  258   LTSLSWICWIFPKSVLAQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAAG  317

Query  993   FFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGK  1172
             FF+ +YV TPI YW +++ A+ FPIFSD LFT +GQ YNIS IIDS FH D +AY++ G 
Sbjct  318   FFIYIYVITPIAYWINLYKAQNFPIFSDGLFTVTGQKYNISTIIDSQFHFDTKAYEKNGP  377

Query  1173  LYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVP  1352
             LY+STFF+++YG+GFA LTAT+VHV+LFHG EIW+ S+S+F+D+KMDIHT+LM +Y+QVP
Sbjct  378   LYISTFFSISYGLGFACLTATVVHVLLFHGSEIWQLSRSAFQDKKMDIHTKLMKRYKQVP  437

Query  1353  EWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGL  1532
             EWWF  IL+A++A+T+F CEYY EQLQLPWWGVLLAC +AI FTLPIGI+TA TNQTPGL
Sbjct  438   EWWFISILIASVAITMFTCEYYIEQLQLPWWGVLLACALAIFFTLPIGIVTATTNQTPGL  497

Query  1533  NIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVG  1712
             NIITEYI+GY+YPG PVANMCFKVYGYI   QA+AFLQDFKLGHYMKIPPRTMFMAQVVG
Sbjct  498   NIITEYIMGYLYPGRPVANMCFKVYGYIGPQQALAFLQDFKLGHYMKIPPRTMFMAQVVG  557

Query  1713  TVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGD  1886
             T+IA FVYLGTAWWLM+TIP IC T      + WTCP DH+FYDASVIWGLIGPRRIFGD
Sbjct  558   TLIAAFVYLGTAWWLMDTIPNICNTELLPPGSPWTCPYDHLFYDASVIWGLIGPRRIFGD  617

Query  1887  LGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTW  2066
             LGTY AVNWFFL GAIAP+LVW A KAFPGQ+WI L+NMPVLI+  S MPPAT+VNYT W
Sbjct  618   LGTYSAVNWFFLGGAIAPLLVWFAHKAFPGQKWILLVNMPVLIAGISQMPPATSVNYTAW  677

Query  2067  IIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLD  2246
             I V FLSGYVV++YR D W+RHNY+LSGALDAGLAFM VLLYLCLGLE +SLNWWGNDLD
Sbjct  678   IFVAFLSGYVVYKYRRDWWERHNYLLSGALDAGLAFMAVLLYLCLGLEKISLNWWGNDLD  737

Query  2247  GCPYASCPSAKGIIVEGCPV  2306
             GCP ASCP A+GI V+GCPV
Sbjct  738   GCPLASCPIAEGITVQGCPV  757



>ref|XP_010649021.1| PREDICTED: oligopeptide transporter 7-like [Vitis vinifera]
 emb|CBI17364.3| unnamed protein product [Vitis vinifera]
Length=745

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/754 (75%), Positives = 650/754 (86%), Gaps = 14/754 (2%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             SA EI  PLLP+ + +            +  +  E +  ENSPI +VALTVP TDD +LP
Sbjct  3     SAHEITAPLLPRNQSH------------RSHASDELSGAENSPIEQVALTVPITDDRTLP  50

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
             V+TFRMW LGTL+C LLSFLNQFFWYR EPL+IT+ISAQIAVVPLG LMA  IT+RVFF+
Sbjct  51    VVTFRMWTLGTLACALLSFLNQFFWYRREPLSITSISAQIAVVPLGHLMATVITNRVFFK  110

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
             G +WEFTLNPGPFN+KEHVLITIFANSGAG VYAIH+V+AVK+FY +++TFFVSL++V+T
Sbjct  111   GKRWEFTLNPGPFNIKEHVLITIFANSGAGNVYAIHIVSAVKIFYKQNLTFFVSLLVVIT  170

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHE+E+R KGG+TR QFF+IAFIC
Sbjct  171   TQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRALHEREKRIKGGLTRNQFFLIAFIC  230

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYY+FPGYLF MLTSLSWICW FP SVLAQQLGSGL GLGIGAIG DWSSISSYLGSP
Sbjct  231   SFAYYIFPGYLFPMLTSLSWICWIFPTSVLAQQLGSGLHGLGIGAIGFDWSSISSYLGSP  290

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFATANIA+GF LI+YV TP+ YW +++ AK FPIFSD+LF ++GQ YNISAIIDS
Sbjct  291   LASPWFATANIALGFALIMYVITPVAYWFNIYKAKAFPIFSDDLFIATGQRYNISAIIDS  350

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
              FH+D++AY+++G LYLSTFFA++YGVGFA LTAT+VHV LFHG+EIW+ SKS+F++ KM
Sbjct  351   KFHVDIQAYERQGPLYLSTFFAMSYGVGFACLTATVVHVFLFHGKEIWQLSKSAFQENKM  410

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             D+HT+LM KY+QVPEWWF CIL  NI  T+F CEYY  QLQLPWWG+LLAC +AI FTLP
Sbjct  411   DVHTKLMRKYKQVPEWWFMCILFVNIGATIFTCEYYNNQLQLPWWGILLACGLAIFFTLP  470

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             +GIITA TNQTP LN+ITEYIIGYIYPG+PVAN+CFKVYGYISM Q IAFLQDFKLGHYM
Sbjct  471   VGIITATTNQTPALNVITEYIIGYIYPGFPVANICFKVYGYISMKQGIAFLQDFKLGHYM  530

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDAS  1844
             KIPPRTMFMAQ+VGT+IA  V+LGTAWWLMET+P+IC        + WTCP DHVFYDAS
Sbjct  531   KIPPRTMFMAQIVGTIIAALVHLGTAWWLMETVPDICDRALLPAGSPWTCPGDHVFYDAS  590

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGDLG Y A+NWFFL GAIAP+LVWLA KAFP Q WIRLI MPVL+ AT
Sbjct  591   VIWGLIGPRRIFGDLGHYSAINWFFLGGAIAPLLVWLAYKAFPNQHWIRLITMPVLLGAT  650

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              NMPPATAVNYT+WII+GF SG++ +RY  + W RHNYVLSGALDAGLAFMGVLLYLC+G
Sbjct  651   VNMPPATAVNYTSWIIIGFFSGFIAYRYYRNWWSRHNYVLSGALDAGLAFMGVLLYLCIG  710

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +E+ SL+WWG+D DGCP ASCP+A+G+ V+GCPV
Sbjct  711   MEHDSLSWWGSDPDGCPLASCPTAQGVFVKGCPV  744



>ref|XP_006655737.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=762

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/759 (74%), Positives = 648/759 (85%), Gaps = 11/759 (1%)
 Frame = +3

Query  63    IKTPLLPKVEEYEGRHGFASSSKSKVESLP---------EAAEEENSPIREVALTVPTTD  215
             + + L  +VEE +G         S+  + P         E  E ENSP+ +VALTVP  D
Sbjct  1     MASSLHQEVEEEQGHGDEEEVHDSQTLASPLLRPSTGPEEVEEGENSPVEQVALTVPVGD  60

Query  216   DPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITD  395
             +PS PVLT R WVLGT SCV+LSFLN FFWYR EPLT+TAISAQIAVVPLG+LMAA + +
Sbjct  61    EPSAPVLTARTWVLGTASCVVLSFLNTFFWYRKEPLTVTAISAQIAVVPLGRLMAAVLPE  120

Query  396   RVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSL  575
             R FFRG  WEFTLNPGPFNVKEHVLITIFAN+GAG+V+AI+V+TAV+VFYGK I+FFVSL
Sbjct  121   RAFFRGRPWEFTLNPGPFNVKEHVLITIFANAGAGSVFAINVITAVRVFYGKRISFFVSL  180

Query  576   IIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFV  755
             ++VLT+QVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEK++R KGG+TR QFF+
Sbjct  181   LVVLTSQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKKQRSKGGMTRNQFFL  240

Query  756   IAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISS  935
             +AF+CSFAYY+FPGYLFQML+SLSWICW FP SV+AQQLGSGL GLGIGA+G DWSSISS
Sbjct  241   VAFVCSFAYYIFPGYLFQMLSSLSWICWIFPNSVIAQQLGSGLHGLGIGAVGFDWSSISS  300

Query  936   YLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNIS  1115
             YLGSPLASPWFATANIA GFF+ +Y+ TPI YW +++ A+ FPIFSD LFT +GQ YNIS
Sbjct  301   YLGSPLASPWFATANIAAGFFIYIYIITPIAYWINLYKAQNFPIFSDGLFTVTGQKYNIS  360

Query  1116  AIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF  1295
              I+DS FH D +AY++ G LY+STFFA++YG+GFA LTAT+ HV+LFHG EIW+ SKS+F
Sbjct  361   TIMDSQFHFDTKAYEKNGPLYISTFFAISYGLGFACLTATIAHVLLFHGSEIWKLSKSAF  420

Query  1296  KDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAI  1475
             +D++MDIHT+LM +Y+QVPEWWF CILVA++A+T+F CEYY EQLQLPWWGVLLAC +AI
Sbjct  421   QDKRMDIHTKLMKRYKQVPEWWFICILVASVAITMFTCEYYIEQLQLPWWGVLLACALAI  480

Query  1476  IFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFK  1655
              FTLPIGI+TA TNQTPGLNIITEYI+GY+Y G PVANMCFKVYGYI   QA+ FLQDFK
Sbjct  481   FFTLPIGIVTATTNQTPGLNIITEYIMGYLYTGRPVANMCFKVYGYIGPRQALTFLQDFK  540

Query  1656  LGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHV  1829
             LGHYMKIPPRTMFMAQVVGT+IA FVYLGTAWWLM+TIP+IC T      + WTCP DH+
Sbjct  541   LGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDTIPDICNTELLPPGSPWTCPYDHL  600

Query  1830  FYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPV  2009
             FYDASVIWGLIGPRRIFGDLGTY A+NWFFL GAIAP+LVW A KAFPGQ+WI L+NMPV
Sbjct  601   FYDASVIWGLIGPRRIFGDLGTYSAINWFFLGGAIAPLLVWFAHKAFPGQKWILLVNMPV  660

Query  2010  LISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLL  2189
             LI+  S MPPAT+VNYT WI V FLSGYVV++YR D W+RHNY+LSGALDAGLAFM VLL
Sbjct  661   LITGISQMPPATSVNYTAWIFVAFLSGYVVYKYRRDWWERHNYLLSGALDAGLAFMAVLL  720

Query  2190  YLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             YLCLGLE +SL WWGNDLDGCP ASCP+AKG+ VEGCPV
Sbjct  721   YLCLGLEKISLKWWGNDLDGCPLASCPTAKGVTVEGCPV  759



>gb|EMS45172.1| Oligopeptide transporter 7 [Triticum urartu]
Length=925

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/744 (77%), Positives = 641/744 (86%), Gaps = 15/744 (2%)
 Frame = +3

Query  54    ADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPV  233
              D I +PLLP             S+        +  EEENSPI +VALTVP  DDP  PV
Sbjct  23    GDGITSPLLP-------------STSRSSPEPDDDDEEENSPIEQVALTVPVGDDPDTPV  69

Query  234   LTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRG  413
             LTFRMWVLG  SC +LSFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R FFRG
Sbjct  70    LTFRMWVLGMASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRG  129

Query  414   TKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTT  593
               +EFTLNPGPFNVKEHVLITIFAN+GAGTVYAIHVVTAV+VFYGK++TFFVSL++VLTT
Sbjct  130   RAYEFTLNPGPFNVKEHVLITIFANAGAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTT  189

Query  594   QVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICS  773
             QVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG TR+QFF++AF+CS
Sbjct  190   QVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEVRSKGGFTRSQFFLVAFVCS  249

Query  774   FAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPL  953
             F YY+FPGYLFQMLTSLSWICW FP SV AQQLGSGL GLGIG+IGLDW+S+SSYLGSPL
Sbjct  250   FVYYIFPGYLFQMLTSLSWICWVFPNSVFAQQLGSGLYGLGIGSIGLDWASVSSYLGSPL  309

Query  954   ASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSN  1133
             ASPWFATAN+A GFF+I+YV TPI YW + + A+ FPIFSD LFT +GQ YNI++I+DS 
Sbjct  310   ASPWFATANVAAGFFIIMYVITPIAYWFNFYKARNFPIFSDGLFTETGQKYNITSIVDSQ  369

Query  1134  FHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMD  1313
             FH D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW+ SKS+FK++++D
Sbjct  370   FHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFKEKRVD  429

Query  1314  IHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPI  1493
             +HT+LM +Y+QVPEWWF CIL  NIA+TVFACEYY EQLQLPWWGVLLAC IA  FTLPI
Sbjct  430   VHTKLMRRYKQVPEWWFICILTVNIAVTVFACEYYIEQLQLPWWGVLLACAIAFFFTLPI  489

Query  1494  GIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMK  1673
             GIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMK
Sbjct  490   GIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMK  549

Query  1674  IPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASV  1847
             IPPRTMFMAQVVGT+IA FVYLGTAWWLM++IP IC T      + WTCP DHVFYDASV
Sbjct  550   IPPRTMFMAQVVGTLIAAFVYLGTAWWLMDSIPNICDTELLPAGSPWTCPGDHVFYDASV  609

Query  1848  IWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATS  2027
             IWGLI PRRIFGDLGTY AVNWFFL GAIAP+LVW A KAFPGQ WI LINMPVLI +T 
Sbjct  610   IWGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWFAHKAFPGQNWILLINMPVLIGSTG  669

Query  2028  NMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGL  2207
              MPPATAVNY TWI VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGL
Sbjct  670   QMPPATAVNYITWIFVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGL  729

Query  2208  ENVSLNWWGNDLDGCPYASCPSAK  2279
             EN+SLNWWGNDLDGCP ASCP+AK
Sbjct  730   ENISLNWWGNDLDGCPLASCPTAK  753



>ref|XP_010246854.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=757

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/756 (73%), Positives = 652/756 (86%), Gaps = 4/756 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
                A+EI+ PL+P+    +       S + +  SL    +  NSPI +VALTVP TDDP+
Sbjct  3     SAGAEEIRNPLIPRKGNKDSSSSAPCSEEEQRNSLDFGVD--NSPIEQVALTVPITDDPT  60

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LP+LTFRMWVLGTL+C LLSFLNQFFWYR EPL+IT+ISAQIAVVPLG LMA+ ITDRVF
Sbjct  61    LPILTFRMWVLGTLACALLSFLNQFFWYRKEPLSITSISAQIAVVPLGHLMASTITDRVF  120

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             F+ ++WEFTLNPGPFN+KEHVLITIFANSGAG VYAIH+V+AVK+FY K++TF VSL++V
Sbjct  121   FKKSRWEFTLNPGPFNIKEHVLITIFANSGAGNVYAIHIVSAVKLFYKKNLTFLVSLLVV  180

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +T+QVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE++PKGG+TR QFF++AF
Sbjct  181   ITSQVLGFGWAGLFRRYLVEPAAMWWPHNLVQVSLFRALHEKEQKPKGGLTRNQFFLVAF  240

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             +CSFAYYVFPGYLF MLTSLSWICW FP S+LAQQLGSGL GLG+GA+G DWSSISSYLG
Sbjct  241   MCSFAYYVFPGYLFPMLTSLSWICWIFPASILAQQLGSGLHGLGLGALGFDWSSISSYLG  300

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+A+GF LI YV TPI YW +++ +K+FP+FSD LFTS+GQ YNISAII
Sbjct  301   SPLASPWFATANVAMGFVLITYVITPIAYWLNLYKSKSFPVFSDNLFTSTGQRYNISAII  360

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             D NF LD++AY++EG LYLS FF +TYGVGFA LTAT+VHV LFHGREIW+ SKS+F+++
Sbjct  361   DPNFQLDIKAYEREGPLYLSAFFTMTYGVGFACLTATVVHVFLFHGREIWQLSKSAFQEQ  420

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
              MDIHTRLM KY+QVP+WWF C+L  NIA T+F C+YY +QLQLPWWGVLLAC +AI FT
Sbjct  421   GMDIHTRLMMKYKQVPQWWFICLLCLNIAATIFTCQYYNDQLQLPWWGVLLACALAIFFT  480

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIG+ITA TNQTP LN+ITEYIIGY+YPG PVAN+CFKVYG ISM Q I FLQDFKLGH
Sbjct  481   LPIGVITATTNQTPALNVITEYIIGYLYPGRPVANICFKVYGNISMKQGITFLQDFKLGH  540

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYD  1838
             YMKIPPR MFMAQVVGT+++  V+LGTAWWLM +IP IC        + WTCPSDHVFYD
Sbjct  541   YMKIPPRDMFMAQVVGTLVSAVVHLGTAWWLMGSIPNICDRALLPAGSPWTCPSDHVFYD  600

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFGDLG Y A+NWFFL GA+AP+LVW+A KAFP + WI+LI MPVL+ 
Sbjct  601   ASVIWGLIGPRRIFGDLGHYSAINWFFLVGAVAPILVWVAHKAFPHRHWIKLITMPVLLG  660

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             AT++MPPATAVNYT+WI++GF+SG++V+RY  D W+RHNYVLSGALDAGLAFMGVLLYLC
Sbjct  661   ATASMPPATAVNYTSWIVIGFVSGFIVYRYHRDWWRRHNYVLSGALDAGLAFMGVLLYLC  720

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LG+++VSL+WWG++LDGCP ASCP+ KGI V GCPV
Sbjct  721   LGMDHVSLDWWGSNLDGCPLASCPTQKGIEVHGCPV  756



>gb|EMT07894.1| Oligopeptide transporter 7 [Aegilops tauschii]
Length=758

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/714 (79%), Positives = 627/714 (88%), Gaps = 2/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPI +VALTVP  DDP  PVLTFRMWVLG LSC +LSFLNQFFWYR EPLT+TAISAQ+
Sbjct  43    NSPIEQVALTVPVGDDPDTPVLTFRMWVLGVLSCAVLSFLNQFFWYRKEPLTVTAISAQV  102

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA + +R FFRG  +EFTLNPGPFNVKEHVLITIFAN+GAGTVYAIHVVTA
Sbjct  103   AVVPLGRLMAAALPERAFFRGRPYEFTLNPGPFNVKEHVLITIFANAGAGTVYAIHVVTA  162

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             V+VFYGK+++FFVSL++VLTTQVLGFGWAGIFRRYLVEPA MWWPANLVQVSLFRALHEK
Sbjct  163   VRVFYGKNLSFFVSLLVVLTTQVLGFGWAGIFRRYLVEPATMWWPANLVQVSLFRALHEK  222

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E R KGG TR QFF++AF+ SFAYYVFPGYLFQMLTSLSWICW FP SVL QQLGSGL G
Sbjct  223   ERRRKGGFTRNQFFLVAFVSSFAYYVFPGYLFQMLTSLSWICWVFPHSVLVQQLGSGLHG  282

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIG IGLDW+S+SSYLGSPL SPWFAT N+  GFF+I+YV TPI YW + + A+TFPIF
Sbjct  283   LGIGTIGLDWASVSSYLGSPLVSPWFATVNVGAGFFIIMYVITPIGYWFNFYKARTFPIF  342

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S +LFTS+GQ YNISAI+D +FH D EAY++ G LYLST  A+TYGV FA+LTAT+VHV+
Sbjct  343   SADLFTSTGQKYNISAIVDDHFHFDTEAYERNGPLYLSTLLAITYGVSFASLTATIVHVL  402

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHG EI + S+S+F+ + MDIHT+LM +Y++VPEWWF CIL+ +IA T+FACEYY EQL
Sbjct  403   LFHGSEILQLSRSTFQGKSMDIHTKLMRRYKKVPEWWFICILLVSIAATIFACEYYIEQL  462

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLACVIA  FTLPIGIITA TNQTPGLNI+TEYIIGY+YPG PVANMCFKVYG
Sbjct  463   QLPWWGVLLACVIAFFFTLPIGIITATTNQTPGLNIVTEYIIGYLYPGRPVANMCFKVYG  522

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QA+ FLQDFKLGHYMKIPPRTMFMAQV GT IA FVYLGTAWWLM+TIP IC   
Sbjct  523   YISMHQALMFLQDFKLGHYMKIPPRTMFMAQVAGTSIAAFVYLGTAWWLMDTIPNICNID  582

Query  1791  --ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
               + +  WTCP+DHVFYDASVIWGLIGPRRIFG LGTY AVNWFFL GAIAP+LVW A K
Sbjct  583   LLSADNPWTCPTDHVFYDASVIWGLIGPRRIFGVLGTYSAVNWFFLGGAIAPLLVWFAHK  642

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP Q WI LINMPV+I  T  MPPATAVNYTTWI+VGFLSGYVV+RYR D W+RHNY+L
Sbjct  643   AFPSQNWILLINMPVMIGCTVKMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLL  702

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGALDAGLAFM VL+YLCLGLEN+SLNWWGNDLDGCP ASCP+AKGI+V+GCPV
Sbjct  703   SGALDAGLAFMAVLIYLCLGLENISLNWWGNDLDGCPLASCPTAKGIVVKGCPV  756



>dbj|BAJ85948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=755

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/756 (76%), Positives = 643/756 (85%), Gaps = 19/756 (3%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E+  D I +PLL +            SS ++ E     A EENSPI +VALTVP  DDP 
Sbjct  15    ELDGDRITSPLLRR------------SSPARDE-----ASEENSPIEQVALTVPVGDDPD  57

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
              PVLTFRMWVLG  SC +LSFLNQFFWYR EPLT+TAISAQIAVVPLG+LMAA + +R F
Sbjct  58    TPVLTFRMWVLGMASCAVLSFLNQFFWYRKEPLTVTAISAQIAVVPLGRLMAAALPERAF  117

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             F    +EFTLNPGPFNVKEHVLITIFAN+GAGTVYAIHVVTAV+VFYGK++TFFVSL++V
Sbjct  118   FPDRPYEFTLNPGPFNVKEHVLITIFANAGAGTVYAIHVVTAVRVFYGKNLTFFVSLLVV  177

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             LTTQVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG TR QFF++AF
Sbjct  178   LTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEGRQKGGFTRNQFFLVAF  237

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
              CSF YYVFPGYLFQMLTSLSWICW FP SVLAQQLGSGL+GLGIGAIGLDW+S+SSYLG
Sbjct  238   TCSFTYYVFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLRGLGIGAIGLDWASVSSYLG  297

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPL SPWFAT N+A GFF+I+YV TPI YW + +NA TFPIFS +LFTS+GQ YNISAI+
Sbjct  298   SPLVSPWFATVNVAAGFFIIMYVITPIGYWFNFYNAWTFPIFSADLFTSTGQKYNISAIV  357

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             D +F  D EAY++ G LYLST  A+TYGV FA LTAT+VHV+LFHGREI + S+S+F+  
Sbjct  358   DDHFRFDTEAYERNGPLYLSTLLAITYGVSFATLTATIVHVLLFHGREILQLSRSTFQGE  417

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
              +DIHT+LM +Y+QVPEWWF CIL+ +IA TVFACEYY EQLQLPWWGVLLAC IA  FT
Sbjct  418   NVDIHTKLMRRYKQVPEWWFICILLVSIAATVFACEYYIEQLQLPWWGVLLACAIAFFFT  477

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITA TNQTPGLNI+TEYIIGY+YPG PVANMCFKVYG+ISM QA+ FLQDFKLGH
Sbjct  478   LPIGIITATTNQTPGLNIVTEYIIGYLYPGRPVANMCFKVYGHISMHQALMFLQDFKLGH  537

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYD  1838
             YMKIPPRTMFMAQVVGT IA FVYLGTAWWLM+TIP IC  +  + +  WTCP+DHVFYD
Sbjct  538   YMKIPPRTMFMAQVVGTSIAAFVYLGTAWWLMDTIPNICNIELLSADNPWTCPTDHVFYD  597

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGLIGPRRIFG LGTY AVNWFFL GAIAP+LVW A KAFP Q WI LINMPV+I 
Sbjct  598   ASVIWGLIGPRRIFGVLGTYSAVNWFFLGGAIAPLLVWFAHKAFPAQNWILLINMPVMIG  657

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
              T  MPPATAVNYTTWI++GFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLC
Sbjct  658   CTVKMPPATAVNYTTWILIGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLC  717

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LGLE +SLNWWGNDLDGCP ASCP+AKGI+V+GCPV
Sbjct  718   LGLEKISLNWWGNDLDGCPLASCPTAKGIVVKGCPV  753



>ref|NP_001056651.1| Os06g0125500 [Oryza sativa Japonica Group]
 gb|AAO17308.1|AF393848_1 glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAF18565.1| Os06g0125500 [Oryza sativa Japonica Group]
 gb|EAY99477.1| hypothetical protein OsI_21445 [Oryza sativa Indica Group]
 gb|EAZ35667.1| hypothetical protein OsJ_19953 [Oryza sativa Japonica Group]
Length=766

 Score =  1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/730 (77%), Positives = 634/730 (87%), Gaps = 5/730 (1%)
 Frame = +3

Query  132   SKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYR  311
             S   S PE  EEENSP+  VALTVP +D+P  PVLTFRMWVLGT SC +LSFLNQFFWYR
Sbjct  35    STSGSSPENGEEENSPVELVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFFWYR  94

Query  312   TEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANS  491
              EPLTITAISAQIAVVPLG+LMAA + +  FFRG  WEFTLNPGPFNVKEHVLITIFANS
Sbjct  95    KEPLTITAISAQIAVVPLGRLMAATLPEHAFFRGRPWEFTLNPGPFNVKEHVLITIFANS  154

Query  492   GAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ---VLGFGWAGIFRRYLVEPAAMWW  662
             GAGTVYAIHV+T V+VFYGK ++FF+SL++VLTTQ   +LGFGWAGIFRRYLVEPA+MWW
Sbjct  155   GAGTVYAIHVITGVRVFYGKTLSFFISLLVVLTTQYHQMLGFGWAGIFRRYLVEPASMWW  214

Query  663   PANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWF  842
             P+NLVQVSLF ALHEKE R KGG+TR QFF++AF+CSFAYY+FPGYLFQMLTSLSWICW 
Sbjct  215   PSNLVQVSLFSALHEKEARRKGGLTRNQFFLVAFVCSFAYYIFPGYLFQMLTSLSWICWV  274

Query  843   FPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTP  1022
             FP SVLAQQLGSGL+GLG+GAIGLDWSSISSYLGSPLASPWFAT N+ VGFF+++Y+ TP
Sbjct  275   FPSSVLAQQLGSGLRGLGVGAIGLDWSSISSYLGSPLASPWFATVNVGVGFFIVMYIITP  334

Query  1023  IFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALT  1202
             I YW + + A+ FPIFSD LFTS+GQ YN+S+I+DS+FH D +AY++ G LYLST   +T
Sbjct  335   IAYWFNFYKAQNFPIFSDGLFTSTGQKYNVSSIVDSHFHFDTKAYEKNGPLYLSTSLLVT  394

Query  1203  YGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVA  1382
             YGVGFA L AT+VH +LFHG EIW  SKS+F++++MDIHT+LM +Y+QVPEWWF CIL+A
Sbjct  395   YGVGFATLAATIVHALLFHGSEIWLLSKSAFQEKRMDIHTKLMRRYKQVPEWWFICILIA  454

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             NI  T+FACEYY E+LQLPWWGVL AC IA  FTLPIGII A TNQTPGLN+ITEYIIGY
Sbjct  455   NIGTTIFACEYYNEELQLPWWGVLFACSIAFFFTLPIGIIKATTNQTPGLNVITEYIIGY  514

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
             +YPG PVANMCFKVYGYISM QA+AFL+DFKLGHYMKIPPRTMFMAQVVGT IA FVY+G
Sbjct  515   LYPGRPVANMCFKVYGYISMKQALAFLEDFKLGHYMKIPPRTMFMAQVVGTSIAAFVYIG  574

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLMETIP IC T    +++ WTCP DHVFYDASV WGLI PRRIFGDLGTY A+NWF
Sbjct  575   TAWWLMETIPNICNTELLPSDSPWTCPGDHVFYDASVTWGLISPRRIFGDLGTYSALNWF  634

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FL GAIAP+LVW A K FPGQ WI LI  PVLI AT  MPPATAVNYTTWI+VGFLSGYV
Sbjct  635   FLCGAIAPLLVWFAHKTFPGQNWILLIKTPVLIGATFQMPPATAVNYTTWILVGFLSGYV  694

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             V+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLE++SLNWWGNDLDGCP ASCP+A
Sbjct  695   VYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLEDISLNWWGNDLDGCPLASCPTA  754

Query  2277  KGIIVEGCPV  2306
             KGI+V+GC V
Sbjct  755   KGIVVKGCAV  764



>ref|XP_008790539.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=780

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/715 (76%), Positives = 633/715 (89%), Gaps = 2/715 (0%)
 Frame = +3

Query  165   EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISA  344
             ++NSP+ +VALTVP  DDPS+PVLTFRMWVLGT+SCV+LSFLNQFFWYR EPL+IT+ISA
Sbjct  64    DDNSPVEQVALTVPVGDDPSIPVLTFRMWVLGTVSCVMLSFLNQFFWYRNEPLSITSISA  123

Query  345   QIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVV  524
             QIAVVPLG LMA+ + DRVFFRG++WEFTLNPGPFNVKEHVLITIFANSGA  VYA+H++
Sbjct  124   QIAVVPLGHLMASALPDRVFFRGSRWEFTLNPGPFNVKEHVLITIFANSGAANVYAVHII  183

Query  525   TAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  704
             +AVK+FY K++TFFVS ++++TTQVLG+GWAG+FRRYLVEPAAMWWP NLVQVSLF ALH
Sbjct  184   SAVKIFYKKNLTFFVSFVVIVTTQVLGYGWAGLFRRYLVEPAAMWWPYNLVQVSLFGALH  243

Query  705   EKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsgl  884
             EKE+RP+G +TR QFF+IAFICSFAYYVFPGYLF+MLTSLSWICW FP S+LAQQLGSG+
Sbjct  244   EKEKRPRGSLTRNQFFLIAFICSFAYYVFPGYLFKMLTSLSWICWIFPNSILAQQLGSGM  303

Query  885   qglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFP  1064
             +GLGI AIGLDWSS+ +YLGSPLASPWFATANIA GFF ++Y  TP  YW DV++AKTFP
Sbjct  304   KGLGIAAIGLDWSSVCAYLGSPLASPWFATANIAAGFFFLMYFITPFTYWLDVYHAKTFP  363

Query  1065  IFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVH  1244
             IFSD+LFTSSGQ YNIS+IIDSNF  D  AY+++G LYLSTFFA+TYG GFA+L+AT+VH
Sbjct  364   IFSDDLFTSSGQKYNISSIIDSNFQFDAAAYEKQGPLYLSTFFAMTYGFGFASLSATVVH  423

Query  1245  VVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKE  1424
             V+LFHGREIW+ SK +F+++KMD+H RLM +Y QVP WWF CIL+ N+ALT+FACEYY +
Sbjct  424   VLLFHGREIWQMSKLAFREKKMDVHARLMRRYNQVPLWWFVCILLVNVALTIFACEYYID  483

Query  1425  QLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKV  1604
             QLQLPWWGVLLAC +AI FTLPIGI+TA TNQTPGLN+ITEYIIGY+YPG PVANMCFKV
Sbjct  484   QLQLPWWGVLLACAVAIFFTLPIGILTATTNQTPGLNVITEYIIGYVYPGRPVANMCFKV  543

Query  1605  YGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQ  1784
             YGYISM QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+I+  V+LGTAWWLM TIP IC 
Sbjct  544   YGYISMKQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLISALVHLGTAWWLMSTIPNICD  603

Query  1785  TT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLA  1958
              T  A ++ WTCP DHVFYDASV+WGLIGPRRIFG LGTY A+NWFFL GAI P+LVWLA
Sbjct  604   RTKLAPDSPWTCPGDHVFYDASVVWGLIGPRRIFGALGTYSAINWFFLLGAIGPLLVWLA  663

Query  1959  TKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNY  2138
              K FP Q+WIRLI MP++ISA   MPPATAVNYTTWI+VGF+ G+V++RYR D WQRHNY
Sbjct  664   HKTFPRQQWIRLITMPIMISALGQMPPATAVNYTTWIVVGFVFGFVIYRYRRDWWQRHNY  723

Query  2139  VLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             VLSGALDAGLAFM VLLYLCL  E + ++WWGN LDGCP ASCP+AKG +V+ CP
Sbjct  724   VLSGALDAGLAFMAVLLYLCLEFEGIKISWWGNILDGCPLASCPTAKGTVVDYCP  778



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/721 (75%), Positives = 641/721 (89%), Gaps = 3/721 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E+ E  NS I++VALTVPTTDD S+PVLTFRMWVLG +SCVLLSFLNQFFWYRTEP++IT
Sbjct  13    ESPESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLNQFFWYRTEPISIT  72

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             A+SAQIAVVPLG LMA+ IT RVFF+G++WEFT+NPGPFNVKEHVLITIFAN+GAGTVYA
Sbjct  73    ALSAQIAVVPLGHLMASTITKRVFFKGSRWEFTMNPGPFNVKEHVLITIFANAGAGTVYA  132

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++A+K++Y + +TFF +L+I+LTTQ+LGFGWAG+FRRYLVEPA MWWP+NLVQVSLF
Sbjct  133   THILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRRYLVEPAEMWWPSNLVQVSLF  192

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKE+RP+GG+TRTQFF+IA  CSFAYY+ PGY+F MLTSLSW+CW FP+S+LAQQ+
Sbjct  193   RALHEKEKRPRGGVTRTQFFLIALTCSFAYYLLPGYIFPMLTSLSWVCWIFPKSILAQQI  252

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL+GLGIGAIGLDWS++SSYLGSPLASPWFATAN+AVGFF+I+Y+  PI YW DV+ A
Sbjct  253   GSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAVGFFIIMYIIVPISYWLDVYKA  312

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFP+FS  LFTS GQ YNIS+I++S FH+DL++Y++ G L+LSTFFA TYGVGFAALTA
Sbjct  313   KTFPLFSSGLFTSKGQKYNISSIVNSKFHIDLDSYERNGPLHLSTFFAFTYGVGFAALTA  372

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRK-MDIHTRLMSKYRQVPEWWFWCILVANIALTVFAC  1409
             T+VHV+LFHG EI E S+S+ KD+K MD+HTRLM KY+QVP+WWF  ILV  +A T+FAC
Sbjct  373   TIVHVLLFHGSEILELSRSALKDKKRMDVHTRLMKKYKQVPQWWFMFILVVVMAATIFAC  432

Query  1410  EYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVAN  1589
             EYY +QLQL WWGVLLAC++A +FTLPIG+I A TNQ PGLNIITEYI+GY+YPG PVAN
Sbjct  433   EYYNDQLQLRWWGVLLACLVAYVFTLPIGVIAATTNQAPGLNIITEYILGYLYPGRPVAN  492

Query  1590  MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETI  1769
             +CFKVYGYISMTQA+ F+QDFKLGHYMKIPPR MFM Q++GTVIAG VYLGT WWLM TI
Sbjct  493   ICFKVYGYISMTQALTFIQDFKLGHYMKIPPRAMFMVQMIGTVIAGLVYLGTGWWLMMTI  552

Query  1770  PEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
             P +C T     N+ WTCP D VFYDASVIWGLIGPRRIFGDLG+Y AVNWFFL GAIAP+
Sbjct  553   PNLCDTAVLPDNSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGSYAAVNWFFLGGAIAPL  612

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
             LVW+A KAFP Q+WIRLINMPVLISAT  MPPATAVN+TTWII+GFLSG+VV+RYR DLW
Sbjct  613   LVWVAHKAFPNQKWIRLINMPVLISATGMMPPATAVNFTTWIIIGFLSGFVVYRYRQDLW  672

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             QRHNYVLSGALDAGLAFMGVLL+ CLG + +S++WWG + DGCP ASCP+AKG++V+ CP
Sbjct  673   QRHNYVLSGALDAGLAFMGVLLFACLGSKEISIDWWGANPDGCPLASCPTAKGVVVDHCP  732

Query  2304  V  2306
             V
Sbjct  733   V  733



>ref|XP_010934151.1| PREDICTED: oligopeptide transporter 7-like [Elaeis guineensis]
Length=755

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/715 (76%), Positives = 629/715 (88%), Gaps = 2/715 (0%)
 Frame = +3

Query  165   EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISA  344
             ++NSP+ +VALTVP  DDPS+PVLTFRMWVLGT+SCV+LSFLNQFFWYR EPL+IT+ISA
Sbjct  39    DDNSPVEQVALTVPVGDDPSIPVLTFRMWVLGTVSCVILSFLNQFFWYRNEPLSITSISA  98

Query  345   QIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVV  524
             QIAVVPLG LMA  + DR+FFRG+ WEFTLNPGPFNVKEHVLITIFANSGA  VYA+H++
Sbjct  99    QIAVVPLGHLMATALPDRLFFRGSPWEFTLNPGPFNVKEHVLITIFANSGAANVYAVHII  158

Query  525   TAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  704
             +AVK+FY +++TFFVS II++TTQVLG+GWAG+FRRYLVEPA MWWP NLVQVSLF ALH
Sbjct  159   SAVKIFYKQNLTFFVSFIIIVTTQVLGYGWAGLFRRYLVEPAVMWWPYNLVQVSLFGALH  218

Query  705   EKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsgl  884
             EKE+RP+G +TR QFF+IAFICSFAYYVFPGYLF+MLTSLSWICW FP S+LA QLGSG+
Sbjct  219   EKEKRPRGSLTRNQFFLIAFICSFAYYVFPGYLFKMLTSLSWICWIFPNSILAHQLGSGM  278

Query  885   qglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFP  1064
             +GLGI AIGLDWSS+ +YLGSPLASPWFATANIAVGFFL++YV  PI YW DV++AKTFP
Sbjct  279   KGLGIAAIGLDWSSVCAYLGSPLASPWFATANIAVGFFLLMYVVAPIAYWLDVYHAKTFP  338

Query  1065  IFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVH  1244
             IFSD LFTSSGQ YNIS II+SNF  D  AY+++G LYLSTFF +TYG GFA+L+AT+VH
Sbjct  339   IFSDGLFTSSGQKYNISTIINSNFQFDAGAYEKQGPLYLSTFFTMTYGFGFASLSATVVH  398

Query  1245  VVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKE  1424
             V+LFHGREIW+ SK +F+D+KMD+HTRLMS+Y+QVP  WF CILVAN+ LT+FACEYY +
Sbjct  399   VLLFHGREIWQTSKLAFQDKKMDVHTRLMSRYKQVPMRWFVCILVANVVLTIFACEYYID  458

Query  1425  QLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKV  1604
             QLQLPWWGVLLAC +A+ FTLPIGI+TA TNQTPGLN+ITEYIIGY+YPG PVANMCFKV
Sbjct  459   QLQLPWWGVLLACAVALFFTLPIGILTATTNQTPGLNVITEYIIGYVYPGRPVANMCFKV  518

Query  1605  YGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQ  1784
             YG+ISM QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+I+  V+LGTAWWLM TIP IC 
Sbjct  519   YGFISMKQALNFLQDFKLGHYMKIPPRTMFMAQVVGTLISAMVHLGTAWWLMNTIPNICD  578

Query  1785  TT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLA  1958
              T  + ++ WTCP DHVFYDASV+WGLIGPRRIFGDLG+Y A+NWFFL GAI P+LVWLA
Sbjct  579   RTKLSPDSPWTCPGDHVFYDASVVWGLIGPRRIFGDLGSYSAINWFFLLGAIGPLLVWLA  638

Query  1959  TKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNY  2138
              K FP  +WIRLI MP++ISA   MPPATAVNYTTWI VGF+ G+V++RYR D WQRHNY
Sbjct  639   HKTFPRHQWIRLITMPIMISALGQMPPATAVNYTTWITVGFVFGFVIYRYRRDWWQRHNY  698

Query  2139  VLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             VLSGALDAGLAFM VLLYLCL  E +  NWWGN LDGC  ASCP+AKGI+V+ CP
Sbjct  699   VLSGALDAGLAFMAVLLYLCLEFEGIKFNWWGNKLDGCTLASCPTAKGIVVDYCP  753



>ref|XP_010228050.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Brachypodium 
distachyon]
Length=731

 Score =  1110 bits (2870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/722 (76%), Positives = 633/722 (88%), Gaps = 2/722 (0%)
 Frame = +3

Query  147   LPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLT  326
             +   ++ ENSP+ +VALTVP  DDP  PVLTFR WVLGT SCV LSFLN FF YR EPL 
Sbjct  8     MSSPSDWENSPVEQVALTVPVGDDPLTPVLTFRTWVLGTASCVALSFLNAFFGYRKEPLE  67

Query  327   ITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTV  506
             ITA+SAQIAV+PLG+LMAA +  R FF G ++EFTLNPGPFN+KEHVLITIFAN+GAG+V
Sbjct  68    ITAVSAQIAVLPLGRLMAALLPSRAFFSGRRYEFTLNPGPFNMKEHVLITIFANAGAGSV  127

Query  507   YAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVS  686
             +AI+VVTA++VFY   ITFFVSL+IVLT+QV+GFGWAGIFR+YLVEPAAMWWP+NLVQVS
Sbjct  128   FAINVVTALRVFYAMKITFFVSLLIVLTSQVMGFGWAGIFRQYLVEPAAMWWPSNLVQVS  187

Query  687   LFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaq  866
             LFRALHEKE+R KGG+TR QFF++AF+CSFAYY+FPGYLFQMLTSLSWICW FP SV+AQ
Sbjct  188   LFRALHEKEQRSKGGMTRNQFFILAFVCSFAYYIFPGYLFQMLTSLSWICWIFPNSVVAQ  247

Query  867   qlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVF  1046
             QLGSG+ GLGIGAIGLDWSSISSYLGSPLASPWFATAN+A GF + +Y+ TP+ YW +V+
Sbjct  248   QLGSGMHGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFVIYMYIITPVTYWFNVY  307

Query  1047  NAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAAL  1226
              A+ FPI SD LFT +G+ YNIS IIDS FH D+ AY++ G LY+STFFA++YG+GFA L
Sbjct  308   KAQNFPIISDGLFTGTGRKYNISTIIDSQFHFDMNAYEKNGPLYISTFFAVSYGLGFACL  367

Query  1227  TATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFA  1406
             TATLVHV+LFHG EIW+ SKS+F+++K+DIHT+LM +YRQVPEWWF CILVA+IA+T+F 
Sbjct  368   TATLVHVILFHGSEIWQLSKSAFQEKKVDIHTKLMRRYRQVPEWWFICILVASIAITMFT  427

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
             CE Y EQLQLPWWGVLLAC +AI +TLPIGIITA TNQTPGLNIITEYI+GY+YPG PVA
Sbjct  428   CESYIEQLQLPWWGVLLACALAIFYTLPIGIITATTNQTPGLNIITEYIMGYVYPGRPVA  487

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             NMCFKVYGYI   QA+AFLQDFKLGHYMKIPPRTMFMAQVVGT+IA FVYLGTAWWLM+T
Sbjct  488   NMCFKVYGYIGPRQALAFLQDFKLGHYMKIPPRTMFMAQVVGTIIAAFVYLGTAWWLMDT  547

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             IP IC T      + WTCP DH+FYDASVIWGLI PRRIFGDLGTY A+NWFFL GA+AP
Sbjct  548   IPNICNTELLPAGSPWTCPYDHLFYDASVIWGLISPRRIFGDLGTYSAINWFFLGGAVAP  607

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
             +LVWLA KAFPGQ+WI L+NMPVL+   S+MPPATAVNYT WI + FLSGY+V++YR D 
Sbjct  608   LLVWLAHKAFPGQKWILLVNMPVLLGGISHMPPATAVNYTAWIFIAFLSGYMVYKYRRDW  667

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGC  2300
             W+RHNY+LSGALDAGLAFM VL+Y+CLGLEN+SLNWWGNDLDGCP ASCP+AKGIIVEGC
Sbjct  668   WERHNYLLSGALDAGLAFMAVLIYVCLGLENISLNWWGNDLDGCPLASCPTAKGIIVEGC  727

Query  2301  PV  2306
             PV
Sbjct  728   PV  729



>ref|XP_003557106.2| PREDICTED: oligopeptide transporter 7-like isoform X1 [Brachypodium 
distachyon]
Length=747

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/734 (75%), Positives = 637/734 (87%), Gaps = 4/734 (1%)
 Frame = +3

Query  117   ASSSKSKVES--LPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFL  290
             A     ++E   +   ++ ENSP+ +VALTVP  DDP  PVLTFR WVLGT SCV LSFL
Sbjct  12    AQEDDHQLEQPLMSSPSDWENSPVEQVALTVPVGDDPLTPVLTFRTWVLGTASCVALSFL  71

Query  291   NQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVL  470
             N FF YR EPL ITA+SAQIAV+PLG+LMAA +  R FF G ++EFTLNPGPFN+KEHVL
Sbjct  72    NAFFGYRKEPLEITAVSAQIAVLPLGRLMAALLPSRAFFSGRRYEFTLNPGPFNMKEHVL  131

Query  471   ITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             ITIFAN+GAG+V+AI+VVTA++VFY   ITFFVSL+IVLT+QV+GFGWAGIFR+YLVEPA
Sbjct  132   ITIFANAGAGSVFAINVVTALRVFYAMKITFFVSLLIVLTSQVMGFGWAGIFRQYLVEPA  191

Query  651   AMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSW  830
             AMWWP+NLVQVSLFRALHEKE+R KGG+TR QFF++AF+CSFAYY+FPGYLFQMLTSLSW
Sbjct  192   AMWWPSNLVQVSLFRALHEKEQRSKGGMTRNQFFILAFVCSFAYYIFPGYLFQMLTSLSW  251

Query  831   ICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILY  1010
             ICW FP SV+AQQLGSG+ GLGIGAIGLDWSSISSYLGSPLASPWFATAN+A GF + +Y
Sbjct  252   ICWIFPNSVVAQQLGSGMHGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFVIYMY  311

Query  1011  VFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTF  1190
             + TP+ YW +V+ A+ FPI SD LFT +G+ YNIS IIDS FH D+ AY++ G LY+STF
Sbjct  312   IITPVTYWFNVYKAQNFPIISDGLFTGTGRKYNISTIIDSQFHFDMNAYEKNGPLYISTF  371

Query  1191  FALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWC  1370
             FA++YG+GFA LTATLVHV+LFHG EIW+ SKS+F+++K+DIHT+LM +YRQVPEWWF C
Sbjct  372   FAVSYGLGFACLTATLVHVILFHGSEIWQLSKSAFQEKKVDIHTKLMRRYRQVPEWWFIC  431

Query  1371  ILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEy  1550
             ILVA+IA+T+F CE Y EQLQLPWWGVLLAC +AI +TLPIGIITA TNQTPGLNIITEY
Sbjct  432   ILVASIAITMFTCESYIEQLQLPWWGVLLACALAIFYTLPIGIITATTNQTPGLNIITEY  491

Query  1551  iigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGF  1730
             I+GY+YPG PVANMCFKVYGYI   QA+AFLQDFKLGHYMKIPPRTMFMAQVVGT+IA F
Sbjct  492   IMGYVYPGRPVANMCFKVYGYIGPRQALAFLQDFKLGHYMKIPPRTMFMAQVVGTIIAAF  551

Query  1731  VYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEA  1904
             VYLGTAWWLM+TIP IC T      + WTCP DH+FYDASVIWGLI PRRIFGDLGTY A
Sbjct  552   VYLGTAWWLMDTIPNICNTELLPAGSPWTCPYDHLFYDASVIWGLISPRRIFGDLGTYSA  611

Query  1905  VNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFL  2084
             +NWFFL GA+AP+LVWLA KAFPGQ+WI L+NMPVL+   S+MPPATAVNYT WI + FL
Sbjct  612   INWFFLGGAVAPLLVWLAHKAFPGQKWILLVNMPVLLGGISHMPPATAVNYTAWIFIAFL  671

Query  2085  SGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYAS  2264
             SGY+V++YR D W+RHNY+LSGALDAGLAFM VL+Y+CLGLEN+SLNWWGNDLDGCP AS
Sbjct  672   SGYMVYKYRRDWWERHNYLLSGALDAGLAFMAVLIYVCLGLENISLNWWGNDLDGCPLAS  731

Query  2265  CPSAKGIIVEGCPV  2306
             CP+AKGIIVEGCPV
Sbjct  732   CPTAKGIIVEGCPV  745



>ref|XP_010252553.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=731

 Score =  1106 bits (2860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/720 (75%), Positives = 635/720 (88%), Gaps = 2/720 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E+ E ENS I++VALTVPTTDDP+ PVLTFRMWVLG +SCVLLSFLNQFFWYRTEP++IT
Sbjct  11    ESPESENSSIKQVALTVPTTDDPNQPVLTFRMWVLGIVSCVLLSFLNQFFWYRTEPISIT  70

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
              +SAQIAVVPLG LMA+ +T RVFF+GT+WEF++NPGPFNVKEHVLITIFAN+GAGTVYA
Sbjct  71    GLSAQIAVVPLGHLMASTVTKRVFFKGTRWEFSMNPGPFNVKEHVLITIFANAGAGTVYA  130

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++AVK+FY + +TF  +L+++LTTQ+LGFGWAG+FRRYLVEPA MWWP NLVQVSLF
Sbjct  131   THILSAVKLFYKRKLTFIPALLVILTTQMLGFGWAGLFRRYLVEPAEMWWPNNLVQVSLF  190

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKE+RPKGG+TRTQFF++  +CSFAYYVFPGYLF MLTSLSW+CW FP+S+LAQQL
Sbjct  191   RALHEKEKRPKGGVTRTQFFLMVLVCSFAYYVFPGYLFPMLTSLSWVCWIFPKSILAQQL  250

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL+GLGIGAIGLDWS++SSYLGSPLASPWFATANIAVGF +++YV TPI YW D + A
Sbjct  251   GSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATANIAVGFAILMYVITPISYWFDFYQA  310

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFP+FS  LFT +GQ YNIS+II+  FH+D+ AY+  G L+LSTFFA++YG GFAALTA
Sbjct  311   KTFPLFSSGLFTRTGQKYNISSIINDKFHIDMNAYEHNGPLHLSTFFAISYGAGFAALTA  370

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             T+VHV++FHGREIW+ S+S+ K+ KMD+HTRLM +Y+QVP+WWF C+LV  IA T FAC 
Sbjct  371   TVVHVLVFHGREIWQLSRSALKESKMDVHTRLMRRYKQVPQWWFICVLVVIIATTFFACG  430

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY +QLQLPWWGVLLAC +AI+FTLPIGII A TNQ+PGLNIITEYI+GY+YPG PVAN+
Sbjct  431   YYNDQLQLPWWGVLLACFLAILFTLPIGIIAATTNQSPGLNIITEYIMGYLYPGRPVANI  490

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFKVYGYISMTQA+ F+ DFKLGHYMKIPPR MFMAQ++GT+IAGFVYL TAWWLM+TIP
Sbjct  491   CFKVYGYISMTQALTFISDFKLGHYMKIPPRAMFMAQMIGTLIAGFVYLATAWWLMKTIP  550

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C T     N+ WTCP D VFYDASVIWGLIGPRRIFGDLGTY AVNWFFL GA+AP+L
Sbjct  551   NLCDTNLLPDNSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYPAVNWFFLGGAVAPLL  610

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VW A K FP Q+WIRLINMP+LI AT  MPPATAVN+T WII+GFLSG+V++RYR   WQ
Sbjct  611   VWAAHKVFPNQKWIRLINMPILIGATGMMPPATAVNFTVWIIIGFLSGFVIYRYRQGWWQ  670

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             RHNYVLSGALDAGLAFMGVLL+LCLG +N+S++WWG   DGCP ASCP+AKG++V+ CPV
Sbjct  671   RHNYVLSGALDAGLAFMGVLLFLCLGSKNISIDWWGASPDGCPLASCPTAKGVVVDHCPV  730



>ref|XP_009591882.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=756

 Score =  1105 bits (2857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/755 (74%), Positives = 643/755 (85%), Gaps = 3/755 (0%)
 Frame = +3

Query  48    VSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSL  227
             V   EI  PL+ K ++ +       S      S     EEENSPI +VALTVP TD+PSL
Sbjct  2     VDYQEISAPLIEK-QKQKKISSVHDSDGISSSSQSSPFEEENSPIEQVALTVPITDEPSL  60

Query  228   PVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFF  407
             PV+TFRMW+LGTL+C+LLSFLNQFFW+R EPL+I++ISAQIAVVPLG LMA  I +RVFF
Sbjct  61    PVVTFRMWILGTLACILLSFLNQFFWFRREPLSISSISAQIAVVPLGHLMAFLIPNRVFF  120

Query  408   RGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVL  587
             +G K+EFTLNPGPFNVKEHVLITIFANSGAG  YAIH+V+AVKVFY + +TF+VSLI+VL
Sbjct  121   KGRKFEFTLNPGPFNVKEHVLITIFANSGAGNPYAIHIVSAVKVFYKRTLTFWVSLIVVL  180

Query  588   TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFI  767
             TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEER K  +TR QFF+IAF+
Sbjct  181   TTQVLGFGWAGIFRRYLVEPAAMWWPHNLVQVSLFRALHEKEERAKNEMTRNQFFLIAFL  240

Query  768   CSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGS  947
             CSFAYYVFPGYLF ML+SLSW+CW FP SVLAQQLGSGL GLGIGAIGLDWSSISSYLGS
Sbjct  241   CSFAYYVFPGYLFPMLSSLSWLCWLFPASVLAQQLGSGLHGLGIGAIGLDWSSISSYLGS  300

Query  948   PLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIID  1127
             PLASPWFATANIAVG+FLI+YV TP  YW +V+ AKTFPIFSD LFTS GQ YNISAIID
Sbjct  301   PLASPWFATANIAVGYFLIMYVVTPFMYWFNVYKAKTFPIFSDGLFTSDGQKYNISAIID  360

Query  1128  SNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRK  1307
              NFH+D  AYD+EG+LYLSTFF++TY   FA L+AT+VHV LFHGR++W+ SKS+F+++K
Sbjct  361   PNFHIDFNAYDREGRLYLSTFFSMTYAFSFACLSATVVHVFLFHGRDLWQMSKSAFQEKK  420

Query  1308  MDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTL  1487
             MDIHT+LM KY+QVPEWWF  IL+ NIA TVF CEYYK QLQLPWWGVLLAC +A  FTL
Sbjct  421   MDIHTKLMRKYKQVPEWWFLSILLVNIAATVFICEYYKTQLQLPWWGVLLACSLAFFFTL  480

Query  1488  PIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHY  1667
             P+G+ITA TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM Q + FLQD KLGHY
Sbjct  481   PVGVITATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMKQGLTFLQDLKLGHY  540

Query  1668  MKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDA  1841
             MKIPPR MFMAQVVGT+I+  V+LGTAWWLMET+P+IC        + WTCP DHVFYDA
Sbjct  541   MKIPPRAMFMAQVVGTLISALVHLGTAWWLMETVPDICDRALLPPGSPWTCPGDHVFYDA  600

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGP+RIFG+LG Y A+NW FL GAIAPV+VW+A K+FP Q+WIRLI +PVL++ 
Sbjct  601   SVIWGLIGPQRIFGNLGHYSALNWAFLFGAIAPVIVWIAHKSFPNQQWIRLITVPVLLAG  660

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
               NMPPAT+VNY +WII+ F+SG+VV+RY   LW RHNYVLSGALDAGLAFMGVLLYLCL
Sbjct  661   IINMPPATSVNYNSWIIIAFISGFVVYRYYQKLWSRHNYVLSGALDAGLAFMGVLLYLCL  720

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             G+++V L+WWG+D D CP ASCP+A+G++V+GCPV
Sbjct  721   GMQHVRLDWWGSDADRCPLASCPTAEGVVVKGCPV  755



>ref|XP_009795933.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Nicotiana 
sylvestris]
Length=755

 Score =  1104 bits (2856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/759 (73%), Positives = 646/759 (85%), Gaps = 12/759 (2%)
 Frame = +3

Query  48    VSADEIKTPLLPKVEEYE----GRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTD  215
             V   EI  PL+ K ++ E     R G +SS++S         +E NSPI +VALTVP TD
Sbjct  2     VDYQEISAPLIEKQKQKEISIHNRDGVSSSTQS------SPFDEGNSPIEQVALTVPITD  55

Query  216   DPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITD  395
             + SLPV+TFRMW+LGTL+C+LLSFLNQFFW+R EPL+I++ISAQIAVVPLG LMA  I +
Sbjct  56    ESSLPVVTFRMWILGTLACILLSFLNQFFWFRREPLSISSISAQIAVVPLGHLMAFLIPN  115

Query  396   RVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSL  575
             R+FF+G K+EFTLNPGPFNVKEHVLITIFANSGAG  YAIH+V+AVKVFY + +TF+VSL
Sbjct  116   RIFFKGRKFEFTLNPGPFNVKEHVLITIFANSGAGNPYAIHIVSAVKVFYKRTLTFWVSL  175

Query  576   IIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFV  755
             I+VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEER K  +TR QFF+
Sbjct  176   IVVLTTQVLGFGWAGIFRRYLVEPAAMWWPHNLVQVSLFRALHEKEERAKNEMTRNQFFL  235

Query  756   IAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISS  935
             IAF+CSFAYYVFPGYLF ML+SLSW+CW FP SVLAQQLGSGL GLGIGAIGLDWSSISS
Sbjct  236   IAFLCSFAYYVFPGYLFPMLSSLSWLCWLFPASVLAQQLGSGLHGLGIGAIGLDWSSISS  295

Query  936   YLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNIS  1115
             YLGSPLASPWFATANIAVG+FLI+YV TP  YW +V+ AKTFPIFSD LFTS GQ YNIS
Sbjct  296   YLGSPLASPWFATANIAVGYFLIMYVVTPFMYWFNVYKAKTFPIFSDGLFTSDGQKYNIS  355

Query  1116  AIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF  1295
             AIID NFH+D  AYD+EG+LYLSTFF++TY   FA L+AT+VHV LFHGR++W+ SKS+F
Sbjct  356   AIIDPNFHIDFNAYDREGRLYLSTFFSMTYAFSFACLSATVVHVFLFHGRDLWQLSKSAF  415

Query  1296  KDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAI  1475
             +++KMDIHT+LM KY+QVPEWWF  IL+ NIA TVF CEYYK QLQLPWWGVLLAC +A 
Sbjct  416   QEKKMDIHTKLMRKYKQVPEWWFLSILLVNIAATVFICEYYKTQLQLPWWGVLLACGLAF  475

Query  1476  IFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFK  1655
              FTLP+G+ITA TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM Q + FLQD K
Sbjct  476   FFTLPVGVITATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMKQGLTFLQDLK  535

Query  1656  LGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHV  1829
             LGHYMKIPPR MFMAQVVGT+I+  V+LGTAWWLMET+P+IC        + WTCP DHV
Sbjct  536   LGHYMKIPPRAMFMAQVVGTLISALVHLGTAWWLMETVPDICDRALLPPGSPWTCPGDHV  595

Query  1830  FYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPV  2009
             FYDASVIWGLIGP+RIFG+LG Y A+NW FL GAIAPV+VW+A K+FP Q WIRLI +PV
Sbjct  596   FYDASVIWGLIGPQRIFGNLGHYSALNWAFLFGAIAPVIVWIAHKSFPNQHWIRLITVPV  655

Query  2010  LISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLL  2189
             L++   NMPPAT+VNY +WII+ F+SG+VV+RY   LW RHNYVLSGALDAGLAFMGVLL
Sbjct  656   LLAGIINMPPATSVNYNSWIIIAFISGFVVYRYYQKLWSRHNYVLSGALDAGLAFMGVLL  715

Query  2190  YLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             YLCLG+++V L+WWG+D D CP ASCP+A+G++V+GCPV
Sbjct  716   YLCLGMQHVRLDWWGSDADRCPLASCPTAEGVVVKGCPV  754



>gb|KHG27803.1| Oligopeptide transporter 7 -like protein [Gossypium arboreum]
Length=753

 Score =  1103 bits (2852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/754 (73%), Positives = 641/754 (85%), Gaps = 8/754 (1%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             ++ EI  PLL K    + +      +   V S P+  + E+ PI +VALTVPT DDPSLP
Sbjct  5     TSPEIAAPLLQKSPSGQNQ----PHASGSVPSSPD--DPESCPIEQVALTVPTADDPSLP  58

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
              LTFR W+LGTL+C+LLSFLNQFFWYR EPL+I++ISAQIAVVPLG L+AA +TDRVFF+
Sbjct  59    TLTFRTWILGTLACLLLSFLNQFFWYRREPLSISSISAQIAVVPLGHLLAATVTDRVFFK  118

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
                +EFTLNPGPFNVKEHVL+TIF+NSGAG VYAIH+VTAVK+FY K ++F V+L++V T
Sbjct  119   DWNFEFTLNPGPFNVKEHVLVTIFSNSGAGNVYAIHLVTAVKIFYKKRMSFLVALLVVFT  178

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEER KG +TR QFF+IA  C
Sbjct  179   TQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERAKGRLTRNQFFLIALTC  238

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYYV PGYLF  LTSLSWICW FP S+LA QLGSGL GLGIGAIG DWSSIS+YLGSP
Sbjct  239   SFAYYVLPGYLFPTLTSLSWICWVFPTSILAHQLGSGLHGLGIGAIGFDWSSISAYLGSP  298

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFAT NIAVGF LI Y+ TPI YW ++FNAK FPIFSD LFTS+GQ+YNISAIIDS
Sbjct  299   LASPWFATVNIAVGFALITYIITPIAYWLNLFNAKHFPIFSDGLFTSTGQSYNISAIIDS  358

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
             NFH+D+ AY++ G LYLS+FFA++YGVGFA LTAT+VHV+LFHG EI ++SKS+F++ KM
Sbjct  359   NFHIDMAAYERGGSLYLSSFFAMSYGVGFACLTATVVHVILFHGSEILQRSKSAFQETKM  418

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             D+HT+LM KY+QVPEWWF CIL+ NIA T+F C+YY +QLQLPWWGVLLAC +AI FTLP
Sbjct  419   DVHTKLMRKYKQVPEWWFTCILIVNIAATIFLCQYYNDQLQLPWWGVLLACGLAIFFTLP  478

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             +G+ITA TNQTP LN+ITEYIIGYIYPGYPVANMCFKVYGYISM Q I FLQDFKLGHYM
Sbjct  479   VGVITATTNQTPALNVITEYIIGYIYPGYPVANMCFKVYGYISMKQGITFLQDFKLGHYM  538

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDAS  1844
             KIPPR+MF+AQV GT+IA   +L TAWWLM+T+P+IC  +   T++ WTCP DHVFYDAS
Sbjct  539   KIPPRSMFIAQVGGTIIAALAHLATAWWLMDTVPDICDREMLPTDSPWTCPGDHVFYDAS  598

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGLIGPRRIFGDLG Y A+NWFFL GAIAPVLVWLA+KAFP + WI+LI MPVL  AT
Sbjct  599   VIWGLIGPRRIFGDLGYYSAINWFFLVGAIAPVLVWLASKAFPNKPWIKLITMPVLFGAT  658

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              NMPPATAVNYT+W+++ F SG+V +RY    W RHNYVLSGALDAGLAFMGVLLYLCLG
Sbjct  659   VNMPPATAVNYTSWVLIAFASGFVAYRYYRGWWSRHNYVLSGALDAGLAFMGVLLYLCLG  718

Query  2205  LENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +++VSLNWWG D DGCP ASCP+A+G+IV+GCPV
Sbjct  719   MQHVSLNWWGCDSDGCPLASCPTAQGVIVKGCPV  752



>ref|XP_008394097.1| PREDICTED: oligopeptide transporter 7-like [Malus domestica]
Length=735

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/744 (74%), Positives = 631/744 (85%), Gaps = 15/744 (2%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             S  EI  PL+PK +             +   S P A  +ENSPI +VALTVP TDDPSLP
Sbjct  5     SGHEIAAPLIPKTQY-----------DASASSPPPA--DENSPIEQVALTVPVTDDPSLP  51

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
              +TFR W LG L+CVLLSFLNQFFWYR EPL++T+ISAQIAVVPLG LMA+ ITDRVFF+
Sbjct  52    TVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTSISAQIAVVPLGHLMASLITDRVFFK  111

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
             G KWEFTLNPGPFNVKEHVLITIFANSGAG VYAIH+V+AVK+FY K+++FFV+L++VLT
Sbjct  112   GRKWEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSAVKIFYKKNLSFFVALLVVLT  171

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKGG+TR QFF+IAF C
Sbjct  172   TQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERPKGGLTRNQFFLIAFTC  231

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYYV PGYLF MLTSLSWICW FP S+LA QLGSGL GLGIGAIGLDWSSISSYLGSP
Sbjct  232   SFAYYVLPGYLFPMLTSLSWICWIFPSSILAHQLGSGLHGLGIGAIGLDWSSISSYLGSP  291

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFATANIA GFFL++YV TP+ YW +V+NAKTFPIFSD+LFTS+GQ+YNISAIIDS
Sbjct  292   LASPWFATANIAAGFFLVMYVITPVTYWLNVYNAKTFPIFSDDLFTSTGQSYNISAIIDS  351

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
             NF LD+ AY+ EG LY+STFFA+ YG+ FA LTAT+VHV+LF+GR+IW+ SKS+  + KM
Sbjct  352   NFRLDINAYEGEGPLYMSTFFAIYYGINFACLTATIVHVLLFNGRDIWQLSKSAINENKM  411

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             D+HT+LM KY+QVP WWF CIL+ANI  T+F C YY  QLQL WWGVLLAC +A+ FTLP
Sbjct  412   DVHTKLMRKYKQVPGWWFMCILLANITATLFTCHYYNYQLQLQWWGVLLACGLALFFTLP  471

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             IG+I A TNQ P LN+ITEYIIGY+YPGYPVAN+ FKVYGYISM QAIAFL+DFKLGHYM
Sbjct  472   IGVINATTNQMPALNVITEYIIGYLYPGYPVANILFKVYGYISMKQAIAFLEDFKLGHYM  531

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDAS  1844
             KIPPR MFMAQVVGTVIA FV+LGTAWWLM T+P+IC      +++ WTCP DHVFYDAS
Sbjct  532   KIPPRAMFMAQVVGTVIAAFVHLGTAWWLMSTVPDICDRALLPSDSPWTCPGDHVFYDAS  591

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGL+GPRRIFG+LG Y  +NWFFLAGAIAPV VWLA KAFP + WI+LI MPVL  AT
Sbjct  592   VIWGLVGPRRIFGNLGHYSTINWFFLAGAIAPVPVWLAHKAFPSKHWIKLITMPVLFGAT  651

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              NMPPATAVNYT+WI++GF SG++ +RY   LW RHNYVLSGALDAGLAFMGVLLYLCLG
Sbjct  652   VNMPPATAVNYTSWILIGFASGFIAYRYYRALWSRHNYVLSGALDAGLAFMGVLLYLCLG  711

Query  2205  LENVSLNWWGNDLDGCPYASCPSA  2276
             +E+VSL WWG+  DGCP AS  +A
Sbjct  712   MEHVSLKWWGSSPDGCPLASSSTA  735



>ref|XP_010090590.1| Oligopeptide transporter 7 [Morus notabilis]
 gb|EXB39949.1| Oligopeptide transporter 7 [Morus notabilis]
Length=707

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/755 (74%), Positives = 632/755 (84%), Gaps = 54/755 (7%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAE-EENSPIREVALTVPTTDDP  221
             E S  EIKTPL+ KV E  G      S  S  +   EAAE EENSP+ +VALTVP TDDP
Sbjct  4     EDSYGEIKTPLISKVGEDGGAFSSYPSPSSSTQRSAEAAEKEENSPVEQVALTVPITDDP  63

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             SLPVLTFRMW LG LSCVLLSFLNQFFWYR EPL+ITAISAQIAVVPLGQLMAA+I + V
Sbjct  64    SLPVLTFRMWFLGILSCVLLSFLNQFFWYRKEPLSITAISAQIAVVPLGQLMAAKIPNHV  123

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FFRGT+WEF+LNPGPFNVKEHVLITIFANSGAGTVYAIHVVT VK+FY +H+TFFVSLI+
Sbjct  124   FFRGTRWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTVVKIFYKQHMTFFVSLIV  183

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKG ++RTQFFVIA
Sbjct  184   VLTTQVLGFGWAGIFRRYLVEPAAMWWPENLVQVSLFRALHEKEERPKGSLSRTQFFVIA  243

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F CSFAYYVFPGYLF+MLTS+SWICW FP+S+LAQQLGSGL GLGIG  GLDWS+ISSYL
Sbjct  244   FFCSFAYYVFPGYLFEMLTSISWICWLFPKSILAQQLGSGLHGLGIGTFGLDWSTISSYL  303

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+AVG+F ++YV  P  YW ++FNAKTFPIFSD+LFTS+GQ YN ++I
Sbjct  304   GSPLASPWFATANVAVGYFFVMYVLAPTCYWLNLFNAKTFPIFSDKLFTSNGQKYNTTSI  363

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDS+FHLD+ A+++EG LY+STFFA++YGVGFAALTAT+VHV LFHGREIWEQSKSSFK+
Sbjct  364   IDSHFHLDIAAFEREGPLYISTFFAMSYGVGFAALTATIVHVALFHGREIWEQSKSSFKE  423

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             ++MDIHT+LM KY+QVPEWWF                                       
Sbjct  424   KRMDIHTKLMKKYKQVPEWWF---------------------------------------  444

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
                          +PGLNI+TEYIIGYIYPGYPVANMCFKVYGYISM+QA++FLQDFKLG
Sbjct  445   ------------ISPGLNIMTEYIIGYIYPGYPVANMCFKVYGYISMSQALSFLQDFKLG  492

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDA  1841
             HYMKIPPRTMFMAQ+VGT+IA  VYLGTAWWLMETIP IC+ T+  +VWTCP D VFYDA
Sbjct  493   HYMKIPPRTMFMAQMVGTLIAALVYLGTAWWLMETIPNICEDTS--SVWTCPGDTVFYDA  550

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGL+GPRRIFG+LG+Y  VNWFFL GAIAP+LVWLA +AFP QEWIRLINMPVLI A
Sbjct  551   SVIWGLVGPRRIFGNLGSYSVVNWFFLGGAIAPILVWLAARAFPSQEWIRLINMPVLIGA  610

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVN+ TWI+ GFLSG+VV+RY+PD W+RHNYVLSGALDAGLAFMGV+LY  L
Sbjct  611   TGMMPPATAVNFNTWILAGFLSGFVVYRYKPDWWRRHNYVLSGALDAGLAFMGVVLYFSL  670

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             G+E++SLNWWGNDLDGCP ASCP+AKG+++EGCPV
Sbjct  671   GMEDISLNWWGNDLDGCPLASCPTAKGVVIEGCPV  705



>ref|XP_011078828.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Sesamum 
indicum]
Length=751

 Score =  1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/757 (72%), Positives = 640/757 (85%), Gaps = 9/757 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             M  S +EI  PL+ K++        AS++ +       + EEENSP+ +VALTVP TDDP
Sbjct  1     MIQSEEEISAPLIKKLKPCAVHQPQASAAST-------SEEEENSPVEQVALTVPPTDDP  53

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             +LPV+TFRMW LG  +CV+LSFLNQFFWYR EPL+ITAISAQIAVVPLG LMAA +  RV
Sbjct  54    TLPVVTFRMWTLGAAACVMLSFLNQFFWYRREPLSITAISAQIAVVPLGHLMAAALPRRV  113

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF G KWEF+ NPG FNVKEHVLITIFAN+GA   Y+IH+V+AVK+FYG+ +TF+V+L +
Sbjct  114   FFEGQKWEFSFNPGKFNVKEHVLITIFANAGAANPYSIHIVSAVKIFYGQKLTFWVALGV  173

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             VLTTQVLGFGWAG+FRRYLVEPA+MWWP NLVQVSLFRALHEKE R +G +TR QFF+IA
Sbjct  174   VLTTQVLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFRALHEKEVRDRGALTRNQFFLIA  233

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F+CSFAYYVFPGYLF  LTS+SW+CW F  SVL QQLGSGL GLGIGAIGLDWSSISSYL
Sbjct  234   FLCSFAYYVFPGYLFPKLTSVSWLCWIFSSSVLFQQLGSGLHGLGIGAIGLDWSSISSYL  293

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATANIAVG+F+ +Y  TPI YW +V+NAKTFPIFSD L+TS GQ YNISAI
Sbjct  294   GSPLASPWFATANIAVGYFICMYAVTPIMYWLNVYNAKTFPIFSDGLYTSEGQKYNISAI  353

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             +D NFH+DL++Y++EG+LYLSTFFA+TY   FA LTAT+ HV+LFHGR++W  SKS+FK+
Sbjct  354   VDPNFHIDLQSYEREGRLYLSTFFAMTYAFSFACLTATIAHVLLFHGRDLWLLSKSAFKE  413

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHT+LM  Y+QVPEWWF CIL+ NIA T+  C+ Y  QLQLPWWGVLLACV+A  F
Sbjct  414   KKMDIHTKLMQNYKQVPEWWFMCILLINIAGTLLICQIYYNQLQLPWWGVLLACVLAFCF  473

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLP+G+ITA TNQTPGLN+ITEY+IGY+YPGYPVANMCFKVYGYISM QA+ FLQD KLG
Sbjct  474   TLPVGVITATTNQTPGLNVITEYMIGYLYPGYPVANMCFKVYGYISMKQALIFLQDLKLG  533

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFY  1835
             HYMKIPPR MFMAQVVGT+I+  V+LGTAWWLM+T+P IC  TA    + WTCP DHVFY
Sbjct  534   HYMKIPPRAMFMAQVVGTLISSLVHLGTAWWLMDTVPNICDRTALPPGSPWTCPGDHVFY  593

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLIGP RIFGDLG Y A+NW FL GAIAP+LVWLA KAFP Q+WIRLI++PVL+
Sbjct  594   DASVIWGLIGPERIFGDLGYYSAINWSFLVGAIAPLLVWLAHKAFPNQQWIRLISVPVLL  653

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
              +  NMPPAT+VNY +WII+GFLSGYV +RY  D W +HNYVLSGALDAGLAFMGV LYL
Sbjct  654   VSIINMPPATSVNYNSWIIIGFLSGYVAYRYYRDWWSKHNYVLSGALDAGLAFMGVFLYL  713

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             CLG++++SL+WWG+D DGCP ASCP+AKGI+V+GCP+
Sbjct  714   CLGMKHISLDWWGSDTDGCPLASCPTAKGIVVKGCPI  750



>ref|XP_009379386.1| PREDICTED: oligopeptide transporter 7-like [Pyrus x bretschneideri]
Length=735

 Score =  1094 bits (2830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/744 (74%), Positives = 630/744 (85%), Gaps = 15/744 (2%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             S  EI  PL+PK +           S +   S P A  +ENSPI +VALTVP TDDPSL 
Sbjct  5     SGHEIAAPLIPKTQ-----------SDASASSPPPA--DENSPIEQVALTVPVTDDPSLS  51

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
              +TFR W LG L+CVLLSFLNQFFWYR EPL++T+ISAQIAVVPLG LMA+ ITDRVFF+
Sbjct  52    TVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTSISAQIAVVPLGHLMASLITDRVFFK  111

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
             G KWEFT NPGPFNVKEHVLITIFANSGAG VYAIH+V+AVK+FY K+++FFV+L++VLT
Sbjct  112   GRKWEFTFNPGPFNVKEHVLITIFANSGAGNVYAIHIVSAVKIFYKKNLSFFVALLVVLT  171

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKGG+TR QFF+IAF C
Sbjct  172   TQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERPKGGLTRNQFFLIAFTC  231

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYYV PGYLF MLTSLSWICW FP S+LA QLGSGL GLGIGAIGLDWSSISSYLGSP
Sbjct  232   SFAYYVLPGYLFPMLTSLSWICWIFPTSILAHQLGSGLHGLGIGAIGLDWSSISSYLGSP  291

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFATANIA GFFL++YV TP+ YW +V+NAKTFPIFSD+LFTS+GQ+YNISAIIDS
Sbjct  292   LASPWFATANIAAGFFLVMYVITPVTYWLNVYNAKTFPIFSDDLFTSTGQSYNISAIIDS  351

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
             NF LD+ AY++EG LY+STFFA+ YG+ FA LTAT+VHV+LF+GR+IW+ SKS+  + KM
Sbjct  352   NFRLDINAYEREGPLYMSTFFAIYYGINFACLTATIVHVLLFNGRDIWQLSKSAINENKM  411

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             D+HT+LM KY+QVP WWF CIL+ANI  T+F C YY  QLQL WWGVLLAC +A+ FTLP
Sbjct  412   DVHTKLMRKYKQVPGWWFMCILLANITATLFTCHYYNYQLQLQWWGVLLACGLALFFTLP  471

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             IG+I A TNQ P LN+ITEYIIGY+YPGYPVAN+ FKVYGYISM QAIAFL+DFKLGHYM
Sbjct  472   IGVINATTNQAPALNVITEYIIGYLYPGYPVANILFKVYGYISMKQAIAFLEDFKLGHYM  531

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDAS  1844
             KIPPR MFMAQVVGT+IA  V+LGTAWWLM T+P+IC      +++ WTCP DHVFYDAS
Sbjct  532   KIPPRAMFMAQVVGTIIAAIVHLGTAWWLMSTVPDICDRALLPSDSPWTCPGDHVFYDAS  591

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGL+GPRRIFG+LG Y A+NWFFLAGAIAPV VWLA KAFP + WI+LI MPVL  AT
Sbjct  592   VIWGLVGPRRIFGNLGHYSAINWFFLAGAIAPVPVWLAHKAFPSKHWIKLITMPVLFGAT  651

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              NMPPATAVNYT+WI++GF SG++ +RY   LW RHNYVLSGALDAGLAFMGVLLYLCLG
Sbjct  652   VNMPPATAVNYTSWILIGFASGFIAYRYYRALWSRHNYVLSGALDAGLAFMGVLLYLCLG  711

Query  2205  LENVSLNWWGNDLDGCPYASCPSA  2276
             +E+VS  WWG+  DGCP AS  +A
Sbjct  712   MEHVSFKWWGSSPDGCPLASSSTA  735



>ref|XP_007046673.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 ref|XP_007046674.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90830.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90831.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=741

 Score =  1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/748 (73%), Positives = 636/748 (85%), Gaps = 10/748 (1%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEE-ENSPIREVALTVPTTDD  218
             M  + +E+  PL+ K    + +            S+P + ++ ENSPI +VALTVPTTDD
Sbjct  1     MTTAINEVTAPLIQKSRSDQIQ-------PDASGSIPLSPDDLENSPIEQVALTVPTTDD  53

Query  219   PSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDR  398
              SLP LTFR W+LGTL+CVLLSFLNQFFWYR EPL+I++ISAQIAVVPLG LMAA +TDR
Sbjct  54    LSLPTLTFRTWILGTLACVLLSFLNQFFWYRREPLSISSISAQIAVVPLGHLMAAMVTDR  113

Query  399   VFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLI  578
             VFF+G K+EFTLNPGPFNVKEHVLITIF NSGAG VYAIH+++ VK+FY K ++F V+L+
Sbjct  114   VFFKGRKFEFTLNPGPFNVKEHVLITIFTNSGAGNVYAIHLISTVKIFYKKEMSFLVALL  173

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             +V TTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKEER KG +TR QFF+I
Sbjct  174   VVFTTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERAKGRLTRNQFFLI  233

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AFICSFAYYV PGYLF  L+SLSW+CW FP S+LA QLGSGL+GLGIGAIG DWSSIS+Y
Sbjct  234   AFICSFAYYVLPGYLFPALSSLSWLCWVFPTSILAHQLGSGLRGLGIGAIGFDWSSISAY  293

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFAT NIA GF LI+Y+ TPI YW +VF AK FPIFSD LFTS+GQ+YNISA
Sbjct  294   LGSPLASPWFATVNIAAGFALIMYIITPIAYWLNVFKAKNFPIFSDGLFTSTGQSYNISA  353

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             IIDSNFH+D+EAY++EG LYLST FA++YGVGFA LTAT+VHV++F+GREIW+ SKS+F+
Sbjct  354   IIDSNFHIDMEAYEREGPLYLSTVFAMSYGVGFACLTATVVHVIIFNGREIWQLSKSAFR  413

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             ++KMD+HT+LM KY+QVPEWWF CIL  NI+ T+F C+YY +QLQLPWWG+LLAC +AI 
Sbjct  414   EKKMDVHTKLMRKYKQVPEWWFTCILAVNISATIFTCQYYNDQLQLPWWGILLACGLAIF  473

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLP+G+I A TNQTP LNI TEYIIGYIYPGYPVA+MCFKVYGYISM Q I FLQDFKL
Sbjct  474   FTLPVGVIAATTNQTPALNIFTEYIIGYIYPGYPVASMCFKVYGYISMKQGITFLQDFKL  533

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVF  1832
             GHYMKIPPR MF+AQV GT+I+ F +LGTAWWLM T+P+IC  +   T + WTCPSDHVF
Sbjct  534   GHYMKIPPRAMFIAQVGGTMISAFAHLGTAWWLMATVPDICNRELLPTGSPWTCPSDHVF  593

Query  1833  YDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVL  2012
             YDASVIWGLIGPRRIFGDLG Y A+NWFFLAGA+APVLVWLATK FP + WI+LI MPVL
Sbjct  594   YDASVIWGLIGPRRIFGDLGYYSAINWFFLAGAVAPVLVWLATKTFPNKPWIKLITMPVL  653

Query  2013  ISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLY  2192
             + AT NMPPATAVNYT+W+++GF SG++ +RY    W RHNYVLSGALDAGLAFM VLLY
Sbjct  654   LGATVNMPPATAVNYTSWVLIGFASGFIAYRYHRGWWSRHNYVLSGALDAGLAFMAVLLY  713

Query  2193  LCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             LCLG+E+VSL+WWG+D D CP ASCP+A
Sbjct  714   LCLGMEHVSLSWWGSDWDRCPLASCPTA  741



>ref|XP_011078837.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Sesamum 
indicum]
Length=744

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/757 (72%), Positives = 637/757 (84%), Gaps = 16/757 (2%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             M  S +EI  PL+         H   +S+ S  E      EEENSP+ +VALTVP TDDP
Sbjct  1     MIQSEEEISAPLI--------IHQPQASAASTSE------EEENSPVEQVALTVPPTDDP  46

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             +LPV+TFRMW LG  +CV+LSFLNQFFWYR EPL+ITAISAQIAVVPLG LMAA +  RV
Sbjct  47    TLPVVTFRMWTLGAAACVMLSFLNQFFWYRREPLSITAISAQIAVVPLGHLMAAALPRRV  106

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF G KWEF+ NPG FNVKEHVLITIFAN+GA   Y+IH+V+AVK+FYG+ +TF+V+L +
Sbjct  107   FFEGQKWEFSFNPGKFNVKEHVLITIFANAGAANPYSIHIVSAVKIFYGQKLTFWVALGV  166

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             VLTTQVLGFGWAG+FRRYLVEPA+MWWP NLVQVSLFRALHEKE R +G +TR QFF+IA
Sbjct  167   VLTTQVLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFRALHEKEVRDRGALTRNQFFLIA  226

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             F+CSFAYYVFPGYLF  LTS+SW+CW F  SVL QQLGSGL GLGIGAIGLDWSSISSYL
Sbjct  227   FLCSFAYYVFPGYLFPKLTSVSWLCWIFSSSVLFQQLGSGLHGLGIGAIGLDWSSISSYL  286

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATANIAVG+F+ +Y  TPI YW +V+NAKTFPIFSD L+TS GQ YNISAI
Sbjct  287   GSPLASPWFATANIAVGYFICMYAVTPIMYWLNVYNAKTFPIFSDGLYTSEGQKYNISAI  346

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             +D NFH+DL++Y++EG+LYLSTFFA+TY   FA LTAT+ HV+LFHGR++W  SKS+FK+
Sbjct  347   VDPNFHIDLQSYEREGRLYLSTFFAMTYAFSFACLTATIAHVLLFHGRDLWLLSKSAFKE  406

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +KMDIHT+LM  Y+QVPEWWF CIL+ NIA T+  C+ Y  QLQLPWWGVLLACV+A  F
Sbjct  407   KKMDIHTKLMQNYKQVPEWWFMCILLINIAGTLLICQIYYNQLQLPWWGVLLACVLAFCF  466

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLP+G+ITA TNQTPGLN+ITEY+IGY+YPGYPVANMCFKVYGYISM QA+ FLQD KLG
Sbjct  467   TLPVGVITATTNQTPGLNVITEYMIGYLYPGYPVANMCFKVYGYISMKQALIFLQDLKLG  526

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFY  1835
             HYMKIPPR MFMAQVVGT+I+  V+LGTAWWLM+T+P IC  TA    + WTCP DHVFY
Sbjct  527   HYMKIPPRAMFMAQVVGTLISSLVHLGTAWWLMDTVPNICDRTALPPGSPWTCPGDHVFY  586

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLIGP RIFGDLG Y A+NW FL GAIAP+LVWLA KAFP Q+WIRLI++PVL+
Sbjct  587   DASVIWGLIGPERIFGDLGYYSAINWSFLVGAIAPLLVWLAHKAFPNQQWIRLISVPVLL  646

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
              +  NMPPAT+VNY +WII+GFLSGYV +RY  D W +HNYVLSGALDAGLAFMGV LYL
Sbjct  647   VSIINMPPATSVNYNSWIIIGFLSGYVAYRYYRDWWSKHNYVLSGALDAGLAFMGVFLYL  706

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             CLG++++SL+WWG+D DGCP ASCP+AKGI+V+GCP+
Sbjct  707   CLGMKHISLDWWGSDTDGCPLASCPTAKGIVVKGCPI  743



>ref|XP_006851891.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
 gb|ERN13358.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
Length=800

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/715 (75%), Positives = 628/715 (88%), Gaps = 2/715 (0%)
 Frame = +3

Query  168   ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQ  347
             ENSPI +VALTVP TDDPSLPV+TFRMW LG LSCV++SFLNQFFW+RTEPLTIT++SAQ
Sbjct  85    ENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQFFWFRTEPLTITSVSAQ  144

Query  348   IAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT  527
             IAVVPLG LMAA +  R FF+G +WEFTLNPGPFNVKEHVLITIFANSGAG+V+AIH+V+
Sbjct  145   IAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFANSGAGSVFAIHIVS  204

Query  528   AVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  707
             +VKVFY + ++FFV+ ++V+TTQV+GFGWAG+FR+YLVEPAAMWWP NLVQVS+F ALHE
Sbjct  205   SVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLVEPAAMWWPYNLVQVSIFGALHE  264

Query  708   KEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglq  887
             KEERPK  +TR QFF++A ICSFAYY  PGYLF MLTSLSWICW FP+SVLA QLGSGL 
Sbjct  265   KEERPKESLTRNQFFLVALICSFAYYALPGYLFPMLTSLSWICWIFPKSVLAHQLGSGLH  324

Query  888   glgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPI  1067
             GLG+GAIGLDWSSISSYL SPLASPWFATAN+A GFFL  YV  P+ YW D++NAK FPI
Sbjct  325   GLGLGAIGLDWSSISSYLDSPLASPWFATANVAAGFFLFTYVIVPLAYWLDLYNAKRFPI  384

Query  1068  FSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHV  1247
             FS++LF  SG  YNI+AI+DSNF++DLEAY++ GKLYLSTFF LTYG+GFA+L AT+VHV
Sbjct  385   FSEKLFAYSGGEYNITAIVDSNFNIDLEAYEKGGKLYLSTFFVLTYGIGFASLAATVVHV  444

Query  1248  VLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQ  1427
             +LFHGREI + SK++F+++ MDIHT+LM+KY QVPEWWF   L+ NIA  +FACEYY +Q
Sbjct  445   LLFHGREILQISKTTFQEKTMDIHTKLMTKYEQVPEWWFIVTLILNIAAAMFACEYYNDQ  504

Query  1428  LQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVY  1607
             LQLPWWGVLLAC I+I FTLPIGIITA TNQ PGLNII+EY+IGY+YPG PVANMCFKVY
Sbjct  505   LQLPWWGVLLACGISIFFTLPIGIITATTNQKPGLNIISEYVIGYLYPGRPVANMCFKVY  564

Query  1608  GYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQT  1787
             G+ISM QA+ FLQDFKLGHYMKIPPRTMFMAQ+VGT+IA  VYLGTAW LM  IP IC T
Sbjct  565   GFISMKQAVTFLQDFKLGHYMKIPPRTMFMAQIVGTMIAAMVYLGTAWCLMNLIPNICDT  624

Query  1788  TA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
             +   +N+ WTCP DHVFYDASVIWGL+GPRRIFGDLGTY A+NW FL GAIAP ++WLA 
Sbjct  625   SVLPSNSPWTCPMDHVFYDASVIWGLLGPRRIFGDLGTYSAINWCFLGGAIAPFVMWLAH  684

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             +AFP +EWIRLINMPVLI A S MPPAT VNYT+WI++GF+ G+VV+RY+ D WQRHNY+
Sbjct  685   QAFPDKEWIRLINMPVLIGAISIMPPATTVNYTSWILMGFIFGFVVYRYKRDWWQRHNYI  744

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LSG+LDAGLAFMGVLLYL LGLE++SL WWG++LDGCP ASCP+AKG++VEGCPV
Sbjct  745   LSGSLDAGLAFMGVLLYLWLGLEDISLYWWGSELDGCPLASCPTAKGVVVEGCPV  799



>ref|XP_006343361.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=754

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/712 (76%), Positives = 622/712 (87%), Gaps = 2/712 (0%)
 Frame = +3

Query  177   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAV  356
             PI +VALTVP TDD +LPV+TFRMW+LGTL+C+LLSFLNQFFW+R EPL+I++ISAQIAV
Sbjct  42    PIEQVALTVPVTDDSTLPVVTFRMWILGTLACILLSFLNQFFWFRREPLSISSISAQIAV  101

Query  357   VPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVK  536
             VPLG LMA  I +RVFF+G K+EFT+NPGPFNVKEHVLITIFANSGAG  YAIH+V+AVK
Sbjct  102   VPLGHLMAMAIPNRVFFKGRKFEFTMNPGPFNVKEHVLITIFANSGAGNPYAIHIVSAVK  161

Query  537   VFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEE  716
             VFY + +TF+VSLI+VLTTQVLGFGWAG+FR+YLVEPAAMWWP NLVQVSLFRALHEKEE
Sbjct  162   VFYKRTLTFWVSLIVVLTTQVLGFGWAGLFRKYLVEPAAMWWPHNLVQVSLFRALHEKEE  221

Query  717   RPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglg  896
             R K  +TR QFF+IAF+CSFAYYVFPGYLF ML+SLSW+CW FP SVLAQQLGSGL GLG
Sbjct  222   RAKNELTRNQFFLIAFLCSFAYYVFPGYLFPMLSSLSWLCWLFPASVLAQQLGSGLHGLG  281

Query  897   igaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSD  1076
             +GAIGLDWSSISSYLGSPLASPWFATANIA G+FLI+YVFTPI YW +V+ AKTFPIFSD
Sbjct  282   MGAIGLDWSSISSYLGSPLASPWFATANIAAGYFLIMYVFTPIIYWSNVYKAKTFPIFSD  341

Query  1077  ELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLF  1256
              LFTS GQTYNISAI+D NFH+D  AYD EG LYLSTFF++TY   FA L+AT+VHV LF
Sbjct  342   GLFTSDGQTYNISAIVDQNFHIDFNAYDHEGPLYLSTFFSMTYAFSFACLSATVVHVFLF  401

Query  1257  HGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQL  1436
             HGR++W+ SKS+F+++KMDIHT+LM KY+QVPEWWF  IL+ NIA TVF CEYYK QLQL
Sbjct  402   HGRDLWQLSKSAFQEKKMDIHTKLMRKYKQVPEWWFLSILLVNIAATVFICEYYKTQLQL  461

Query  1437  PWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYI  1616
             PWWGVLLAC +A  FTLP+G+ITA TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYI
Sbjct  462   PWWGVLLACGLAFFFTLPVGVITATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYI  521

Query  1617  SMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--  1790
             SM Q + FLQD KLGHYMKIPPR MFMAQV GT+I+  V+LGTAWWL++T+P+IC     
Sbjct  522   SMKQGLTFLQDLKLGHYMKIPPRAMFMAQVAGTLISALVHLGTAWWLIDTVPDICDRALL  581

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
                + WTCP DHVFYDASVIWGLIGP+RIFG+LG Y A+NW FL GAIAPV+VW+A K F
Sbjct  582   PPGSPWTCPGDHVFYDASVIWGLIGPQRIFGNLGHYSALNWAFLFGAIAPVIVWIAHKTF  641

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P Q+WIRLI +PVL++   NMPPAT+VNY +WII+ FLSG+VV+RY   LW RHNYVLSG
Sbjct  642   PSQQWIRLITVPVLLAGIMNMPPATSVNYNSWIIIAFLSGFVVYRYNQKLWSRHNYVLSG  701

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLYLCLG+E+V LNWWG+D D CP A CP+A+GI+V+GCPV
Sbjct  702   ALDAGLAFMGVLLYLCLGMEHVRLNWWGSDADRCPLAKCPTAEGIVVKGCPV  753



>ref|XP_002436389.1| hypothetical protein SORBIDRAFT_10g001670 [Sorghum bicolor]
 gb|EER87756.1| hypothetical protein SORBIDRAFT_10g001670 [Sorghum bicolor]
Length=773

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/752 (72%), Positives = 640/752 (85%), Gaps = 6/752 (1%)
 Frame = +3

Query  54    ADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPV  233
               +I +PLL        RHG  S  + + E+  +  ++++SPI +VALTVP  DDP+ PV
Sbjct  23    GSQITSPLLQPSPRR--RHG--SPEEEEREAGDDDDDDDSSPIEQVALTVPVGDDPATPV  78

Query  234   LTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRG  413
             LTFRMW+LGT SC  LSFLN FF YR EPLTITA+SAQIAV+PLG+LMAA + +  FFRG
Sbjct  79    LTFRMWMLGTASCAGLSFLNAFFGYRKEPLTITAVSAQIAVLPLGRLMAAALPEGAFFRG  138

Query  414   TKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTT  593
               W FTLNPGPFN+KEHVLITIFAN+GAG V+ +++VT+V+VFYG+H++FFV+L+++LT+
Sbjct  139   RPWAFTLNPGPFNMKEHVLITIFANAGAGAVFGMNLVTSVRVFYGQHMSFFVALLLILTS  198

Query  594   QVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICS  773
             QVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KG +TR QFF++AFICS
Sbjct  199   QVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRRKGRMTRNQFFLVAFICS  258

Query  774   FAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPL  953
             FAYY+FPGYLFQMLTSLSWICW FP SV+AQQLGSGL GLGIGAIGLDWSSISSYLGSPL
Sbjct  259   FAYYIFPGYLFQMLTSLSWICWVFPISVIAQQLGSGLHGLGIGAIGLDWSSISSYLGSPL  318

Query  954   ASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSN  1133
             ASPWFATANIA GFF+++Y+ TPI YW +V+ A+ FPI+SD L+T SGQ YN+S+I+DS 
Sbjct  319   ASPWFATANIAAGFFIVMYIITPINYWFNVYKARNFPIYSDGLYTESGQKYNVSSIMDSQ  378

Query  1134  FHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMD  1313
             F+ D +AY++ G LY+STFFA +YG+GFA LTAT+ HV+LFHG EI + SKS+F+D+KMD
Sbjct  379   FYFDTDAYEKNGPLYISTFFASSYGLGFACLTATVSHVLLFHGSEICQLSKSAFEDKKMD  438

Query  1314  IHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPI  1493
             IHT+LM +YRQVPEWWF CILVA++A+T+  CEYY EQLQLPWWGVLLAC +AI +TLPI
Sbjct  439   IHTKLMRRYRQVPEWWFICILVASVAVTMLTCEYYIEQLQLPWWGVLLACALAIFYTLPI  498

Query  1494  GIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMK  1673
             GII A TNQ PGLNIITEYI+GY+YPG P+ANMCFKVYGY+   QA+ FLQDFKLGHYMK
Sbjct  499   GIIKATTNQAPGLNIITEYIMGYLYPGRPIANMCFKVYGYVGPRQALEFLQDFKLGHYMK  558

Query  1674  IPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASV  1847
             IPPRTMFMAQVVGT+IAG VYLGT WWLM+TIP +C       ++ WTCP DH+FYDASV
Sbjct  559   IPPRTMFMAQVVGTLIAGSVYLGTTWWLMDTIPNVCNREFLPADSPWTCPYDHLFYDASV  618

Query  1848  IWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATS  2027
             +WGLIGPRRIFGDLGTY AVNWFFL GAIAP LVW   KAFP Q+WIR +N+PVLI ATS
Sbjct  619   LWGLIGPRRIFGDLGTYSAVNWFFLGGAIAPFLVWCTQKAFPAQKWIRHVNVPVLIGATS  678

Query  2028  NMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGL  2207
              MPP TAVNYTTWI++ FLSGYVV+RYR + W+RHNY+LSGALDAGLAFM VLLYLCLGL
Sbjct  679   LMPPGTAVNYTTWILIAFLSGYVVYRYRRNWWERHNYLLSGALDAGLAFMAVLLYLCLGL  738

Query  2208  ENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             EN SLNWWGNDLDGCP ASCP+AKGI V+GCP
Sbjct  739   ENKSLNWWGNDLDGCPLASCPTAKGITVDGCP  770



>ref|XP_006380596.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
 gb|ERP58393.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
Length=750

 Score =  1088 bits (2813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/753 (72%), Positives = 636/753 (84%), Gaps = 9/753 (1%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             +EI TPL+        +H   +SS     S   A  +ENSPI +VALTVPTTDDP+LP +
Sbjct  5     EEITTPLI-------HQHSKQTSSSVANSSSTSADSKENSPIEQVALTVPTTDDPTLPAV  57

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFR W LG+L+C+LLSFLNQFFWYR EPL+IT+I AQIAVVPLG LMA+ IT++ FF G 
Sbjct  58    TFRTWTLGSLACILLSFLNQFFWYRREPLSITSICAQIAVVPLGHLMASTITNKTFFIGK  117

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             KWEFTLNPGPFNVKEHVLITIFANSGAG VYAIH+V+AVK+FY K +TFFV+L++VLTTQ
Sbjct  118   KWEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSAVKLFYKKELTFFVALLVVLTTQ  177

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             +LGFGWAG+FRRYLVEPA+MWWP NLVQVSLFRALHEKEER K G+TR QFF+IAFICSF
Sbjct  178   MLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFRALHEKEERHKDGLTRNQFFIIAFICSF  237

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYY FPGYLF  LTS+SW+CW FP S+LA QLGSGL GLGIGA G DW++ISSYLGSPLA
Sbjct  238   AYYAFPGYLFPKLTSISWLCWIFPSSILAHQLGSGLHGLGIGAFGFDWATISSYLGSPLA  297

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATANIA GF L++YV  PI YW +++ AK FPIFSD LFTS+GQ+YNISAIID  F
Sbjct  298   SPWFATANIAAGFVLLMYVIAPIAYWLNIYEAKNFPIFSDGLFTSTGQSYNISAIIDPKF  357

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             H+DL+AYD++G LYLST FA+ YG+ FA LTAT+VHV LFHGR+IW+ SKS+F+ +KMD+
Sbjct  358   HIDLDAYDRQGPLYLSTIFAMIYGLNFACLTATVVHVFLFHGRDIWQLSKSAFRYKKMDV  417

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM KY QVPEWWF CIL  NIA T+F CEYY EQLQLPWWGVLLAC IA+ FTLP+G
Sbjct  418   HTKLMRKYNQVPEWWFLCILFLNIAATIFTCEYYNEQLQLPWWGVLLACGIAVFFTLPVG  477

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             +ITA TN+TPGLN+ITEY+IGY+YPG+PVAN+CFKVYGYISM Q I FL+DFKLGHYMKI
Sbjct  478   VITATTNKTPGLNVITEYVIGYLYPGFPVANICFKVYGYISMKQGITFLEDFKLGHYMKI  537

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDASVI  1850
             PPR MFMAQVVGT+I+  V+LGTAWWLMETIP IC  +  +  + WTCPSDH+FYDASVI
Sbjct  538   PPRAMFMAQVVGTIISALVHLGTAWWLMETIPNICDRELLSPGSPWTCPSDHLFYDASVI  597

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRR+FGDLG Y A NWFFL GAIAP+LVWLA KAFP ++WI LI++PVL+SAT N
Sbjct  598   WGLIGPRRVFGDLGHYSATNWFFLGGAIAPILVWLAHKAFPNKDWIGLISIPVLLSATLN  657

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             M PATAVNYTTW++VGF SG++ +RY  D W RHNYVLSGALDAGLAFM V LYLCLG+ 
Sbjct  658   MLPATAVNYTTWVVVGFASGFIAYRYYRDWWSRHNYVLSGALDAGLAFMAVFLYLCLGMW  717

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             +VSL WWG++ +GCP ASCP+A G+  +GCP++
Sbjct  718   HVSLEWWGSESEGCPLASCPTAPGVFGKGCPIL  750



>gb|KDP46770.1| hypothetical protein JCGZ_06558 [Jatropha curcas]
Length=748

 Score =  1087 bits (2811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/755 (71%), Positives = 629/755 (83%), Gaps = 15/755 (2%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLP-EAAEEENSPIREVALTVPTTDDPSL  227
             ++ EI TPL+ K            +  SK  S   +  E+ENSPI +VALTV T DD +L
Sbjct  5     TSHEITTPLINK------------NRTSKYNSADNDDNEKENSPIEQVALTVSTADDQTL  52

Query  228   PVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFF  407
             P +TFR W LGTL+C++LSFLNQFFWYR EPLTIT+ISAQI VVPLG LMA+ ITD+VFF
Sbjct  53    PTVTFRTWTLGTLACIVLSFLNQFFWYRREPLTITSISAQIVVVPLGHLMASIITDKVFF  112

Query  408   RGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVL  587
             +GT+WEF+LN GPFNVKEHVLITIFANSGAG+VYA+H+++AVK+FY K ++F ++  IV+
Sbjct  113   KGTRWEFSLNRGPFNVKEHVLITIFANSGAGSVYAVHIISAVKIFYKKELSFLMAFFIVI  172

Query  588   TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFI  767
             TTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKGG+TR QFF+IA I
Sbjct  173   TTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERPKGGLTRNQFFIIALI  232

Query  768   CSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGS  947
             CSFAYYVFPGYL   L+SLSWICW FP S+LA QLGSGL GLGIG+IG DW+SISSYLGS
Sbjct  233   CSFAYYVFPGYLLPKLSSLSWICWIFPTSILAHQLGSGLHGLGIGSIGFDWASISSYLGS  292

Query  948   PLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIID  1127
             P+A+PWFATAN+A GF LI+YV TPI YW + + AKTFPIFSD LFTS+GQ YNISAIID
Sbjct  293   PMATPWFATANVACGFALIMYVITPISYWHNFYKAKTFPIFSDGLFTSNGQKYNISAIID  352

Query  1128  SNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRK  1307
               FH+D++AY++EG LYLST FA+ YG+ FA L A +VHV LFHGR +W  SKS+F+++K
Sbjct  353   PKFHIDIDAYEREGPLYLSTNFAMIYGLNFATLAAVIVHVFLFHGRSLWHLSKSAFQEKK  412

Query  1308  MDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTL  1487
             MD+HTRLM KY+QVPEWWF CIL+ NIA T+F CEYY +QLQLPWWGVLLAC +A  FTL
Sbjct  413   MDVHTRLMRKYKQVPEWWFLCILLFNIAATIFICEYYNDQLQLPWWGVLLACGLAFFFTL  472

Query  1488  PIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHY  1667
             PIGIITA TNQTPGLN+ITEYIIGY+YPG+PVANMCFKVYGYISM Q I FLQDFKLGHY
Sbjct  473   PIGIITATTNQTPGLNVITEYIIGYLYPGFPVANMCFKVYGYISMKQGITFLQDFKLGHY  532

Query  1668  MKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDA  1841
             MKIPPR MFMAQVVGT+IA  V+L TAWWLMET+P IC      + + WTCP DHVFYDA
Sbjct  533   MKIPPRAMFMAQVVGTIIAAIVHLLTAWWLMETVPNICDRAVLPSGSPWTCPGDHVFYDA  592

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGPRRIFG LG Y A+NWFFLAGAIAP+LVWLA KAFP Q WI+LI+MPVL+  
Sbjct  593   SVIWGLIGPRRIFGGLGHYSAINWFFLAGAIAPILVWLAHKAFPNQHWIKLISMPVLLGG  652

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
             T  MPPATAVNY TWI++GF SG++ +RY  + W+RHNYV S  LDAGLAFM V LYLCL
Sbjct  653   TLQMPPATAVNYVTWILIGFCSGFIAYRYYNNWWRRHNYVFSAGLDAGLAFMAVFLYLCL  712

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             G++ V+L+WWGND DGCP ASCP+A G++V+GCPV
Sbjct  713   GMQQVTLDWWGNDSDGCPLASCPTAPGVVVKGCPV  747



>ref|XP_008241834.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=738

 Score =  1085 bits (2806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/744 (73%), Positives = 631/744 (85%), Gaps = 10/744 (1%)
 Frame = +3

Query  51    SADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLP  230
             S  EI +PL+    + +G       S S+     E +  ENSPI +VALTVP TDDPSLP
Sbjct  3     SEHEISSPLI-HSNKIDG-------SASRRPPADEISGHENSPIEQVALTVPVTDDPSLP  54

Query  231   VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR  410
              +TFR W LG L+CVLLSFLNQFFWYR EPL++T+ISAQIAVVPLG+LMA+ IT RVFF+
Sbjct  55    TVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTSISAQIAVVPLGRLMASLITKRVFFK  114

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLT  590
             G KWEFTLNPGPFNVKEHVLITIFANSGAG VYAIH+V+ VK+FY K+++FFV+L++VLT
Sbjct  115   GQKWEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSTVKLFYKKNLSFFVALLVVLT  174

Query  591   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFIC  770
             TQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE+RP+GG+TR QFF+IAF C
Sbjct  175   TQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEKRPRGGLTRNQFFLIAFTC  234

Query  771   SFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSP  950
             SFAYYV PGYLF MLTSLSWICW FP S+LA QLGSGL GLGIGAIGLDWSSISSYLGSP
Sbjct  235   SFAYYVLPGYLFPMLTSLSWICWIFPTSILAHQLGSGLHGLGIGAIGLDWSSISSYLGSP  294

Query  951   LASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDS  1130
             LASPWFATANIA GFFL+LYV TP+ YW +++NAKTFPI SD LFTS+GQ+YNISAIID 
Sbjct  295   LASPWFATANIAAGFFLVLYVITPLAYWFNLYNAKTFPIVSDGLFTSTGQSYNISAIIDP  354

Query  1131  NFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKM  1310
             NF LD++AY++EG L++STFFA+ YGV FA LTAT+VHV+LF+GR+IW+ S S+F+++KM
Sbjct  355   NFRLDIDAYEREGALHISTFFAIYYGVNFACLTATIVHVLLFNGRDIWQLSTSAFREKKM  414

Query  1311  DIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLP  1490
             D+HT+LM KY+QVP WWF CILVANI  T+F C YY  QLQL WWGVLLAC +A+ FTLP
Sbjct  415   DVHTKLMRKYKQVPGWWFMCILVANIVATIFTCHYYNHQLQLKWWGVLLACGLALFFTLP  474

Query  1491  IGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYM  1670
             IG+I A TNQ P LN+ITEYIIGY+YPGYPVAN+CFKVYGYISM Q IAFL+DFKLGHYM
Sbjct  475   IGVIAATTNQKPALNVITEYIIGYLYPGYPVANVCFKVYGYISMKQGIAFLEDFKLGHYM  534

Query  1671  KIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDAS  1844
             KIPPR MFMAQVVGT+IA FV+LGTAWWLM TIP+IC       ++ WTCP DHVFYDAS
Sbjct  535   KIPPRAMFMAQVVGTIIAAFVHLGTAWWLMNTIPDICDRALLPADSPWTCPGDHVFYDAS  594

Query  1845  VIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISAT  2024
             VIWGL+GPRRIFGDLG Y A+NWFFLAGAIAPVLVWLA KAFP + WI+LI MPVL+ AT
Sbjct  595   VIWGLVGPRRIFGDLGHYSAINWFFLAGAIAPVLVWLAHKAFPRKHWIKLITMPVLLGAT  654

Query  2025  SNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG  2204
              NMPPATAVN+T+W+++GF SG++ +RY   LW RHNYVLSGALDAGLAFM V+LYLCLG
Sbjct  655   VNMPPATAVNFTSWVLIGFASGFIAYRYYRGLWSRHNYVLSGALDAGLAFMAVILYLCLG  714

Query  2205  LENVSLNWWGNDLDGCPYASCPSA  2276
             +E+VS  WWG+  DGC  AS  +A
Sbjct  715   MEHVSFKWWGSSPDGCTLASSSTA  738



>ref|XP_002529653.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32740.1| Oligopeptide transporter, putative [Ricinus communis]
Length=763

 Score =  1083 bits (2802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/730 (73%), Positives = 620/730 (85%), Gaps = 2/730 (0%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             S S S   +L +   EENSPI +VALTVP TDDP LP +TFR W LGTL+C+LLSFLNQF
Sbjct  31    SPSVSATSALDDVNSEENSPIEQVALTVPITDDPMLPAVTFRTWTLGTLACILLSFLNQF  90

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYR EPL IT+I AQIAV+PLG LMA+ ITD+VFFRGTK EFTLNPGPFNVKEHVLITI
Sbjct  91    FWYRREPLAITSIFAQIAVLPLGHLMASAITDKVFFRGTKLEFTLNPGPFNVKEHVLITI  150

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAG VYAIH+V+AVK+FY K ++F V+L++V+TTQVLGFGWAG+FRRYLVEPAAMW
Sbjct  151   FANSGAGNVYAIHIVSAVKIFYKKELSFLVALLVVITTQVLGFGWAGVFRRYLVEPAAMW  210

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP NLVQVSLFRALHEKEER KG +TR QFF+ AFICSFAYYVFPGY+   LTS+SWIC 
Sbjct  211   WPQNLVQVSLFRALHEKEERHKGRLTRNQFFIAAFICSFAYYVFPGYIIPKLTSVSWICL  270

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
              FP S+LA QLGSGL GLGIGAIG DW++ SSYLGSPLASPWFATAN+A GF LI+YV T
Sbjct  271   IFPASILAHQLGSGLHGLGIGAIGFDWATTSSYLGSPLASPWFATANVAAGFALIMYVIT  330

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             PI Y  +++ A TFPIFSD LFTSSG+ YN+SAIID  FH+D++AY+++G LYLST FA+
Sbjct  331   PIAYCLNIYKANTFPIFSDGLFTSSGRRYNVSAIIDPKFHIDMDAYNRQGPLYLSTNFAM  390

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILV  1379
              YG+ FA +TAT+VHV LFHGR+IW+ SKS+F+++KMD+HT+LM KY+ VPEWWF CIL+
Sbjct  391   IYGLNFACMTATIVHVFLFHGRDIWQLSKSAFQEKKMDVHTKLMRKYKPVPEWWFLCILL  450

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NI+ T+F C+YY  QLQLPWWGVLLAC +A++FTLP+G+ITA TNQTPGLN+ITEYIIG
Sbjct  451   LNISATIFTCQYYNAQLQLPWWGVLLACSLALLFTLPVGVITATTNQTPGLNVITEYIIG  510

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y+YPG+PVAN+CFKVYGYISM Q I FL DFKLGHYMKIPPR MFMAQVVGTVIA  V+L
Sbjct  511   YLYPGFPVANICFKVYGYISMKQGITFLHDFKLGHYMKIPPRAMFMAQVVGTVIAALVHL  570

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
              TAWWLMET+P IC+       + WTCP DHVFYDASVIWGLIGPRRIFGD G Y A+NW
Sbjct  571   ATAWWLMETVPNICERELLPKGSPWTCPGDHVFYDASVIWGLIGPRRIFGDRGHYSAINW  630

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFLAGAIAPVLVWLA K FP + WIRLI+MPVL+ AT NM PATAVNYTTW++VGF SG+
Sbjct  631   FFLAGAIAPVLVWLAHKTFPDKHWIRLISMPVLLGATLNMLPATAVNYTTWVLVGFASGF  690

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
             + +RY  D W RHNYVLSGALD GLAFM VLLYL LG+++VSL+WWGND DGCP ASCP+
Sbjct  691   IAYRYYRDWWSRHNYVLSGALDGGLAFMAVLLYLSLGMQHVSLDWWGNDSDGCPLASCPT  750

Query  2274  AKGIIVEGCP  2303
             A G++V GCP
Sbjct  751   APGVVVNGCP  760



>ref|XP_010317692.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=750

 Score =  1083 bits (2800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/755 (72%), Positives = 640/755 (85%), Gaps = 9/755 (1%)
 Frame = +3

Query  48    VSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSL  227
             +  +EI  PL+ K ++ E        S +  + +  +++ ENSPI +VALTVP TD  +L
Sbjct  2     IETEEISAPLIDKQKQKE-------ISSNYSDDVSSSSQSENSPIEQVALTVPITDVSTL  54

Query  228   PVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFF  407
             PV+TFRMW+LGTL+C+LLSFLNQFFW+R EPL+I +ISAQIAVVPLG LMA  I +RVFF
Sbjct  55    PVVTFRMWILGTLACILLSFLNQFFWFRREPLSIGSISAQIAVVPLGHLMAMAIPNRVFF  114

Query  408   RGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVL  587
             +G K+EFT+NPGPFNVKEHVLITIFANSGAG  YAIH+V+AVKVFY + +TF+VSLI+VL
Sbjct  115   KGRKFEFTMNPGPFNVKEHVLITIFANSGAGNPYAIHIVSAVKVFYKRTLTFWVSLIVVL  174

Query  588   TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFI  767
             TTQVLGFGWAG+FR+YLVEPAAMWWP NLVQVSLFRALHEKEER K  +TR QFF+IAF+
Sbjct  175   TTQVLGFGWAGLFRKYLVEPAAMWWPHNLVQVSLFRALHEKEERAKNELTRNQFFLIAFL  234

Query  768   CSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGS  947
             CSFAYYVFPGYLF ML+SLSW+CW FP SVLAQQLGSGL GLG+GAIGLDWSSISSYLGS
Sbjct  235   CSFAYYVFPGYLFPMLSSLSWLCWIFPASVLAQQLGSGLHGLGMGAIGLDWSSISSYLGS  294

Query  948   PLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIID  1127
             PLASPWFATANIA G+FLI+YV TPI YW +V+ AKTFPIFSD LFTS GQTYNISAIID
Sbjct  295   PLASPWFATANIAAGYFLIMYVVTPIMYWSNVYKAKTFPIFSDGLFTSDGQTYNISAIID  354

Query  1128  SNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRK  1307
              NFH+D  AYD EG LYLSTFF++TY   FA L+AT+VHV LFHGR++W+ SKS+F+++K
Sbjct  355   QNFHIDFNAYDHEGPLYLSTFFSMTYAFSFACLSATVVHVFLFHGRDLWQLSKSAFQEKK  414

Query  1308  MDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTL  1487
             MDIHT+LM KY+QVPEWWF  IL+ NIA TVF CEYYK QLQLPWWGVLLAC +A  FTL
Sbjct  415   MDIHTKLMRKYKQVPEWWFLSILLVNIAATVFICEYYKTQLQLPWWGVLLACGLAFFFTL  474

Query  1488  PIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHY  1667
             P+G+ITA TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM Q + FLQD KLGHY
Sbjct  475   PVGVITATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMKQGLTFLQDLKLGHY  534

Query  1668  MKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDA  1841
             MKIPPR MFMAQV GT+I+  V+LGTAWWL++T+P+IC        + WTCP DHVFYDA
Sbjct  535   MKIPPRAMFMAQVAGTLISALVHLGTAWWLIDTVPDICDRALLPPGSPWTCPGDHVFYDA  594

Query  1842  SVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISA  2021
             SVIWGLIGP+RIFG+LG Y A+NW FL GAIAPV+VW+A K FP Q+WIRLI +PVL++ 
Sbjct  595   SVIWGLIGPQRIFGNLGHYSALNWSFLFGAIAPVIVWIAHKTFPSQQWIRLITVPVLLAG  654

Query  2022  TSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCL  2201
               NMPPAT+VNY +WII+ FLSG+VV+RY   LW RHNYVLSGALDAGLAFMGVLLYLCL
Sbjct  655   IINMPPATSVNYNSWIIIAFLSGFVVYRYNQKLWSRHNYVLSGALDAGLAFMGVLLYLCL  714

Query  2202  GLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             G+E+V LNWWG+D D CP A CP+A+G++V+GCPV
Sbjct  715   GMEHVRLNWWGSDADQCPLAKCPTAEGVVVKGCPV  749



>ref|XP_004287803.1| PREDICTED: oligopeptide transporter 7-like [Fragaria vesca subsp. 
vesca]
Length=747

 Score =  1082 bits (2797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/752 (71%), Positives = 634/752 (84%), Gaps = 12/752 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI  PLL     +   H  AS S    E+    + EENSPI +VALTVP TDDPSLP +T
Sbjct  6     EITAPLL-----HNKNH--ASVSSPSPENF---SGEENSPIEQVALTVPITDDPSLPAVT  55

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FR W LG+L+C+LLSFLNQFFWYR EPL++T+ISAQIAVVPLG LMA+ +TDRVFF+G +
Sbjct  56    FRTWTLGSLACILLSFLNQFFWYRREPLSLTSISAQIAVVPLGHLMASVVTDRVFFKGRR  115

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPGPFNVKEHVLITIFANSGAG VYAIH+V+ +KVFYGK ++F+V+L++VLTTQV
Sbjct  116   WEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSTIKVFYGKDMSFWVALLVVLTTQV  175

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKEERP+GG+TR QFF+IAF CSFA
Sbjct  176   LGFGWAGLFRRYLVEPAAMWWPHNLVQVSLFRALHEKEERPRGGLTRNQFFLIAFTCSFA  235

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYLF ML+S+SW+CW FP SVL  QLGSGL GLGIGAIGLDWSSISSYLGSPLAS
Sbjct  236   YYVFPGYLFPMLSSISWVCWIFPASVLVHQLGSGLHGLGIGAIGLDWSSISSYLGSPLAS  295

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+AVGF L++YV TP+ YW +V+ A+TFPIFSD LFTS+GQ+YNISAIID NF 
Sbjct  296   PWFATANVAVGFVLVMYVITPVAYWLNVYKARTFPIFSDGLFTSTGQSYNISAIIDPNFR  355

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
             LD++AY++EG L++STFFA+ YGV FA LTAT+VHV+LF+GR+IWE SKS+F+++K D+H
Sbjct  356   LDIDAYEREGPLHISTFFAINYGVNFACLTATVVHVLLFNGRDIWELSKSAFQEKKADVH  415

Query  1320  TRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGI  1499
             T LM +Y+QVP WWF CILVANIA T+F C YY +QLQL WWGVLLAC +A+ FTLP+G+
Sbjct  416   TNLMRRYKQVPGWWFICILVANIAATMFTCHYYNDQLQLQWWGVLLACGLALFFTLPVGV  475

Query  1500  ITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIP  1679
             I A TNQ P LN+ITEYIIGY+YPGYP AN+ FKVYG+ISM Q I FL+DFKLGHYMKI 
Sbjct  476   IYATTNQMPALNVITEYIIGYLYPGYPAANILFKVYGHISMKQGITFLEDFKLGHYMKIA  535

Query  1680  PRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIW  1853
             PR MFMAQ+ GT+IA  V+LGTAWWLM TIP+IC       ++ WTCP DHVFYDASVIW
Sbjct  536   PRAMFMAQIAGTIIAALVHLGTAWWLMSTIPDICDRALLPADSPWTCPGDHVFYDASVIW  595

Query  1854  GLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNM  2033
             GL+GPRRIFGDLG Y A+NWFFLAGAIAP LVWLA KAFP ++WIRLI MPVL+    NM
Sbjct  596   GLVGPRRIFGDLGYYSAINWFFLAGAIAPALVWLAHKAFPTKQWIRLITMPVLLGTVVNM  655

Query  2034  PPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLEN  2213
             PPATAVN+T+WI++GF SG+V +RY    W RHNYVLSGALDAGLAFM V+LYLCLG+ +
Sbjct  656   PPATAVNFTSWILIGFASGFVAYRYYRSWWSRHNYVLSGALDAGLAFMAVILYLCLGMHH  715

Query  2214  VSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             V L WWG+  DGCP ASCP+  G++++GCP++
Sbjct  716   VHLKWWGSSPDGCPLASCPTEPGVLIKGCPLL  747



>ref|XP_011008821.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=750

 Score =  1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/751 (72%), Positives = 633/751 (84%), Gaps = 9/751 (1%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             +EI TPL+        +H   +SS     S   A  EENSPI +VALTVPTT DP+LP +
Sbjct  5     EEITTPLI-------HQHNKQTSSSVANSSSTSADSEENSPIVQVALTVPTTGDPTLPAV  57

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFR W LG+L+C+LLSFLNQFFWYR EPL+IT+I AQIAVVPLG LMA+ IT++ FF G 
Sbjct  58    TFRTWTLGSLACILLSFLNQFFWYRREPLSITSICAQIAVVPLGHLMASTITNKTFFMGK  117

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             KWEFTLNPGPFNVKEHVLITIFANSGAG VYAIH+V+AVK+FY K +TFFV+L++V+TTQ
Sbjct  118   KWEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSAVKLFYKKELTFFVALLVVITTQ  177

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             +LGFGWAG+FRRYLVEPA+MWWP NLVQVSLFRALHEKEER K G+TR QFF+IAFICSF
Sbjct  178   MLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFRALHEKEERHKDGLTRNQFFIIAFICSF  237

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYY FPGYLF  LTS+SW+CW FP S+LA QLGSGL GLGIGA G DW++ISSYLGSPLA
Sbjct  238   AYYAFPGYLFPKLTSISWLCWIFPSSLLAHQLGSGLHGLGIGAFGFDWATISSYLGSPLA  297

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SPWFATAN+A GF L++YV  PI YW +++ AK FPIFSD LFTS+GQ+YNISAIID  F
Sbjct  298   SPWFATANVAAGFVLLMYVIAPIAYWLNIYEAKNFPIFSDGLFTSTGQSYNISAIIDPKF  357

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             H+DL+AYD++G LYLST FA+ YG+ FA LTAT+VHV LFHGR+IW+ SKS+F+ +KMD+
Sbjct  358   HIDLDAYDRQGPLYLSTIFAMIYGLNFACLTATVVHVFLFHGRDIWQLSKSAFRYKKMDV  417

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM KY QVPEWWF CIL  NIA T+F CEYY EQLQLPWWGVLLAC IA+ FTLP+G
Sbjct  418   HTKLMRKYNQVPEWWFLCILFLNIAATIFTCEYYNEQLQLPWWGVLLACGIAVFFTLPVG  477

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             +ITA TN+TPGLN+ITEY+IGY+YPG+PVAN+CFKVYGYISM Q I FL+DFKLGHYMKI
Sbjct  478   VITATTNKTPGLNVITEYVIGYMYPGFPVANICFKVYGYISMKQGITFLEDFKLGHYMKI  537

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDASVI  1850
             PPR MFMAQVVGT+I+  V+LGTAWWLMETIP IC  +  +  + WTCP DH+FYDASVI
Sbjct  538   PPRAMFMAQVVGTIISALVHLGTAWWLMETIPNICDRELLSPGSPWTCPGDHLFYDASVI  597

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRR+FGDLG Y A NWFFL GAIAP+LVWLA KAFP ++WI LI++PVL+SAT N
Sbjct  598   WGLIGPRRVFGDLGRYSATNWFFLGGAIAPILVWLAHKAFPNKDWIGLISIPVLLSATLN  657

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             + PATAVNYTTW++VGF SG++ +RY  D W RHNYVLSGALDAGLAFM VLLYL LG+ 
Sbjct  658   LLPATAVNYTTWVVVGFASGFIAYRYYRDWWSRHNYVLSGALDAGLAFMAVLLYLSLGMW  717

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             +VSL WWG++ +GCP ASCP+A G+ V+GCP
Sbjct  718   HVSLEWWGSEAEGCPLASCPTAPGVTVKGCP  748



>emb|CDP01884.1| unnamed protein product [Coffea canephora]
Length=762

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/758 (71%), Positives = 638/758 (84%), Gaps = 3/758 (0%)
 Frame = +3

Query  42    MEVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDP  221
             M   A+EI  PLL   +  E     AS S +   S  E   +ENSP+ +VALTVP TDD 
Sbjct  1     MRKDAEEISAPLLTTEKRAEPYKDHASGSGTSSPSC-EPFGDENSPVEQVALTVPVTDDR  59

Query  222   SLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRV  401
             +LPV+TFRMWVLG L+C++LSFLNQFFW+R EPL+I++ISAQIAVVPLG LMA+ +T RV
Sbjct  60    TLPVVTFRMWVLGALACIVLSFLNQFFWFRREPLSISSISAQIAVVPLGHLMASALTSRV  119

Query  402   FFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLII  581
             FF+G KWEFTLNPGPFN+KEHVLITIFANSGA   Y+IH+V+AVKVFY + +TF+V+L++
Sbjct  120   FFKGQKWEFTLNPGPFNMKEHVLITIFANSGAANPYSIHIVSAVKVFYRQRLTFWVALVV  179

Query  582   VLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIA  761
             V+TTQVLGFGWAGI RRYLVEPA MWWP NLVQVSLFRAL EKE+R KG ++R QFF+IA
Sbjct  180   VITTQVLGFGWAGILRRYLVEPAEMWWPQNLVQVSLFRALDEKEQRIKGRLSRNQFFLIA  239

Query  762   FICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYL  941
             FICSFAYYV PGYLF MLTSLSWICW FP SVLAQQLGSGL GLGIGAIGLDWSSISSY+
Sbjct  240   FICSFAYYVLPGYLFPMLTSLSWICWIFPNSVLAQQLGSGLHGLGIGAIGLDWSSISSYI  299

Query  942   GSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAI  1121
             GSPLASPWFATAN+AVG+FL++YV TPI YW +++ AKTFPI+SD LFTS GQ YNISAI
Sbjct  300   GSPLASPWFATANLAVGYFLMMYVITPIAYWFNIYKAKTFPIYSDGLFTSKGQNYNISAI  359

Query  1122  IDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD  1301
             IDSNFH+DL AY+ EG+LY+STFFA+TYG  FA LTAT+VHV LFHGR++W  SKS+F++
Sbjct  360   IDSNFHIDLTAYENEGRLYISTFFAITYGFSFACLTATVVHVFLFHGRDLWRLSKSAFQE  419

Query  1302  RKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             +K+D+HT+LM  Y+QVPEWWF CIL+ NIA T+F CEYY +QLQLPWW VLLAC +A  F
Sbjct  420   KKLDVHTKLMRMYKQVPEWWFTCILLVNIAATIFICEYYNDQLQLPWWAVLLACGLAFFF  479

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIG+ITA TNQTPGLN+ITEYIIGY+YPGYPVANM FKVYGYISM QA+AFLQDFKLG
Sbjct  480   TLPIGVITATTNQTPGLNVITEYIIGYLYPGYPVANMSFKVYGYISMKQALAFLQDFKLG  539

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFY  1835
             HYMKIPPR MFMAQV GT+++  V+LGTAWWL+ET+P+IC        + WTCP DHVFY
Sbjct  540   HYMKIPPRDMFMAQVAGTLVSALVHLGTAWWLLETVPDICDRAMLPPGSPWTCPGDHVFY  599

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLIGP+RIFGDLG Y A+NW F+ GA+AP +VWL  KAFP Q+WI LI++PV++
Sbjct  600   DASVIWGLIGPQRIFGDLGYYSAINWAFVLGAVAPAVVWLMHKAFPNQQWIGLISVPVVL  659

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
             +   NMPPATAVNY +W+I+ FLSG++ +RY    W RHNYVLSGALDAGLAFMGVLLYL
Sbjct  660   AGIMNMPPATAVNYNSWVIIAFLSGFIAYRYYRSWWSRHNYVLSGALDAGLAFMGVLLYL  719

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
              L + +VSL+WWG+  DGCP ASCP+A+G++V+GCPV+
Sbjct  720   ALDIGHVSLDWWGSKADGCPLASCPTAEGVVVQGCPVL  757



>ref|XP_007204095.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
 gb|EMJ05294.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
Length=713

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/709 (76%), Positives = 617/709 (87%), Gaps = 3/709 (0%)
 Frame = +3

Query  147   LPEA-AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL  323
             +PE  + +ENSPI +VALTVP TDDPSLP +TFR W LG L+CVLLSFLNQFFWYR EPL
Sbjct  1     MPEDFSGDENSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLNQFFWYRREPL  60

Query  324   TITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGT  503
             ++T+ISAQIAVVPLG LMA+ IT RVFF+G KWEFTLNPGPFNVKEHVLITIFANSGAG 
Sbjct  61    SLTSISAQIAVVPLGHLMASLITKRVFFKGQKWEFTLNPGPFNVKEHVLITIFANSGAGN  120

Query  504   VYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQV  683
             VYAIH+V+ VK+FY K+++FFV+L++VLTTQVLGFGWAG+FRRYLVEPAAMWWP NLVQV
Sbjct  121   VYAIHIVSTVKLFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQV  180

Query  684   SLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVla  863
             SLFRALHEKE+RPKGG+TR QFF+IAF CSFAYYV PGYLF MLTSLSWICW FP S+LA
Sbjct  181   SLFRALHEKEKRPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFPTSILA  240

Query  864   qqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDV  1043
              QLGSGL GLGIGAIGLDWSSISSYLGSPLASPWFATANI  GFFL+LYV TP+ YW ++
Sbjct  241   HQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANITAGFFLVLYVITPVAYWLNL  300

Query  1044  FNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAA  1223
             +NAKTFPI SD LFTS+GQ+YNISAIID NF LD++AY +EG L++STFFA+ YGV FA 
Sbjct  301   YNAKTFPIVSDGLFTSTGQSYNISAIIDPNFRLDIDAYGREGALHISTFFAMYYGVNFAC  360

Query  1224  LTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVF  1403
             LTAT+VHV+LF+GR+IW+ S S+ +++KMD+HT+LM KY+QVP WWF CILVANI  T+F
Sbjct  361   LTATIVHVLLFNGRDIWQLSTSAIREKKMDVHTKLMRKYKQVPGWWFMCILVANIVATMF  420

Query  1404  ACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypV  1583
              C YY +QLQL WWGVLLAC +A+ FTLPIG+I A TNQ P LN+ITEYIIGY+YPGYPV
Sbjct  421   TCHYYNDQLQLKWWGVLLACGLALFFTLPIGVIAATTNQKPALNVITEYIIGYLYPGYPV  480

Query  1584  ANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLME  1763
             AN+CFKVYGYISM Q IAFL+DFKLGHYMKIPPR MFMAQVVGT+IA FV+LGTAWWLM 
Sbjct  481   ANVCFKVYGYISMKQGIAFLEDFKLGHYMKIPPRAMFMAQVVGTIIAAFVHLGTAWWLMN  540

Query  1764  TIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIA  1937
             TIP+IC       ++ WTCP DHVFYDASVIWGL+GPRRIFGDLG Y A+NWFFLAGAIA
Sbjct  541   TIPDICDRALLPADSPWTCPGDHVFYDASVIWGLVGPRRIFGDLGHYSAINWFFLAGAIA  600

Query  1938  PVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPD  2117
             PVLVWLA KAFP + WI+LI MPVL+ AT NMPPATAVN+T+W+++GF SG++ +RY   
Sbjct  601   PVLVWLAHKAFPRKHWIKLITMPVLLGATVNMPPATAVNFTSWVLIGFASGFIAYRYYRG  660

Query  2118  LWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYAS  2264
             LW RHNYVLSGALDAGLAFM V+LYLCLG+E+VS  WWG+  DGCP AS
Sbjct  661   LWSRHNYVLSGALDAGLAFMAVILYLCLGMEHVSFKWWGSSPDGCPLAS  709



>ref|XP_008648099.1| PREDICTED: uncharacterized protein LOC100383021 isoform X1 [Zea 
mays]
 gb|AFW75350.1| hypothetical protein ZEAMMB73_111868 [Zea mays]
Length=769

 Score =  1078 bits (2788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/753 (71%), Positives = 634/753 (84%), Gaps = 15/753 (2%)
 Frame = +3

Query  90    EEYEGRHG--------FASSSK----SKVESLPEAAEEENSPIREVALTVPTTDDPSLPV  233
             EE++ RHG           SS+    S  E   EA ++  SPI +VALTVP  DDP+ P 
Sbjct  16    EEHD-RHGIQLITSPLLQPSSRRPHGSAEEKEAEAGDDNGSPIEQVALTVPAWDDPATPA  74

Query  234   LTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRG  413
             LTFR WVLGT SC  LSFLN FF YR EPLT+TA+SAQ+AV+P+G+LMAA + +R FFRG
Sbjct  75    LTFRTWVLGTASCAALSFLNAFFGYRKEPLTVTAVSAQVAVLPVGRLMAAALPERAFFRG  134

Query  414   TKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTT  593
                EFTLNPGPF+VKEHVLITIFAN+GAGTV+A ++VT+V+VFYG+H++F ++L+++LT+
Sbjct  135   RPCEFTLNPGPFSVKEHVLITIFANAGAGTVFAKNLVTSVRVFYGQHMSFLIALLLILTS  194

Query  594   QVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICS  773
             QV+GFGWAG+FRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KG +TR QFF +AFICS
Sbjct  195   QVMGFGWAGVFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRRKGSMTRNQFFTVAFICS  254

Query  774   FAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPL  953
             FAYY+FPGYLFQMLTSLSWICW FP SV+AQQLGSGL GLGIGA+GLDWSSISSYLGSPL
Sbjct  255   FAYYIFPGYLFQMLTSLSWICWVFPSSVIAQQLGSGLHGLGIGAVGLDWSSISSYLGSPL  314

Query  954   ASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSN  1133
             ASPWFATANIA  FF+++Y+ TPI YW +V+ A+ FPI+SD L+T +GQ YNIS+I+DS+
Sbjct  315   ASPWFATANIAAAFFIVVYIITPINYWFNVYKARNFPIYSDGLYTVAGQKYNISSIMDSH  374

Query  1134  FHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMD  1313
             F+ D +AY++ G LY+STFFA +YG+ FA LTAT+ HV+LFHG EIW+ SKS+F+D+KMD
Sbjct  375   FYFDTDAYEKSGPLYISTFFASSYGLSFACLTATVSHVLLFHGSEIWQLSKSAFEDKKMD  434

Query  1314  IHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPI  1493
             IHT+LM +YRQVPEWWF CILVA+++ T+  CEYY EQLQLPWWGVLLAC +AI +TLPI
Sbjct  435   IHTKLMRRYRQVPEWWFICILVASVSATMLTCEYYIEQLQLPWWGVLLACALAIFYTLPI  494

Query  1494  GIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMK  1673
             GI+ A TNQ PGLN+ITEYI+GY+YPG P+ANMCFKVYGY+   QA+ FLQDFKLGHYMK
Sbjct  495   GILKATTNQAPGLNVITEYIMGYLYPGRPMANMCFKVYGYVGPHQALEFLQDFKLGHYMK  554

Query  1674  IPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASV  1847
             IPPR MF AQVVGT+IAG VYLGT WWL++TIP++C T      + WTCP DHVFYDASV
Sbjct  555   IPPRAMFTAQVVGTLIAGSVYLGTIWWLLDTIPDVCNTELLPAGSPWTCPYDHVFYDASV  614

Query  1848  IWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATS  2027
             +WGLIGPRRIFGDLGTY AVNWFFL GAIAP+LVW   KAFP Q+WIR +N PVLI AT+
Sbjct  615   LWGLIGPRRIFGDLGTYSAVNWFFLGGAIAPLLVWCTHKAFPAQKWIRHVNAPVLIGATT  674

Query  2028  NMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGL  2207
              MPPATA NYTTWI+V FLSGYVV++YR + W+RHNY+LSGALDAGLAFM VLLYLCLGL
Sbjct  675   FMPPATAANYTTWILVAFLSGYVVYKYRRNWWERHNYLLSGALDAGLAFMAVLLYLCLGL  734

Query  2208  ENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             EN SLNWWGNDLDGCP ASCP+AKGI V+GCPV
Sbjct  735   ENKSLNWWGNDLDGCPLASCPTAKGITVDGCPV  767



>ref|XP_010040072.1| PREDICTED: oligopeptide transporter 7-like [Eucalyptus grandis]
 gb|KCW45503.1| hypothetical protein EUGRSUZ_L00780 [Eucalyptus grandis]
Length=761

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/719 (75%), Positives = 620/719 (86%), Gaps = 8/719 (1%)
 Frame = +3

Query  174   SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIA  353
             SPI +VALTVP  DDPSLPV+TFR +VLGTL+C LLSFLNQFFWYR EPL+++++SAQIA
Sbjct  42    SPIEQVALTVPEGDDPSLPVVTFRTFVLGTLACSLLSFLNQFFWYRREPLSVSSVSAQIA  101

Query  354   VVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAV  533
             VVPLG LMA  IT RVFF G+KW+FTLNPGPFNVKEHVLITIFANSGA TVYAIH+++ V
Sbjct  102   VVPLGHLMAGVITKRVFFEGSKWQFTLNPGPFNVKEHVLITIFANSGAATVYAIHIISVV  161

Query  534   KVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE  713
             K+FY K ++F V+L++VLTTQ+LGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE
Sbjct  162   KIFYRKEMSFLVALVVVLTTQILGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALHEKE  221

Query  714   ERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqgl  893
             +R KG +TR  FF+IAF+CSF+YYVFPGYLF MLTSLSWICW FP SV+AQQLGSGL GL
Sbjct  222   QRLKGRLTRNHFFLIAFVCSFSYYVFPGYLFPMLTSLSWICWIFPASVVAQQLGSGLHGL  281

Query  894   gigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFS  1073
             GIGAIGLDWSSISSYLGSPLASPWFATANIAVGF L++YV TP  YW +++ ++TFPIFS
Sbjct  282   GIGAIGLDWSSISSYLGSPLASPWFATANIAVGFALVVYVITPFTYWLNIYRSRTFPIFS  341

Query  1074  DELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVL  1253
             D LFTSSGQ YNI  IID +FHLD EA ++EG LYLSTFFA+ YG+ FA LTAT+VHV L
Sbjct  342   DSLFTSSGQKYNIETIIDEHFHLDAEACEREGPLYLSTFFAVYYGISFACLTATVVHVFL  401

Query  1254  FHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQ  1433
             FHG+EIW  SKS+  ++KMDIHT+LM +Y+QVPEWWF CIL+ NIA T+F C+Y+K+QLQ
Sbjct  402   FHGKEIWLLSKSALSEKKMDIHTKLMRRYKQVPEWWFTCILLVNIAATIFTCQYFKDQLQ  461

Query  1434  LPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGY  1613
             LPWWGVLLAC +A+ FTLP+G+ITA TNQTPGLN+ITE+IIGYIYPGYPVAN+ FKVYG+
Sbjct  462   LPWWGVLLACALALFFTLPVGVITATTNQTPGLNVITEFIIGYIYPGYPVANILFKVYGF  521

Query  1614  ISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QT  1787
             ISM Q I FLQDFKLGHYMKIPPR MFMAQVVGT++A  V+LGTAWWLM+T+P+IC  + 
Sbjct  522   ISMKQGITFLQDFKLGHYMKIPPRAMFMAQVVGTIVAALVHLGTAWWLMDTVPDICNREL  581

Query  1788  TATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKA  1967
                 + WTCP DHVFYDASVIWGLIGPRRIFGDLG Y A+NWFFL GAIAP +VWLA KA
Sbjct  582   LPAGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGHYSAINWFFLVGAIAPFIVWLARKA  641

Query  1968  FPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLS  2147
             FP +EWIRLI MPVL+ AT +MPPATAVNYT WII GFLSG++ +RY    W RHNYVLS
Sbjct  642   FPDKEWIRLITMPVLLGATLHMPPATAVNYTNWIIAGFLSGFIAYRYYQGWWSRHNYVLS  701

Query  2148  GALD------AGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             GALD      AGLAFM VLLYLCL +++VSL+WWG D DGCP ASCP+AKG++VEGCPV
Sbjct  702   GALDAGLAFMAGLAFMAVLLYLCLEMKHVSLSWWGEDPDGCPLASCPTAKGVVVEGCPV  760



>emb|CDY25261.1| BnaA02g21950D [Brassica napus]
Length=730

 Score =  1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/711 (75%), Positives = 614/711 (86%), Gaps = 33/711 (5%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSPIREVALTVPTTDD SLPVLTFRMW LG++SC+LLSFLNQFFWYR EPL I+AISAQI
Sbjct  50    NSPIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQI  109

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG+LMAA+ITDRVF +G+KWEFTLNPGPFNVKEHVLITIFAN+GAG+VYAIH++T 
Sbjct  110   AVVPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHIITV  169

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VK +Y K++TFFVS I+ +TTQVLGFGWAGIFR+YLVEPAAMWWPANLVQVSLFRALHEK
Sbjct  170   VKAYYMKNMTFFVSFIVKVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  229

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             EER KGG+TRTQFF+IAFICSFAYYVFPGYLFQMLTSLSW+CWFFP SV+AQQ+GSGL G
Sbjct  230   EERAKGGLTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWVCWFFPSSVMAQQIGSGLHG  289

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWS+ISSYLGSPLASPWFAT N+ VGF L +YV  PI YW DV+ AKTFP+F
Sbjct  290   LGIGAIGLDWSTISSYLGSPLASPWFATVNVGVGFVLAIYVLIPICYWLDVYKAKTFPLF  349

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             S  LFT+ G  YNI++IIDSNFHLDL+AY++EG LYL TFFA++YG+GFAAL++T++HV 
Sbjct  350   SSSLFTNEGSKYNIASIIDSNFHLDLQAYEREGPLYLCTFFAISYGIGFAALSSTIMHVA  409

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGREIWEQS  SFK++KMD+HTRLM +Y+QVPEWWFWCIL  NI +T+FACEYYK+QL
Sbjct  410   LFHGREIWEQSMDSFKEKKMDVHTRLMQRYKQVPEWWFWCILAINIGVTIFACEYYKDQL  469

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +AIIFTLPIGI+TAITNQ PGLNIITEYIIGYIYPGYPVANMCFKVYG
Sbjct  470   QLPWWGVLLACTVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVYG  529

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QA+ FL+DFKLGHYMKIPPR MFMAQ+VGT+++  VYL TAWW +ETIP+IC   
Sbjct  530   YISMKQAVLFLEDFKLGHYMKIPPRIMFMAQIVGTLLSCLVYLVTAWWQLETIPDICN--  587

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
              +N+VWTCP D VFYDASVIWGLIGP RIFGDLG Y++VNWFFL GAIAP+LV LA++ F
Sbjct  588   -SNSVWTCPHDKVFYDASVIWGLIGPHRIFGDLGLYKSVNWFFLVGAIAPILVLLASRMF  646

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P QEWI+L+NMP+LIS+   MP AT VNYT+W++ GF SG+VVFRYRP+LWQ        
Sbjct  647   PRQEWIKLVNMPILISSIRWMPSATTVNYTSWLLAGFFSGFVVFRYRPNLWQ--------  698

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
                                   S +WWGN+LDGCP ASCP+A GI+VEGCP
Sbjct  699   ----------------------SFDWWGNELDGCPLASCPTAAGIVVEGCP  727



>ref|XP_009773684.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Nicotiana 
sylvestris]
Length=736

 Score =  1070 bits (2767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/722 (73%), Positives = 616/722 (85%), Gaps = 2/722 (0%)
 Frame = +3

Query  147   LPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLT  326
             L ++ +++NSP+ +VALTVP TDDP+  V+TFRMWVLGT++C LLSFLNQFFWYR EPLT
Sbjct  14    LLQSEDDDNSPVEQVALTVPITDDPTFLVVTFRMWVLGTIACFLLSFLNQFFWYRREPLT  73

Query  327   ITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTV  506
             IT+IS QIAVV LG LMA  ITDRVFF+G+KWEFTLNPGPFNVKEHVLITIFANSGAG  
Sbjct  74    ITSISTQIAVVLLGHLMAKAITDRVFFKGSKWEFTLNPGPFNVKEHVLITIFANSGAGNP  133

Query  507   YAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVS  686
             YAIHVV+AVK+FY + ++F+V+LI+V+TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVS
Sbjct  134   YAIHVVSAVKLFYKQKLSFWVALIVVITTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVS  193

Query  687   LFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaq  866
             LFRA H+KEER K G+TR QFF+IAF+CSFAYYVFPGYLF +L+S+SW+CW FP SVL Q
Sbjct  194   LFRAHHDKEERTKNGLTRNQFFLIAFVCSFAYYVFPGYLFPVLSSISWLCWLFPSSVLGQ  253

Query  867   qlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVF  1046
             QLGSG+ GLGIGAIGLDWSSISSYLGSPLASPWFATANIAVG+FL+LYV TP+ YW +V+
Sbjct  254   QLGSGMHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFLLLYVVTPLMYWSNVY  313

Query  1047  NAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAAL  1226
              AK FPIFSD LF  +GQ YNIS+IID NFH+DLE Y+ EG+LYLS F +LTY   FA L
Sbjct  314   KAKNFPIFSDGLFKENGQDYNISSIIDQNFHIDLEKYEHEGRLYLSIFLSLTYAFSFACL  373

Query  1227  TATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFA  1406
             TAT+VHV LFHG+E+W+ SKS+ K++KMD+HT+LM KY+QVPEWWF  ILV NIA TVF 
Sbjct  374   TATVVHVFLFHGQELWQLSKSALKEKKMDVHTKLMRKYKQVPEWWFQIILVINIAATVFV  433

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
             CE YK QLQLPWWGVLLAC +A  FTLPIG+ITA TNQTPGLNIITEYI+GY+YPGYP A
Sbjct  434   CEIYKNQLQLPWWGVLLACGLAFFFTLPIGVITATTNQTPGLNIITEYIMGYLYPGYPAA  493

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             NMCFKVYGYISM Q + FLQD KLGHYMK PPR MFMAQVVGT+I+ F +LGTAWWLM+T
Sbjct  494   NMCFKVYGYISMKQGLTFLQDLKLGHYMKTPPRAMFMAQVVGTLISAFAHLGTAWWLMDT  553

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             +P IC       ++ WTCP+DHVFYDASVIWGLIG +RI+G+LG Y A N FFL GA+AP
Sbjct  554   VPNICDRALLPQDSPWTCPTDHVFYDASVIWGLIGSQRIYGNLGYYSATNCFFLLGAVAP  613

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
               VWL  KAFP  +WIRLI++PV+++    MPPATAVNY +WII+ F+SG+VV+RY  +L
Sbjct  614   AFVWLLQKAFPNHQWIRLISVPVVLAGIIKMPPATAVNYNSWIIIAFISGFVVYRYYKNL  673

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGC  2300
             W RHNYVLSGALDAGLAFMGVLLYLCLG ENVSL WWG+  D CP ASCP+A+GI V+GC
Sbjct  674   WSRHNYVLSGALDAGLAFMGVLLYLCLGQENVSLKWWGSHTDICPLASCPTAEGITVDGC  733

Query  2301  PV  2306
             P+
Sbjct  734   PI  735



>ref|XP_006425445.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
 ref|XP_006466961.1| PREDICTED: oligopeptide transporter 7-like [Citrus sinensis]
 gb|ESR38685.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
Length=751

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/744 (71%), Positives = 623/744 (84%), Gaps = 11/744 (1%)
 Frame = +3

Query  111   GFASSSKSKVESLP---------EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGT  263
             G  ++SKS   + P          + + ENSPI +VALTVPTTDDPSL   TFR   LG 
Sbjct  8     GAGTTSKSNEITAPLIEASSADDPSVDVENSPIEQVALTVPTTDDPSLQTFTFRTLTLGA  67

Query  264   LSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPG  443
             LSC+LLSFLNQFFWYR EPL+I++ISAQIAVVPLG LMA  +  +VFF G ++EFT NPG
Sbjct  68    LSCILLSFLNQFFWYRREPLSISSISAQIAVVPLGYLMAKTLPKKVFFEGRRFEFTFNPG  127

Query  444   PFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGI  623
             PF+VKEHVLITIFAN+GAG VYAIH+V+ +++FY K +TF V+L++V+TTQVLGFGWAG+
Sbjct  128   PFHVKEHVLITIFANAGAGNVYAIHIVSVLQLFYKKELTFLVALLVVITTQVLGFGWAGL  187

Query  624   FRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYL  803
             FRRYLV+P  MWWP NLVQVSLFRALHEKE+R  GG+TR QFF+IAF+CSFAYYVFPGYL
Sbjct  188   FRRYLVDPPTMWWPQNLVQVSLFRALHEKEKRSAGGLTRNQFFLIAFVCSFAYYVFPGYL  247

Query  804   FQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANI  983
             F ML S+SWICW +P SVLA QLGSGL GLGIGAIG DWSSIS+YLGSPLASPWFATANI
Sbjct  248   FPMLVSVSWICWIYPNSVLAHQLGSGLHGLGIGAIGFDWSSISAYLGSPLASPWFATANI  307

Query  984   AVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQ  1163
             A GFFLI+YV TPI YW ++F AKTFPIFSD LFTS+GQ YN+SAII++NF  D EAY++
Sbjct  308   AAGFFLIMYVITPIAYWLNIFKAKTFPIFSDGLFTSTGQNYNVSAIINNNFLFDTEAYER  367

Query  1164  EGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYR  1343
             EG LY+STFFA++YGVGFA LTAT+VHV+LFHGREIW+ SK++F+++ MD+HT+LM KY+
Sbjct  368   EGPLYISTFFAMSYGVGFACLTATVVHVLLFHGREIWQLSKAAFEEKGMDVHTKLMRKYK  427

Query  1344  QVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQT  1523
             QVPEWWF CIL+ NIA T+F C+YY  QLQLPWWGVLLACV+A+ FTLP+G+ITA TNQT
Sbjct  428   QVPEWWFTCILLINIAATIFTCQYYNNQLQLPWWGVLLACVLALFFTLPVGVITATTNQT  487

Query  1524  PGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQ  1703
             P LN+ITEYIIGYIYPG+P AN+CFKVYGYISM Q I FLQD KLGHYMKIPPR MFMAQ
Sbjct  488   PALNVITEYIIGYIYPGFPAANICFKVYGYISMKQGITFLQDLKLGHYMKIPPRAMFMAQ  547

Query  1704  VVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDASVIWGLIGPRRI  1877
             V GT+I+   +LGTAWWLM TIP+IC  +   + + WTCP DHVFYDAS+IWGLIGPRRI
Sbjct  548   VFGTIISALAHLGTAWWLMNTIPDICDREMLPSGSPWTCPGDHVFYDASIIWGLIGPRRI  607

Query  1878  FGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNY  2057
             FGDLG Y +VNWFF AGA+APVLVW+A KAFP + WIR I MPVL+ AT NMPPATAVNY
Sbjct  608   FGDLGYYSSVNWFFFAGAVAPVLVWIAHKAFPNRPWIRHITMPVLLGATVNMPPATAVNY  667

Query  2058  TTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN  2237
             T+WI++GF SG++ +RY  D W RHNYVLSGALDAGLAFMGVLLYLCLG+E++SLNW   
Sbjct  668   TSWILIGFASGFIAYRYYRDWWSRHNYVLSGALDAGLAFMGVLLYLCLGMEHISLNWLKM  727

Query  2238  DLDGCPYASCPSAKGIIVEGCPVI  2309
               DGCP ASCP+  G +V+GCPV+
Sbjct  728   QSDGCPLASCPTEPGTVVKGCPVL  751



>gb|EMS65129.1| Oligopeptide transporter 7 [Triticum urartu]
Length=798

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/736 (73%), Positives = 610/736 (83%), Gaps = 42/736 (6%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEE------ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLL  281
             ++  S +++ PE  ++      ENSPI +VALTVP  DDP  PVLTFRMWVLG  SC +L
Sbjct  94    ANRPSTLQNSPERHDDGHGRSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVL  153

Query  282   SFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKE  461
             SFLNQFFWYR EPLTITAISAQIAVVPLG+LMAA + +R F RG++WEFTLNPGPFNVKE
Sbjct  154   SFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGSRWEFTLNPGPFNVKE  213

Query  462   HVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLV  641
             HVLITIFAN+GAGTVYAIHVVTAV+VFYGK++TFFVSL++VLTTQVLGFGWAGIFRRYLV
Sbjct  214   HVLITIFANAGAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLV  273

Query  642   EPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             EPAAMWWP+NLVQVSLFRALHE E R KGG TR QFF++AF CSFAYY FPGYLFQMLTS
Sbjct  274   EPAAMWWPSNLVQVSLFRALHEDERRRKGGFTRNQFFLVAFACSFAYYAFPGYLFQMLTS  333

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             LSWICW FP SV AQQLGSGL GLGI AIGLDW+SISSYLGSPL SPWFAT N+A GFF+
Sbjct  334   LSWICWVFPNSVFAQQLGSGLHGLGIAAIGLDWASISSYLGSPLVSPWFATGNVAAGFFI  393

Query  1002  ILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             ++Y+  PI YW D + A+TFPIFS  LFTS GQ YNISAI+D NFHLD EAY++ G LYL
Sbjct  394   VMYIIVPIGYWFDFYKAQTFPIFSSGLFTSGGQKYNISAIVDDNFHLDTEAYEKNGPLYL  453

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             ST FA+TYG+GFA+LTAT+VHV+LFHGREI + S+S+F+ + +DIHT+LM +Y+QVPEWW
Sbjct  454   STLFAVTYGIGFASLTATIVHVLLFHGREILQLSRSAFQGKSVDIHTKLMRRYKQVPEWW  513

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F CILV NIA+TVFACEYY EQLQLPWWGVLLAC IA  FTLPIGIITA TNQTPGLNII
Sbjct  514   FICILVVNIAVTVFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNII  573

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEYIIGY+YPG PVANMCFK                                  VVGT I
Sbjct  574   TEYIIGYLYPGRPVANMCFK----------------------------------VVGTTI  599

Query  1722  AGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             A FVYLGTAWWLM+TIP IC  +  +  + WTCP DHVFYDASVIWGLIGPRRIFGDLGT
Sbjct  600   AAFVYLGTAWWLMDTIPNICDIELLSAGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGT  659

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y AVNWFFL GA+AP+LVWLA +AFPGQ WI LINMPV++ +   MPPATAVNYTTWI++
Sbjct  660   YAAVNWFFLGGAVAPLLVWLAHRAFPGQNWIVLINMPVMLGSIFQMPPATAVNYTTWILI  719

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCP  2255
             GFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLEN+SLNWWGNDLDGCP
Sbjct  720   GFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWGNDLDGCP  779

Query  2256  YASCPSAKGIIVEGCP  2303
              ASCP+AKGI+V+GCP
Sbjct  780   LASCPTAKGIVVKGCP  795



>ref|XP_010034698.1| PREDICTED: oligopeptide transporter 7-like [Eucalyptus grandis]
Length=750

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/715 (74%), Positives = 614/715 (86%), Gaps = 2/715 (0%)
 Frame = +3

Query  168   ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQ  347
             ENSP+ +VALTVPT DD SL  +TFR +VLG L+C LLSFLNQFFWYR EPL++T++SAQ
Sbjct  35    ENSPVEQVALTVPTGDDHSLRAVTFRTFVLGALACSLLSFLNQFFWYRREPLSVTSVSAQ  94

Query  348   IAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT  527
             IAVVPLG LMA  IT RVFF G +W+FTLNPGPFNVKEHVLITIFANSGA +VYAIH+++
Sbjct  95    IAVVPLGHLMAGVITRRVFFEGRRWQFTLNPGPFNVKEHVLITIFANSGASSVYAIHIIS  154

Query  528   AVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  707
              VK+FY K ++F V+L+IVLTTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHE
Sbjct  155   VVKIFYRKEMSFPVALVIVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHE  214

Query  708   KEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglq  887
             KE+RPKGG+ R  FF+IAFICSF+YYVFPGYLF MLTSLSWICW FP SVLAQQLGSGL 
Sbjct  215   KEQRPKGGLMRNHFFLIAFICSFSYYVFPGYLFPMLTSLSWICWLFPASVLAQQLGSGLH  274

Query  888   glgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPI  1067
             GLGIGA+GLDWSSIS+YLGSPLASPWFATANIAVGF L++YV TPI YW +++ AKTF +
Sbjct  275   GLGIGAVGLDWSSISAYLGSPLASPWFATANIAVGFALVMYVITPIAYWLNIYRAKTFSL  334

Query  1068  FSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHV  1247
             FSD LFTSSGQ YNISAII+ +F LD EAY++EG LYL T F++ YG+ FA LTAT+VH 
Sbjct  335   FSDSLFTSSGQEYNISAIINEHFQLDAEAYEREGPLYLCTVFSVYYGISFACLTATVVHG  394

Query  1248  VLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQ  1427
              LFHG+EIW  SKS+F ++KMDIHT+LM +Y+QVPEWWF CIL+ NI  T+F CEY+K+Q
Sbjct  395   FLFHGKEIWLLSKSAFSEKKMDIHTKLMRRYKQVPEWWFTCILLVNIVATIFICEYFKDQ  454

Query  1428  LQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVY  1607
             LQLPWWGVLLAC +AI FTLP+G+ITA TNQTP LN+ITE+IIGYIYPGYPVAN+ FKVY
Sbjct  455   LQLPWWGVLLACALAIFFTLPVGVITATTNQTPALNVITEFIIGYIYPGYPVANILFKVY  514

Query  1608  GYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQT  1787
             GYISM Q I FLQDFKLGHYMKIPPR MFMAQVVGT++A  V+L TAWWLM+T+P+IC  
Sbjct  515   GYISMKQGITFLQDFKLGHYMKIPPREMFMAQVVGTIVAALVHLRTAWWLMDTVPDICNR  574

Query  1788  T--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
                   + WTCP D VF+D SVIWGLIGPRRIFGDLG Y A+NWFFL GAIAP +VWLA 
Sbjct  575   ALLPAGSPWTCPGDTVFFDGSVIWGLIGPRRIFGDLGYYSAINWFFLVGAIAPFIVWLAH  634

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             KAFP +EWIRLI MPVL+ AT +MPPATAVNYT+WII GFLSG+V +RY    W RHNY 
Sbjct  635   KAFPDKEWIRLITMPVLLGATVSMPPATAVNYTSWIIAGFLSGFVAYRYYRGWWSRHNYA  694

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LSGALDAGLAFM VLLYLCLG+++VSL+WWG D DGCP A+CP+AKG++VEGCPV
Sbjct  695   LSGALDAGLAFMAVLLYLCLGMKHVSLSWWGEDPDGCPLAACPTAKGVVVEGCPV  749



>gb|EYU19483.1| hypothetical protein MIMGU_mgv1a023929mg [Erythranthe guttata]
Length=707

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/706 (75%), Positives = 607/706 (86%), Gaps = 2/706 (0%)
 Frame = +3

Query  195   LTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQL  374
             +TVP TDDP+LPV+TFRMW LG  +CVLLSFLNQFFWYR EPL+ITAISAQIAVVPLG L
Sbjct  1     MTVPPTDDPTLPVVTFRMWTLGAAACVLLSFLNQFFWYRREPLSITAISAQIAVVPLGHL  60

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MAA +T RVFF G +WEF LNPG FNVKEHVLITIFANSGA   Y+IH+V+AVK+FY + 
Sbjct  61    MAAALTRRVFFEGRRWEFCLNPGRFNVKEHVLITIFANSGAANPYSIHIVSAVKIFYKQR  120

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             +TF+V+L +VLTTQ+LGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE R KGG+
Sbjct  121   LTFWVALGVVLTTQILGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEVRAKGGV  180

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR QFF+IAF+CSF YYVFPGYLF  LTS+SW+CW F  SVL  QLGSGL GLG+GAIGL
Sbjct  181   TRNQFFLIAFLCSFTYYVFPGYLFPKLTSISWLCWIFSSSVLVHQLGSGLHGLGVGAIGL  240

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSISSYLGSPLASPWFATANIAVG+F+ +YV  P  YW +V+ AKTFPIFSD+LFTS+
Sbjct  241   DWSSISSYLGSPLASPWFATANIAVGYFVCVYVIAPTMYWLNVYEAKTFPIFSDDLFTSN  300

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAIIDSNFH+DL+AYD+EG+LYLSTFFA+TY   FA LTAT+VHV+LFHGR++W
Sbjct  301   GQKYNISAIIDSNFHIDLDAYDREGRLYLSTFFAMTYAFSFACLTATIVHVLLFHGRDLW  360

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
               SKS+FK++KMDIHT+LM  Y QVPEWWF CIL+ NIA T+  C +  +QLQLPWWGVL
Sbjct  361   MLSKSAFKEKKMDIHTKLMQNYNQVPEWWFLCILMINIAGTLLICHFQNDQLQLPWWGVL  420

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC +A +FTLP+G+I A TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM QA+
Sbjct  421   LACALAFVFTLPVGVIAATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMKQAL  480

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVW  1808
              FLQD KLGHYMKIPPR MFMAQVVGT+I+  V+LGTAWWLM+T+P IC  +   + + W
Sbjct  481   IFLQDLKLGHYMKIPPRAMFMAQVVGTLISSLVHLGTAWWLMDTVPNICDRSVLPSGSPW  540

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP DHVFYDASVIWGLIGP RIFGDLG Y A+NW FL GA+APVLVWLA KAFP Q+WI
Sbjct  541   TCPGDHVFYDASVIWGLIGPERIFGDLGYYSAINWSFLLGAVAPVLVWLAHKAFPNQQWI  600

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             RLI +PVL+ +  NMPPAT VNY +WII+GFLSGYV +RY  D W RHNYVLSGALDAGL
Sbjct  601   RLITVPVLLVSIINMPPATTVNYNSWIIIGFLSGYVAYRYYRDWWSRHNYVLSGALDAGL  660

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             AFMGVLLYLCL + +VSL WWG+  DGCP A+CP+AKGI+V+GCP+
Sbjct  661   AFMGVLLYLCLDMAHVSLEWWGSVSDGCPLATCPTAKGIVVKGCPI  706



>ref|XP_008440830.1| PREDICTED: oligopeptide transporter 7-like [Cucumis melo]
 ref|XP_008440831.1| PREDICTED: oligopeptide transporter 7-like [Cucumis melo]
Length=755

 Score =  1063 bits (2749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/717 (73%), Positives = 612/717 (85%), Gaps = 2/717 (0%)
 Frame = +3

Query  168   ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQ  347
             ENSP+ +VALTVP TDD SLP  TFR W+LG ++C LLSFLNQFF+YR EPL++T+ISAQ
Sbjct  39    ENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACALLSFLNQFFYYRKEPLSVTSISAQ  98

Query  348   IAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT  527
             IAVVP+G L+A+ +T+RVFF G KW+FTLNPGPFN KEHVLITIFANSGA TVYAIHVV+
Sbjct  99    IAVVPIGHLLASALTNRVFFEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHVVS  158

Query  528   AVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  707
             A+K+FY K +TFF++L++VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHE
Sbjct  159   AIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRALHE  218

Query  708   KEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglq  887
             KEERPKG ++R QFFVIAF CS AYYVFPGYLF MLTS+SW+CW FP S++AQQLGSGL+
Sbjct  219   KEERPKGKLSRNQFFVIAFTCSLAYYVFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSGLR  278

Query  888   glgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPI  1067
             GLGIGA G DWS+IS+YLGSPLASPWFATANIA GF ++ Y+ TP+ YW D+FNAKTFPI
Sbjct  279   GLGIGAFGFDWSTISAYLGSPLASPWFATANIAAGFAIVTYLVTPLAYWLDLFNAKTFPI  338

Query  1068  FSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHV  1247
             FSD LFTS+GQ YNISAIID +F LD++AY++EG L  STFFAL YGV FA L AT+VHV
Sbjct  339   FSDGLFTSAGQNYNISAIIDPHFRLDVDAYNREGPLRFSTFFALYYGVNFACLAATVVHV  398

Query  1248  VLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQ  1427
             +LFHGREIW  S+S+ +++ MD+HT+LM KY QVPE WF CILV NI+ T+F CEYY  Q
Sbjct  399   LLFHGREIWRLSRSALQEKLMDVHTKLMRKYDQVPESWFMCILVVNISATIFICEYYNNQ  458

Query  1428  LQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVY  1607
             LQLPWWGVLLAC +A+ FTLP+G+I A+TNQ P LN+ITE+IIGY+YPGYPVANMCFKVY
Sbjct  459   LQLPWWGVLLACGLAVFFTLPVGVIAALTNQAPSLNVITEFIIGYLYPGYPVANMCFKVY  518

Query  1608  GYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQ-  1784
             GYISM QAI FLQDFKLGHYMKIPPR MF+AQVVGTV++   +LGTAWWLM TIP IC  
Sbjct  519   GYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPNICDR  578

Query  1785  -TTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
              T    + WTCP DHVFYDASVIWGL+GPRRIFGD G Y ++NWFFLAGA++P+LVWLA 
Sbjct  579   ATLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGKYGSLNWFFLAGAVSPLLVWLAH  638

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             KAFP + WI+LI MPVL+ A  NMPPATAVNYT+WI++GF SG+V +R+    W RHNY+
Sbjct  639   KAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSRHNYL  698

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LSGALDAGLAFMGV LYLCLG++++SL WWG D D CP ASCP+A GI+V+ CPV Y
Sbjct  699   LSGALDAGLAFMGVFLYLCLGMQHISLQWWGGDSDACPLASCPTAPGIVVKDCPVHY  755



>gb|EYU30413.1| hypothetical protein MIMGU_mgv1a002159mg [Erythranthe guttata]
Length=707

 Score =  1063 bits (2748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/706 (74%), Positives = 608/706 (86%), Gaps = 2/706 (0%)
 Frame = +3

Query  195   LTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQL  374
             +TVP TDDP+LPV+TFRMW LG  +CVLLSFLNQFFWYR EPL+ITAISAQIAVVPLG L
Sbjct  1     MTVPPTDDPTLPVVTFRMWTLGAAACVLLSFLNQFFWYRREPLSITAISAQIAVVPLGHL  60

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MAA +T RVFF G +WEF LNPG FNVKEHVLITIFANSGA   Y+IH+V+AVK+FY + 
Sbjct  61    MAAALTRRVFFEGRRWEFCLNPGRFNVKEHVLITIFANSGAANPYSIHIVSAVKIFYKQR  120

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             +TF+V+L +VLTTQ+LGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE R KGG+
Sbjct  121   LTFWVALGVVLTTQILGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEVRAKGGV  180

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR QFF+IAF+CSF YYVFPGYLF  LTS+SW+CW F  SVL  QLGSGL GLG+GAIGL
Sbjct  181   TRNQFFLIAFLCSFTYYVFPGYLFPKLTSISWLCWIFSSSVLVHQLGSGLHGLGVGAIGL  240

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSISSYLGSPLASPWFATANIAVG+F+ +YV  P  YW +V+ AKTFPIFSD+LFTS+
Sbjct  241   DWSSISSYLGSPLASPWFATANIAVGYFVCVYVIAPTMYWLNVYEAKTFPIFSDDLFTSN  300

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAIIDSNFH+DL+AYD+EG+LYLSTFFA+TY   FA LTAT+VHV+LFHGR++W
Sbjct  301   GQKYNISAIIDSNFHIDLDAYDREGRLYLSTFFAMTYAFSFACLTATIVHVLLFHGRDLW  360

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
               SKS+FK++KMDIHT+LM  Y QVPEWWF CIL+ NIA T+  C +  +QLQLPWWGVL
Sbjct  361   MLSKSAFKEKKMDIHTKLMQNYNQVPEWWFLCILMINIAGTLLICHFQNDQLQLPWWGVL  420

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC +A +FTLP+G+I A TNQTPGLN+ITEYIIGY+YPGYPVANMCFKVYGYISM QA+
Sbjct  421   LACALAFVFTLPVGVIAATTNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMKQAL  480

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVW  1808
              FLQD KLGHYMKIPPR MFMAQVVGT+I+  V+LGTAWWLM+T+P IC  +   + + W
Sbjct  481   IFLQDLKLGHYMKIPPRAMFMAQVVGTLISSLVHLGTAWWLMDTVPNICDRSVLPSGSPW  540

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP DHVFYDASVIWGLIGP RIFGDLG Y A+NW FL GA+APVLVW+A KAFP Q+WI
Sbjct  541   TCPGDHVFYDASVIWGLIGPERIFGDLGYYSAINWSFLLGAVAPVLVWVAHKAFPNQQWI  600

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             RLI +PVL+ +  NMPPAT VNY +WII+GFLSGYV +RY  D W RHNYVLSGALDAGL
Sbjct  601   RLITVPVLLVSIINMPPATTVNYNSWIIIGFLSGYVAYRYYRDWWSRHNYVLSGALDAGL  660

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             AFMGVLLYLCL + ++SL+WWG+  DGCP A+CP+AKGI+V+GCP+
Sbjct  661   AFMGVLLYLCLDMAHISLDWWGSVSDGCPLATCPTAKGIVVKGCPI  706



>ref|XP_003519862.1| PREDICTED: oligopeptide transporter 7-like [Glycine max]
Length=747

 Score =  1061 bits (2743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/752 (71%), Positives = 625/752 (83%), Gaps = 14/752 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI +PL+        RH   +++ +   S P+  E  NSPI +VALTVP  DDPSLP  T
Sbjct  6     EINSPLI-------KRH--VNNADANTSSSPDGGE--NSPIEQVALTVPVGDDPSLPSFT  54

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FR W+LGTL+C LLSFLNQFF YR EPL++TAISAQIAVVP G LMAA +T RVF RGTK
Sbjct  55    FRTWILGTLACALLSFLNQFFGYRREPLSVTAISAQIAVVPAGHLMAAAVTRRVFMRGTK  114

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPG FNVKEHVLITIFA+SGA +VYAIH V+AVKVFY K +T   +L++V+TTQV
Sbjct  115   WEFTLNPGKFNVKEHVLITIFASSGAASVYAIHFVSAVKVFYRKELTVLAALLVVITTQV  174

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAG+FRRYLVEPA MWWP NLVQVSLFRALHE+E+RPKGG+TR QFF+IAF+CSFA
Sbjct  175   LGFGWAGVFRRYLVEPATMWWPQNLVQVSLFRALHEQEKRPKGGLTRNQFFLIAFLCSFA  234

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYL  MLTS+SWICW FP SV+A QLGSGL GLG+GAIG DWSSI SYLGSPLAS
Sbjct  235   YYVFPGYLIPMLTSISWICWVFPTSVIAHQLGSGLHGLGLGAIGFDWSSICSYLGSPLAS  294

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+A GF + +YV  PI YW +++ A++FPIFSD+LF S+GQ YNISAI DS FH
Sbjct  295   PWFATANVAAGFAIFMYVIMPIAYWTNLYKARSFPIFSDDLFMSNGQKYNISAITDSKFH  354

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
             LD+EAY++EG LYLST FA++YG+GFA L+ATLVHV+LFHG EIW  SKS+F++ K+DIH
Sbjct  355   LDMEAYEREGPLYLSTMFAMSYGIGFACLSATLVHVLLFHGSEIWRLSKSAFQENKIDIH  414

Query  1320  TRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             T++M K Y+QVPEWWF CIL+ NI  T+F CEY+  QLQLPWWGV+LAC++AI FTLP+G
Sbjct  415   TKIMRKHYKQVPEWWFLCILLFNITATIFICEYFNNQLQLPWWGVVLACIVAISFTLPVG  474

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             +I A TNQ P LNIITEYIIGYIYPGYPVA M FKVYG +SM QAI FLQDFKLGHYMKI
Sbjct  475   VIRATTNQAPALNIITEYIIGYIYPGYPVAIMLFKVYGNVSMKQAIFFLQDFKLGHYMKI  534

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PPR MF AQV+GT+I+  V+L TAWWLM T+P IC+       + WTCP DHVFYDASV+
Sbjct  535   PPREMFFAQVLGTLISAVVHLLTAWWLMNTVPNICERELLPAGSPWTCPGDHVFYDASVV  594

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRRIFGDLG Y A+NWFFLAGAIAP LVWLA KAFP ++WIRLI +PVL+ A ++
Sbjct  595   WGLIGPRRIFGDLGHYSAINWFFLAGAIAPFLVWLAHKAFPNKQWIRLITVPVLLGALAD  654

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYT+W++VGFLSG+VV+RY  D W RHNYVLSGALDAGLAFMGVLLYLCLG++
Sbjct  655   MPPATAVNYTSWVLVGFLSGFVVYRYYRDWWSRHNYVLSGALDAGLAFMGVLLYLCLGMK  714

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
              +SLNWWG+D DGCP ASCP++ G+  +GC V
Sbjct  715   QISLNWWGSDPDGCPLASCPTSPGVESKGCSV  746



>ref|XP_004135024.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=851

 Score =  1060 bits (2742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/717 (72%), Positives = 611/717 (85%), Gaps = 2/717 (0%)
 Frame = +3

Query  168   ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQ  347
             ENSP+ +VALTVP TDD SLP  TFR W+LG ++C+LLSFLNQFF+YR EPL +T+ISAQ
Sbjct  135   ENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACMLLSFLNQFFYYRKEPLPVTSISAQ  194

Query  348   IAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVT  527
             IAVVP+G  +A+ +T++VFF G KW+FTLNPGPFN KEHVLITIFANSGA TVYAIHVV+
Sbjct  195   IAVVPIGHFLASALTNKVFFEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHVVS  254

Query  528   AVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  707
             A+K+FY K +TFF++L++VLTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHE
Sbjct  255   AIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRALHE  314

Query  708   KEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglq  887
             KEERPKG ++R QFFV+AF CSF YY+FPGYLF MLTS+SW+CW FP S++AQQLGSGL+
Sbjct  315   KEERPKGKLSRNQFFVVAFTCSFGYYIFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSGLR  374

Query  888   glgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPI  1067
             GLGIGA G DWS+IS+YLGSPLASPWFAT N+A GF ++ Y+ TP+ YW D+FNAKTFPI
Sbjct  375   GLGIGAFGFDWSTISAYLGSPLASPWFATVNVAAGFAIVTYLGTPLAYWLDLFNAKTFPI  434

Query  1068  FSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHV  1247
             FSD LFTS+GQ YNISAIID NF LD++AY++EG L  STF AL YGV FA L AT+VHV
Sbjct  435   FSDGLFTSAGQNYNISAIIDPNFRLDVDAYNREGPLRFSTFLALYYGVNFACLAATIVHV  494

Query  1248  VLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQ  1427
             +LFHGR+IW  S+S+ +++ MD+HT+LM KY QVPE WF CILV NI++T+F CEYY  Q
Sbjct  495   LLFHGRDIWRLSRSALQEKLMDVHTKLMRKYDQVPESWFMCILVVNISVTIFICEYYNNQ  554

Query  1428  LQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVY  1607
             LQLPWWGVL+AC +A+ FTLP+G+ITA+TNQ P LN+ITE+IIGY+YPGYPVANMCFKVY
Sbjct  555   LQLPWWGVLIACGLAMFFTLPVGVITALTNQAPSLNVITEFIIGYLYPGYPVANMCFKVY  614

Query  1608  GYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQT  1787
             GYISM QAI FLQDFKLGHYMKIPPR MF+AQVVGTV++   +LGTAWWLM TIP IC  
Sbjct  615   GYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPNICDR  674

Query  1788  TA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLAT  1961
                   + WTCP DHVFYDASVIWGL+GPRRIFGD G Y ++NWFFLAGA++P+LVWLA 
Sbjct  675   AKLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGQYGSLNWFFLAGAVSPLLVWLAH  734

Query  1962  KAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYV  2141
             KAFP + WI+LI MPVL+ A  NMPPATAVNYT+WI++GF SG+V +R+    W RHNY+
Sbjct  735   KAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSRHNYL  794

Query  2142  LSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LSGALDAGLAFMGVLLYLCLG++++SL WWG D D CP ASCP+A G+IV+ CPV Y
Sbjct  795   LSGALDAGLAFMGVLLYLCLGMQHISLQWWGGDSDACPLASCPTAPGVIVKDCPVHY  851



>ref|XP_009773685.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Nicotiana 
sylvestris]
Length=722

 Score =  1058 bits (2737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/718 (73%), Positives = 609/718 (85%), Gaps = 2/718 (0%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
             +  + S +  VALTVP TDDP+  V+TFRMWVLGT++C LLSFLNQFFWYR EPLTIT+I
Sbjct  4     SNTQKSQLHFVALTVPITDDPTFLVVTFRMWVLGTIACFLLSFLNQFFWYRREPLTITSI  63

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             S QIAVV LG LMA  ITDRVFF+G+KWEFTLNPGPFNVKEHVLITIFANSGAG  YAIH
Sbjct  64    STQIAVVLLGHLMAKAITDRVFFKGSKWEFTLNPGPFNVKEHVLITIFANSGAGNPYAIH  123

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             VV+AVK+FY + ++F+V+LI+V+TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRA
Sbjct  124   VVSAVKLFYKQKLSFWVALIVVITTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRA  183

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
              H+KEER K G+TR QFF+IAF+CSFAYYVFPGYLF +L+S+SW+CW FP SVL QQLGS
Sbjct  184   HHDKEERTKNGLTRNQFFLIAFVCSFAYYVFPGYLFPVLSSISWLCWLFPSSVLGQQLGS  243

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             G+ GLGIGAIGLDWSSISSYLGSPLASPWFATANIAVG+FL+LYV TP+ YW +V+ AK 
Sbjct  244   GMHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFLLLYVVTPLMYWSNVYKAKN  303

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPIFSD LF  +GQ YNIS+IID NFH+DLE Y+ EG+LYLS F +LTY   FA LTAT+
Sbjct  304   FPIFSDGLFKENGQDYNISSIIDQNFHIDLEKYEHEGRLYLSIFLSLTYAFSFACLTATV  363

Query  1239  VHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYY  1418
             VHV LFHG+E+W+ SKS+ K++KMD+HT+LM KY+QVPEWWF  ILV NIA TVF CE Y
Sbjct  364   VHVFLFHGQELWQLSKSALKEKKMDVHTKLMRKYKQVPEWWFQIILVINIAATVFVCEIY  423

Query  1419  KEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCF  1598
             K QLQLPWWGVLLAC +A  FTLPIG+ITA TNQTPGLNIITEYI+GY+YPGYP ANMCF
Sbjct  424   KNQLQLPWWGVLLACGLAFFFTLPIGVITATTNQTPGLNIITEYIMGYLYPGYPAANMCF  483

Query  1599  KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEI  1778
             KVYGYISM Q + FLQD KLGHYMK PPR MFMAQVVGT+I+ F +LGTAWWLM+T+P I
Sbjct  484   KVYGYISMKQGLTFLQDLKLGHYMKTPPRAMFMAQVVGTLISAFAHLGTAWWLMDTVPNI  543

Query  1779  CQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
             C       ++ WTCP+DHVFYDASVIWGLIG +RI+G+LG Y A N FFL GA+AP  VW
Sbjct  544   CDRALLPQDSPWTCPTDHVFYDASVIWGLIGSQRIYGNLGYYSATNCFFLLGAVAPAFVW  603

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             L  KAFP  +WIRLI++PV+++    MPPATAVNY +WII+ F+SG+VV+RY  +LW RH
Sbjct  604   LLQKAFPNHQWIRLISVPVVLAGIIKMPPATAVNYNSWIIIAFISGFVVYRYYKNLWSRH  663

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             NYVLSGALDAGLAFMGVLLYLCLG ENVSL WWG+  D CP ASCP+A+GI V+GCP+
Sbjct  664   NYVLSGALDAGLAFMGVLLYLCLGQENVSLKWWGSHTDICPLASCPTAEGITVDGCPI  721



>ref|XP_004169608.1| PREDICTED: oligopeptide transporter 7-like, partial [Cucumis 
sativus]
Length=832

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/758 (69%), Positives = 628/758 (83%), Gaps = 3/758 (0%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E  AD+ +  L P ++E +     AS S S   S  +    ENSP+ +VALTVP TDD S
Sbjct  76    EKMADDHEI-LDPLIQEKQITQWRASGSTSVSSSSEDPYPVENSPVEQVALTVPVTDDTS  134

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LP  TFR W+LG ++C+LLSFLNQFF+YR EPL +T+ISAQIAVVP+G  +A+ +T++VF
Sbjct  135   LPTFTFRTWILGIIACMLLSFLNQFFYYRKEPLPVTSISAQIAVVPIGHFLASALTNKVF  194

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             F G KW+FTLNPGPFN KEHVLITIFANSGA TVYAIHVV+A+K+FY K +TFF++L++V
Sbjct  195   FEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHVVSAIKIFYKKELTFFLALLVV  254

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             LTTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKG ++R QFFV+AF
Sbjct  255   LTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERPKGKLSRNQFFVVAF  314

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
              CSF YY+FPGYLF MLTS+SW+CW FP S++AQQLGSGL+GLGIGA G DWS+IS+YLG
Sbjct  315   TCSFGYYIFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSGLRGLGIGAFGFDWSTISAYLG  374

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFAT N+A GF ++ Y+ TP+ YW D+FNAKTFPIFSD LFTS+GQ YNISAII
Sbjct  375   SPLASPWFATVNVAAGFAIVTYLGTPLAYWLDLFNAKTFPIFSDGLFTSAGQNYNISAII  434

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             D NF LD++AY++EG L  STF AL YGV FA L AT+VHV+LFHGR+IW  S+S+ +++
Sbjct  435   DPNFRLDVDAYNREGPLRFSTFLALYYGVNFACLAATIVHVLLFHGRDIWRLSRSALQEK  494

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
              MD+HT+LM KY QVPE WF CILV NI++T+F CEYY  QLQLPWWGVL+AC +A+ FT
Sbjct  495   LMDVHTKLMRKYDQVPESWFMCILVVNISVTIFICEYYNNQLQLPWWGVLIACGLAMFFT  554

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LP+G+ITA+TNQ P LN+ITE+IIGY+YPGYPVANMCFKVYGYISM QAI FLQDFKLGH
Sbjct  555   LPVGVITALTNQAPSLNVITEFIIGYLYPGYPVANMCFKVYGYISMKQAITFLQDFKLGH  614

Query  1665  YMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYD  1838
             YMKIPPR MF+AQVVGTV++   +LGTAWWLM TIP IC        + WTCP DHVFYD
Sbjct  615   YMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPNICDRAKLPAGSPWTCPGDHVFYD  674

Query  1839  ASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLIS  2018
             ASVIWGL+GPRRIFGD G Y ++NWFFLAGA++P+LVWLA KAFP + WI+LI MPVL+ 
Sbjct  675   ASVIWGLVGPRRIFGDQGQYGSLNWFFLAGAVSPLLVWLAHKAFPDKNWIKLITMPVLLG  734

Query  2019  ATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLC  2198
             A  NMPPATAVNYT+WI++GF SG+V +R+    W RHNY+LSGALDAGLAFMGVLLYLC
Sbjct  735   AVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSRHNYLLSGALDAGLAFMGVLLYLC  794

Query  2199  LGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             LG++++SL WWG D D CP ASCP+A G+IV+ CPV Y
Sbjct  795   LGMQHISLQWWGGDSDACPLASCPTAPGVIVKDCPVHY  832



>ref|XP_007156168.1| hypothetical protein PHAVU_003G263900g [Phaseolus vulgaris]
 gb|ESW28162.1| hypothetical protein PHAVU_003G263900g [Phaseolus vulgaris]
Length=748

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/752 (71%), Positives = 628/752 (84%), Gaps = 13/752 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI  PL+ +      RH   + + S+ E+ P A   ENSPI +VALTVP +DDPSLP  T
Sbjct  6     EINAPLIKR------RH-HNNDAISEAENSPAA---ENSPIEQVALTVPVSDDPSLPSFT  55

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FR W+LGTL+CVLLSFLNQFF ++ EPL++TAISAQIAVVP G LMAA +T RVF +GTK
Sbjct  56    FRTWILGTLACVLLSFLNQFFGFQREPLSVTAISAQIAVVPAGHLMAAAVTRRVFMKGTK  115

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPG FNVKEHVLITIFA+SGA +VYAI  V+AVK+FY K +T   +L++V+T+QV
Sbjct  116   WEFTLNPGKFNVKEHVLITIFASSGAASVYAIRFVSAVKLFYRKELTVLAALLVVITSQV  175

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAGIFR+YLVEPA MWWP NLVQVSLFRALHE+EER KG +TR QFF+IAF+CSFA
Sbjct  176   LGFGWAGIFRQYLVEPATMWWPQNLVQVSLFRALHEQEERRKGALTRNQFFLIAFLCSFA  235

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYLF MLTS+SWICW FP SV+A QLGSGL GLG+GA+G DWSSI SYLGSPLAS
Sbjct  236   YYVFPGYLFPMLTSISWICWMFPTSVIAHQLGSGLHGLGVGAVGFDWSSICSYLGSPLAS  295

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+AVGF + +Y   PI Y  +++NA+ FPIFSDELF S+GQ YNISAIIDSNFH
Sbjct  296   PWFATANVAVGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGQKYNISAIIDSNFH  355

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
             LD+EAY++EG LYLST FA++YG+GFA L+ATLVHV+LFHG EI   SKS+F++ K+DIH
Sbjct  356   LDMEAYEREGPLYLSTMFAMSYGIGFACLSATLVHVLLFHGSEILRLSKSAFQENKIDIH  415

Query  1320  TRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             T++M K Y+QVPEWWF CIL+ NI  T+F CEY+  +LQLPWWGV+LACV+A+ FTLPIG
Sbjct  416   TKIMRKNYKQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSFTLPIG  475

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             +I A TNQ P LNIITEYIIGYIYPGYPVANM FKVYG +SM QAI FLQDFKLGHYMKI
Sbjct  476   VIRATTNQAPALNIITEYIIGYIYPGYPVANMLFKVYGNVSMKQAIFFLQDFKLGHYMKI  535

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PPR MF+AQVVGT+++G V+L TAWWLM T+P IC+       + WTCP DHVFYDASVI
Sbjct  536   PPREMFLAQVVGTLMSGVVHLLTAWWLMNTVPNICERALLPAGSPWTCPGDHVFYDASVI  595

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRR FGDLG Y A+NWFFLAGAIAP LVWLA KA P ++WIRLI +PVL+ A S+
Sbjct  596   WGLIGPRRTFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLLGALSD  655

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYT+W+IVGF+SG+VV+RY    W RHNYVLSGALDAGLAFMGVLLYLCLG+E
Sbjct  656   MPPATAVNYTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALDAGLAFMGVLLYLCLGME  715

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ++SLNWWG+D DGCP ASCP+A G+  EGCP+
Sbjct  716   HISLNWWGSDSDGCPLASCPTAPGVESEGCPL  747



>gb|KGN48927.1| hypothetical protein Csa_6G506530 [Cucumis sativus]
Length=755

 Score =  1056 bits (2732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/748 (70%), Positives = 623/748 (83%), Gaps = 2/748 (0%)
 Frame = +3

Query  75    LLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWV  254
             L P ++E +     AS S S   S  +    ENSP+ +VALTVP TDD SLP  TFR W+
Sbjct  8     LDPLIQEKQITQWRASGSTSVSSSSEDPYPVENSPVEQVALTVPVTDDTSLPTFTFRTWI  67

Query  255   LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTL  434
             LG ++C+LLSFLNQFF+YR EPL +T+ISAQIAVVP+G  +A+ +T++VFF G KW+FTL
Sbjct  68    LGIIACMLLSFLNQFFYYRKEPLPVTSISAQIAVVPIGHFLASALTNKVFFEGKKWKFTL  127

Query  435   NPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGW  614
             NPGPFN KEHVLITIFANSGA TVYAIHVV+A+K+FY K +TFF++L++VLTTQVLGFGW
Sbjct  128   NPGPFNQKEHVLITIFANSGASTVYAIHVVSAIKIFYKKELTFFLALLVVLTTQVLGFGW  187

Query  615   AGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFP  794
             AGIFRRYLVEPAAMWWP NLVQVSLFRALHEKEERPKG ++R QFFV+AF CSF YY+FP
Sbjct  188   AGIFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERPKGKLSRNQFFVVAFTCSFGYYIFP  247

Query  795   GYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFAT  974
             GYLF MLTS+SW+CW FP S++AQQLGSGL+GLGIGA G DWS+IS+YLGSPLASPWFAT
Sbjct  248   GYLFPMLTSMSWLCWVFPTSIIAQQLGSGLRGLGIGAFGFDWSTISAYLGSPLASPWFAT  307

Query  975   ANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEA  1154
              N+A GF ++ Y+ TP+ YW D+FNAKTFPIFSD LFTS+GQ YNISAIID NF LD++A
Sbjct  308   VNVAAGFAIVTYLGTPLAYWLDLFNAKTFPIFSDGLFTSAGQNYNISAIIDPNFRLDVDA  367

Query  1155  YDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMS  1334
             Y++EG L  STF AL YGV FA L AT+VHV+LFHGR+IW  S+S+ +++ MD+HT+LM 
Sbjct  368   YNREGPLRFSTFLALYYGVNFACLAATIVHVLLFHGRDIWRLSRSALQEKLMDVHTKLMR  427

Query  1335  KYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAIT  1514
             KY QVPE WF CILV NI++T+F CEYY  QLQLPWWGVL+AC +A+ FTLP+G+ITA+T
Sbjct  428   KYDQVPESWFMCILVVNISVTIFICEYYNNQLQLPWWGVLIACGLAMFFTLPVGVITALT  487

Query  1515  NQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMF  1694
             NQ P LN+ITE+IIGY+YPGYPVANMCFKVYGYISM QAI FLQDFKLGHYMKIPPR MF
Sbjct  488   NQAPSLNVITEFIIGYLYPGYPVANMCFKVYGYISMKQAITFLQDFKLGHYMKIPPREMF  547

Query  1695  MAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGP  1868
             +AQVVGTV++   +LGTAWWLM TIP IC        + WTCP DHVFYDASVIWGL+GP
Sbjct  548   IAQVVGTVVSAVTHLGTAWWLMATIPNICDRAKLPAGSPWTCPGDHVFYDASVIWGLVGP  607

Query  1869  RRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATA  2048
             RRIFGD G Y ++NWFFLAGA++P+LVWLA KAFP + WI+LI MPVL+ A  NMPPATA
Sbjct  608   RRIFGDQGQYGSLNWFFLAGAVSPLLVWLAHKAFPDKNWIKLITMPVLLGAVVNMPPATA  667

Query  2049  VNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNW  2228
             VNYT+WI++GF SG+V +R+    W RHNY+LSGALDAGLAFMGVLLYLCLG++++SL W
Sbjct  668   VNYTSWIVIGFASGFVAYRHYRGWWSRHNYLLSGALDAGLAFMGVLLYLCLGMQHISLQW  727

Query  2229  WGNDLDGCPYASCPSAKGIIVEGCPVIY  2312
             WG D D CP ASCP+A G+IV+ CPV Y
Sbjct  728   WGGDSDACPLASCPTAPGVIVKDCPVHY  755



>ref|XP_007156167.1| hypothetical protein PHAVU_003G263800g [Phaseolus vulgaris]
 gb|ESW28161.1| hypothetical protein PHAVU_003G263800g [Phaseolus vulgaris]
Length=748

 Score =  1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/752 (71%), Positives = 621/752 (83%), Gaps = 13/752 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI +PL+ +      RH   S + S  E+ P A   ENSPI +VALTVP +DDPS P  T
Sbjct  6     EINSPLIKR------RH-HNSDAISVAENSPAA---ENSPIEQVALTVPVSDDPSRPSFT  55

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FR W+LGT++C LLSFLNQFF +R EPL++TAISAQIAVVP G LMAA +T RVF +GTK
Sbjct  56    FRTWILGTIACALLSFLNQFFGFRREPLSVTAISAQIAVVPAGHLMAAVVTRRVFMKGTK  115

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPG FNVKEHVLITIFA+SGA +VYAIH V+AVKVFY K +T   +L++V+T+QV
Sbjct  116   WEFTLNPGSFNVKEHVLITIFASSGAASVYAIHFVSAVKVFYQKDLTILAALLVVITSQV  175

Query  600   LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFA  779
             LGFGWAGIFR+YLVEPA MWWP NLVQVSLFRALHEKEER KG +TR QFF+IAF+CSFA
Sbjct  176   LGFGWAGIFRKYLVEPATMWWPQNLVQVSLFRALHEKEERRKGALTRNQFFLIAFLCSFA  235

Query  780   YYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLAS  959
             YYVFPGYLF  LTS+SWICW FP SV+A QLGSGL GLG+GAIG DWSSI SYLGSPLAS
Sbjct  236   YYVFPGYLFPSLTSISWICWMFPTSVIAHQLGSGLHGLGVGAIGFDWSSICSYLGSPLAS  295

Query  960   PWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFH  1139
             PWFATAN+A GF + +Y   PI Y  +++NA+ FPIFSDELF S+G+ YNISAIIDSNFH
Sbjct  296   PWFATANVAAGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGRKYNISAIIDSNFH  355

Query  1140  LDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIH  1319
             LD+EAY++EG LYLST FA++YG+GFA L+ATLVHV LFHG EI   SKS+F++ K+DIH
Sbjct  356   LDMEAYEREGPLYLSTMFAMSYGIGFACLSATLVHVSLFHGSEILRLSKSAFQENKIDIH  415

Query  1320  TRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             T++M K Y+QVPEWWF CIL+ NI  T+F CEY+  +LQLPWWGV+LACV+A+ FTLP+G
Sbjct  416   TKIMRKNYKQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSFTLPVG  475

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             +I A TNQ P LNIITEYIIGYIYPGYPVANM FKVYG +SM QAI FLQDFKLGHYMKI
Sbjct  476   VIRATTNQAPALNIITEYIIGYIYPGYPVANMLFKVYGNVSMKQAIFFLQDFKLGHYMKI  535

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
             PP  MF+AQVVGT+++G V+L TAWWLM T+P IC+       + WTCP DHVFYDASVI
Sbjct  536   PPTEMFLAQVVGTLMSGVVHLLTAWWLMNTVPNICERALLPAGSPWTCPGDHVFYDASVI  595

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLIGPRR FGDLG Y A+NWFFLAGAIAP LVWLA KA P ++WIRLI +PVL+ A S+
Sbjct  596   WGLIGPRRTFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLLGALSD  655

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYT+W+IVGF+SG+VV+RY    W RHNYVLSGALDAGLAFMGVLLYLCLG+E
Sbjct  656   MPPATAVNYTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALDAGLAFMGVLLYLCLGME  715

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ++SLNWWG D DGCP ASCP+A G+   GCP+
Sbjct  716   HISLNWWGTDSDGCPLASCPTAPGVESVGCPL  747



>dbj|BAJ95761.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =  1045 bits (2703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/682 (77%), Positives = 588/682 (86%), Gaps = 24/682 (4%)
 Frame = +3

Query  267   SCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGP  446
             SC +LSFLNQFFWYR EPLTITA                      FF G  +EFTLNPGP
Sbjct  3     SCAVLSFLNQFFWYRKEPLTITA----------------------FFPGRPYEFTLNPGP  40

Query  447   FNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIF  626
             FNVKEHVLITIFAN+GAGTVYAIHVVTAV+VFYGK++TFFVSL++VLTTQVLGFGWAGIF
Sbjct  41    FNVKEHVLITIFANAGAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIF  100

Query  627   RRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLF  806
             RRYLVEPA MWWP+NLVQVSLFRALHEKE R KGG TR+QFF++AF+CSF YY+FPGYLF
Sbjct  101   RRYLVEPATMWWPSNLVQVSLFRALHEKEVRSKGGFTRSQFFLVAFVCSFVYYIFPGYLF  160

Query  807   QMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIA  986
             QMLTSLSWICW FP SV AQQLGSGL GLGIG+IGLDW+S+SSYLGSPLASPWFATAN+A
Sbjct  161   QMLTSLSWICWVFPNSVFAQQLGSGLYGLGIGSIGLDWASVSSYLGSPLASPWFATANVA  220

Query  987   VGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQE  1166
              GFF+I+YV TPI YW + + A+ FPIFSD LFT SG  YNI++I+DS FH D +AY++ 
Sbjct  221   AGFFIIMYVITPIAYWFNFYKARNFPIFSDGLFTESGHKYNITSIVDSQFHFDTKAYEKN  280

Query  1167  GKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQ  1346
             G LYLSTFFA+TYG GFA+LTAT+VHV+LFHG EIW+ SKS+F+++++D+HT+LM +Y+Q
Sbjct  281   GPLYLSTFFAITYGAGFASLTATIVHVLLFHGSEIWQLSKSAFQEKRVDVHTKLMRRYKQ  340

Query  1347  VPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTP  1526
             VPEWWF CIL+ NIA+TVFACEYY EQLQLPWWGVLLAC IA  FTLPIGIITA TNQTP
Sbjct  341   VPEWWFICILIVNIAVTVFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTP  400

Query  1527  GLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQV  1706
             GLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMKIPPRTMFMAQV
Sbjct  401   GLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQV  460

Query  1707  VGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIF  1880
             VGT+IA FVYLGTAWWLM++IP IC T      + WTCP DHVFYDASVIWGLI PRRIF
Sbjct  461   VGTLIAAFVYLGTAWWLMDSIPNICNTELLPPGSPWTCPGDHVFYDASVIWGLISPRRIF  520

Query  1881  GDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYT  2060
             GDLGTY AVNWFFL GAIAP+LVW A KAFP Q WI LINMPVLI +T  MPPATAVNY 
Sbjct  521   GDLGTYSAVNWFFLGGAIAPLLVWFAHKAFPDQNWILLINMPVLIGSTGQMPPATAVNYI  580

Query  2061  TWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGND  2240
             TWI VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLEN+SLNWWGND
Sbjct  581   TWIFVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWGND  640

Query  2241  LDGCPYASCPSAKGIIVEGCPV  2306
             LDGCP ASCP+AKGI VEGCPV
Sbjct  641   LDGCPLASCPTAKGIFVEGCPV  662



>ref|XP_006340746.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=741

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/718 (73%), Positives = 615/718 (86%), Gaps = 2/718 (0%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
             + +++SP+ +VALTVP TDD +LPV+TFRMWVLG+++C LLSFLNQFFWYR+EPLTIT+I
Sbjct  23    STDDDSPVEQVALTVPITDDSTLPVVTFRMWVLGSIACFLLSFLNQFFWYRSEPLTITSI  82

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVPLG LMA  ITDRVFF+G+KWEFTLNPGPFNVKEHVLITIFANSGAG  YAIH
Sbjct  83    SAQIAVVPLGHLMAKGITDRVFFKGSKWEFTLNPGPFNVKEHVLITIFANSGAGNPYAIH  142

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             VV+AVK+FY + ++F+V+LI+++TTQVLGFGWAGIFRRYLVEPAAMWWP NLVQVS+FRA
Sbjct  143   VVSAVKLFYKQKLSFWVALIVIITTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSIFRA  202

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LH+KEER K G+TR QFF+IAFICSF YYVFPGYLF ML+SLSW+C  FP SVL QQLGS
Sbjct  203   LHDKEERAKNGMTRNQFFLIAFICSFGYYVFPGYLFPMLSSLSWLCLLFPSSVLVQQLGS  262

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             GL+GLG+GAIGLDWS+ISSYLGSPLASPWFATANIAVG+FLI+Y  TP+ YW +V+ A+ 
Sbjct  263   GLRGLGVGAIGLDWSTISSYLGSPLASPWFATANIAVGYFLIMYAVTPLMYWFNVYKARN  322

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPIFSD LF  +GQ YNIS IID NFH+DLE YD EG+LYLS    LTYG  FA LTAT+
Sbjct  323   FPIFSDGLFKENGQDYNISKIIDPNFHIDLEKYDHEGRLYLSIVLLLTYGFSFACLTATV  382

Query  1239  VHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYY  1418
             VHV LFHGR++W  SKS+ +++KMD+HT+LM KY+QVPEWWF  IL+  IA TVF CEYY
Sbjct  383   VHVFLFHGRDLWHLSKSALQEKKMDVHTKLMRKYKQVPEWWFTIILLIIIAATVFVCEYY  442

Query  1419  KEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCF  1598
             K QLQLPWWGVLLAC +A  FTLPIG+ITA TNQTPGLN+ITEYI+GY+YPGYPVANMCF
Sbjct  443   KNQLQLPWWGVLLACGLAFFFTLPIGVITATTNQTPGLNVITEYIMGYLYPGYPVANMCF  502

Query  1599  KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEI  1778
             KVYGYISM Q + FLQDFKLGHYMKIPPR MFMAQVVGT+I+ F +LGTAWWLM+++P I
Sbjct  503   KVYGYISMKQGLTFLQDFKLGHYMKIPPRAMFMAQVVGTLISAFAHLGTAWWLMDSVPNI  562

Query  1779  CQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
             C        + WTCP+DHVFYDASV+WGLIG +RIFG+LG Y A+NWFFL GA+APV VW
Sbjct  563   CDRALLPQGSPWTCPADHVFYDASVVWGLIGSQRIFGNLGYYSAINWFFLIGAVAPVFVW  622

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             L  KAFP  +WIRLI++PV+++    +PPATAVNY +WII+ F+SG+V +RY    W RH
Sbjct  623   LLQKAFPNHQWIRLISVPVVLAGIIKIPPATAVNYNSWIIIAFISGFVAYRYYKIWWSRH  682

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             NYVLSGALDAGLAFMGVLLYLCLG E+VSL WWG+  D CP ASCP+ KGI+V+GCP+
Sbjct  683   NYVLSGALDAGLAFMGVLLYLCLGQEHVSLQWWGSHTDTCPLASCPTVKGIVVDGCPI  740



>ref|XP_007156166.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
 gb|ESW28160.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
Length=753

 Score =  1038 bits (2685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/757 (70%), Positives = 622/757 (82%), Gaps = 18/757 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI  PL+ +      RH   + + S+ E  P A   ENSPI +VALTVP +DDPSLP  T
Sbjct  6     EINAPLIKR------RH-HNNDAISEAEKSPAA---ENSPIEQVALTVPVSDDPSLPSFT  55

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTK  419
             FR W+LGTL+CVLLSFLNQFF +R EPL++TAISAQIAVVP G LMAA +T RVF +GTK
Sbjct  56    FRTWILGTLACVLLSFLNQFFGFRREPLSVTAISAQIAVVPAGHLMAAAVTRRVFMKGTK  115

Query  420   WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQV  599
             WEFTLNPG FNVKEHVLITIFA+SGA +VYAI+ V+AVK+FY K +T   +L++V+T+QV
Sbjct  116   WEFTLNPGKFNVKEHVLITIFASSGAASVYAIYFVSAVKLFYRKDLTILTALLVVITSQV  175

Query  600   LGFGWAGIFRRYLVEPAAMWWPANL-----VQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             LGFGWAGIFR+YLVEPAAMWWP N      +Q+  FRALHEKEER KGG+TR QFF+IAF
Sbjct  176   LGFGWAGIFRKYLVEPAAMWWPQNFFSGLALQLCYFRALHEKEERRKGGLTRNQFFLIAF  235

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             +CSFAYYVFPGYLF  LTS+SWICW FP SV+A QLGSGL GLG+GAIG DWSSI SYLG
Sbjct  236   LCSFAYYVFPGYLFPSLTSISWICWMFPTSVIAHQLGSGLHGLGVGAIGFDWSSICSYLG  295

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+A GF + +Y   PI Y  +++NA+ FPIFSDELF S+GQ YNISAII
Sbjct  296   SPLASPWFATANVAAGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGQKYNISAII  355

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             DSNFHLD+EAY++EG LYLST FA++YG+GFA ++ATLVHV LFHG EI   SKS+F++ 
Sbjct  356   DSNFHLDMEAYEREGPLYLSTMFAMSYGIGFACISATLVHVSLFHGSEILRLSKSAFQEN  415

Query  1305  KMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIF  1481
             K+DIHT++M K Y+QVPEWWF CIL+ NI  T+F CEY+  +LQLPWWGV+LACV+A+ F
Sbjct  416   KIDIHTKIMRKNYKQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSF  475

Query  1482  TLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLG  1661
             TLPIG+I A TNQ P LNIITEYIIGY+YPGYPVANM FKVYG +SM QA+ FLQDFKLG
Sbjct  476   TLPIGVIRATTNQAPALNIITEYIIGYVYPGYPVANMLFKVYGDVSMQQAVFFLQDFKLG  535

Query  1662  HYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFY  1835
             HYMKIPPR MF+AQVVGT+++G V+L T+WWLM T+P IC+       + WTCP DHVFY
Sbjct  536   HYMKIPPREMFLAQVVGTLMSGVVHLLTSWWLMNTVPNICERALLPAGSPWTCPGDHVFY  595

Query  1836  DASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLI  2015
             DASVIWGLIGPRR FGDLG Y A+NWFFLAGAIAP LVWLA KA P ++WIRLI +PVL+
Sbjct  596   DASVIWGLIGPRRTFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLL  655

Query  2016  SATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYL  2195
              A S+MPPATAVNYT+W+IVGF+SG+VV+RY    W RHNYVLSGALDAGLAFMGVLLYL
Sbjct  656   GALSDMPPATAVNYTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALDAGLAFMGVLLYL  715

Query  2196  CLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             CLG+E++SLNWWG D DGCP ASCP+A G+   GCP+
Sbjct  716   CLGMEHISLNWWGTDSDGCPLASCPTAPGVESVGCPL  752



>gb|EPS62495.1| hypothetical protein M569_12295, partial [Genlisea aurea]
Length=719

 Score =  1035 bits (2676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/714 (71%), Positives = 614/714 (86%), Gaps = 3/714 (0%)
 Frame = +3

Query  171   NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  350
             NSP+ +VALTVP TDDP++P +TFR WVLG+++CVLLSFLNQFF+YR EPL+IT ISAQI
Sbjct  6     NSPVEQVALTVPPTDDPTIPAVTFRTWVLGSVACVLLSFLNQFFFYRREPLSITGISAQI  65

Query  351   AVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTA  530
             AVVPLG LMAA +T RVF+RGTKWEF+LNPG FN+KEHVLITI AN+GA   Y+IH+V+ 
Sbjct  66    AVVPLGHLMAATVTKRVFYRGTKWEFSLNPGGFNLKEHVLITILANAGAANPYSIHIVSV  125

Query  531   VKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEK  710
             VKVFY + + F+V+  +VLTTQ+LG+GWAG++RRYLVEPAAMWWP NLVQVSLFRALHEK
Sbjct  126   VKVFYRQKLAFWVAFAVVLTTQILGYGWAGLYRRYLVEPAAMWWPENLVQVSLFRALHEK  185

Query  711   EERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqg  890
             E   KG +TR +FF+I+FICSFAYY+FPGYLF  LTS+SW+CW F  SVLAQQLGSGL G
Sbjct  186   EAPVKGRLTRNKFFLISFICSFAYYIFPGYLFPKLTSISWLCWIFSSSVLAQQLGSGLHG  245

Query  891   lgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIF  1070
             LGIGAIGLDWSSISSYLGSPLASPWFATANIA G+F+ +YV TP+ YW D++NAKTFPIF
Sbjct  246   LGIGAIGLDWSSISSYLGSPLASPWFATANIAFGYFVCMYVITPLMYWLDIYNAKTFPIF  305

Query  1071  SDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVV  1250
             SD +FTS GQ YNISAI+D NFH+DL+AYD+ G L+LSTFFA TYG  FA LTAT+VHV 
Sbjct  306   SDGMFTSEGQKYNISAIVDGNFHIDLQAYDRVGPLHLSTFFATTYGFSFACLTATIVHVF  365

Query  1251  LFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQL  1430
             LFHGRE+W  SKS+ K +K DIHT+LM  Y +VPEWWF  IL+ +IA+T+F CEYY +QL
Sbjct  366   LFHGRELWTLSKSALK-QKQDIHTKLMKNYSRVPEWWFISILIVSIAVTLFICEYYNDQL  424

Query  1431  QLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYG  1610
             QLPWWGVLLAC +A  FTLP+G+I A TNQTPGLN+ITEY+IGY+YPGYPVANMCFKVYG
Sbjct  425   QLPWWGVLLACGLAFFFTLPVGVIAATTNQTPGLNVITEYVIGYLYPGYPVANMCFKVYG  484

Query  1611  YISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT  1790
             YISM QA  FL+DFKLGHYMKIPPR+MFMAQV GT+I+  ++LGTAWWLMET+  IC T 
Sbjct  485   YISMKQAHLFLKDFKLGHYMKIPPRSMFMAQVSGTLISALIHLGTAWWLMETVSNICDTA  544

Query  1791  A--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATK  1964
                  + WTCPSDHVFY ASVIWGLIGP+RIFG+LG Y A+NW FLAGA+AP+LVWL  +
Sbjct  545   TLPKGSPWTCPSDHVFYSASVIWGLIGPQRIFGNLGYYSAINWSFLAGAMAPLLVWLVQR  604

Query  1965  AFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVL  2144
             AFP Q W+RLI++PV++ +  NMPPAT+VNY +WII+GFLSG+V +RY  + W+RHNYVL
Sbjct  605   AFPSQTWLRLISVPVILVSVINMPPATSVNYNSWIIIGFLSGFVAYRYHREWWRRHNYVL  664

Query  2145  SGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             SGAL++GLAFMGVLLYLCLG++++S++WWG++ DGCP ASCP+A+GI+V+GCPV
Sbjct  665   SGALNSGLAFMGVLLYLCLGMQHISIDWWGSETDGCPLASCPTARGIVVKGCPV  718



>ref|XP_004502694.1| PREDICTED: oligopeptide transporter 6-like [Cicer arietinum]
Length=737

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/721 (70%), Positives = 601/721 (83%), Gaps = 3/721 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E  E E  P+++V LTVP TDDP+LP +TFRMWVLG LSCVLLSF+NQFFWYRT+PL++T
Sbjct  16    ELNENEECPVKQVELTVPKTDDPTLPAVTFRMWVLGVLSCVLLSFVNQFFWYRTQPLSVT  75

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             +ISAQIAVVPLG  MA  +  RVFF+ T +EF+LN GPFN+KEHVLITIFAN+GAGTVYA
Sbjct  76    SISAQIAVVPLGHFMARTLPTRVFFKDTLFEFSLNRGPFNIKEHVLITIFANAGAGTVYA  135

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++AVK+ Y + + F  +L+++LTTQVLGFGWAG+FR++LVEPA MWWP+NLVQVSLF
Sbjct  136   THILSAVKLMYRRELGFLPALLLMLTTQVLGFGWAGLFRKFLVEPAEMWWPSNLVQVSLF  195

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
              ALHEK  RPKG  +RTQFFV+  I   AYYV PGY+F MLT++SW CW  P S+L QQ+
Sbjct  196   SALHEKGRRPKGATSRTQFFVLVLISGMAYYVLPGYMFTMLTTISWTCWLAPNSILVQQI  255

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG++GLG+ ++G+DWS+ISSYLGSPLASPWFATANI VGF L++YV TPI YW +++NA
Sbjct  256   GSGMRGLGVASVGIDWSTISSYLGSPLASPWFATANITVGFILVMYVITPIAYWFNMYNA  315

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             K FPIFS +LFT  G  YNIS I+ S FHLD +AY + G ++LSTFFA+TYG+GFAAL+A
Sbjct  316   KNFPIFSSKLFTGDGSVYNISTIVSSEFHLDRDAYGKNGSVHLSTFFAVTYGLGFAALSA  375

Query  1233  TLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFAC  1409
             T+VHV+LFHGREIW QSKS+F +++K+DIHTRLM +Y+ VP WWF  ILV NIAL +F C
Sbjct  376   TVVHVILFHGREIWRQSKSAFGENKKIDIHTRLMRRYKSVPNWWFHVILVTNIALIIFIC  435

Query  1410  EYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVAN  1589
             EYYKE LQLPWWGVLLAC IAI FTL IGII A TNQ PGLNIITEYIIGY+YP  PVAN
Sbjct  436   EYYKESLQLPWWGVLLACTIAIFFTLXIGIIAATTNQQPGLNIITEYIIGYMYPERPVAN  495

Query  1590  MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETI  1769
             MCFKVYGYISM QA  FLQDFKLGHYMKIPPRTMFMAQVVGT I+  VY  TAWWLM T+
Sbjct  496   MCFKVYGYISMAQAQTFLQDFKLGHYMKIPPRTMFMAQVVGTFISVLVYTVTAWWLMGTV  555

Query  1770  PEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
             P++C T+    ++ WTCP D+VFYDASVIWGL+GPRRIFG+LG Y  VNWFFL GAIAP+
Sbjct  556   PDLCDTSKLPDDSPWTCPMDNVFYDASVIWGLLGPRRIFGNLGEYSNVNWFFLGGAIAPL  615

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
             LVWLA KAFPGQ WIRLI+MPVL+ ATS MPPATAVN+T+WI VGF+SGY+V+RY+ D W
Sbjct  616   LVWLAHKAFPGQTWIRLIHMPVLLGATSMMPPATAVNFTSWIAVGFISGYIVYRYKQDWW  675

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             +R+NYVLSG LDAG AFM +LL+L LG   +SL+WWG   +GCP ASCP+AKGI V+GCP
Sbjct  676   KRYNYVLSGGLDAGTAFMTILLFLTLGTNGISLDWWGTGNEGCPLASCPTAKGIFVKGCP  735

Query  2304  V  2306
             V
Sbjct  736   V  736



>dbj|BAJ87692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=735

 Score =  1029 bits (2660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/752 (70%), Positives = 612/752 (81%), Gaps = 46/752 (6%)
 Frame = +3

Query  57    DEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVL  236
             D+I  PLL             SSS+   E + +  E ENS + +VALTVP  DDPS PVL
Sbjct  26    DQIIAPLL---------QPLTSSSRGSPEEVGDR-EAENSAVEQVALTVPVGDDPSTPVL  75

Query  237   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGT  416
             TFRMWVLG  SCV LSFLN FFWYR EPL ITAISAQ+AVVPLG+LMAA + +R FFRG 
Sbjct  76    TFRMWVLGAASCVALSFLNTFFWYRKEPLEITAISAQVAVVPLGRLMAAALPERAFFRGR  135

Query  417   KWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             +WEFTLNPGPF+VKEHVLITIFAN+GAG+V+AI++VTAV+VFYGK I+F VSL++VLT+Q
Sbjct  136   RWEFTLNPGPFSVKEHVLITIFANAGAGSVFAINLVTAVRVFYGKPISFLVSLLVVLTSQ  195

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             V+GFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TRTQFF++AF CSF
Sbjct  196   VVGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRRKGGLTRTQFFMVAFGCSF  255

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
             AYY+FPGYL +MLTS+SWICW FP SV+AQQLGSGL GLGIGAIGLDWSSISSYLGSPLA
Sbjct  256   AYYIFPGYLLEMLTSISWICWIFPTSVVAQQLGSGLHGLGIGAIGLDWSSISSYLGSPLA  315

Query  957   SPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNF  1136
             SP FATANIA GFF+ +Y+ TPI YW +V+ A+ FPIFSD LFT+ GQ YNIS+I+D  F
Sbjct  316   SPLFATANIAAGFFIYIYLVTPIAYWFNVYEARNFPIFSDGLFTAIGQKYNISSIVDPEF  375

Query  1137  HLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDI  1316
             H D  AY++ G LY+STFFA++YG+GFA LTAT+VHV+LFHG EIW+ SKS+F+D KMD+
Sbjct  376   HFDANAYEKNGPLYISTFFAVSYGLGFACLTATIVHVLLFHGSEIWQLSKSAFQDSKMDV  435

Query  1317  HTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIG  1496
             HT+LM +YRQVPEWWF CILVA++A+ VF CEYY EQLQLPWWG+LLAC ++I++TLPIG
Sbjct  436   HTKLMRRYRQVPEWWFICILVASVAIAVFTCEYYIEQLQLPWWGILLACALSIVYTLPIG  495

Query  1497  IITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKI  1676
             IITA TNQTPGLNIITEYI+GY+YPG PVANMCFK                         
Sbjct  496   IITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK-------------------------  530

Query  1677  PPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVI  1850
                      VVGT+I+ FVYLGTAWW+M+TIP IC T      + WTCP DH+FYDASVI
Sbjct  531   ---------VVGTLISAFVYLGTAWWMMDTIPNICNTELLPAGSPWTCPYDHLFYDASVI  581

Query  1851  WGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSN  2030
             WGLI PRRIFGDLGTY AVNWFFL GAIAP+LVWLA KAFPGQ+WI L+NMPVL+   S+
Sbjct  582   WGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWLAHKAFPGQKWILLVNMPVLLGGISH  641

Query  2031  MPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLE  2210
             MPPATAVNYT WI V FLSGYVV++YR + W+RHNY+LSGALDAGLAFM VL+YLCL L+
Sbjct  642   MPPATAVNYTAWICVAFLSGYVVYKYRHNWWKRHNYLLSGALDAGLAFMAVLIYLCLELD  701

Query  2211  NVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             N++LNWWGN  DGCP ASCP+AKGIIV+GCPV
Sbjct  702   NITLNWWGNVSDGCPLASCPTAKGIIVDGCPV  733



>ref|XP_009773686.1| PREDICTED: oligopeptide transporter 7-like isoform X3 [Nicotiana 
sylvestris]
Length=690

 Score =  1027 bits (2655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/689 (74%), Positives = 589/689 (85%), Gaps = 2/689 (0%)
 Frame = +3

Query  246   MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWE  425
             MWVLGT++C LLSFLNQFFWYR EPLTIT+IS QIAVV LG LMA  ITDRVFF+G+KWE
Sbjct  1     MWVLGTIACFLLSFLNQFFWYRREPLTITSISTQIAVVLLGHLMAKAITDRVFFKGSKWE  60

Query  426   FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLG  605
             FTLNPGPFNVKEHVLITIFANSGAG  YAIHVV+AVK+FY + ++F+V+LI+V+TTQVLG
Sbjct  61    FTLNPGPFNVKEHVLITIFANSGAGNPYAIHVVSAVKLFYKQKLSFWVALIVVITTQVLG  120

Query  606   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYY  785
             FGWAGIFRRYLVEPAAMWWP NLVQVSLFRA H+KEER K G+TR QFF+IAF+CSFAYY
Sbjct  121   FGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAHHDKEERTKNGLTRNQFFLIAFVCSFAYY  180

Query  786   VFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPW  965
             VFPGYLF +L+S+SW+CW FP SVL QQLGSG+ GLGIGAIGLDWSSISSYLGSPLASPW
Sbjct  181   VFPGYLFPVLSSISWLCWLFPSSVLGQQLGSGMHGLGIGAIGLDWSSISSYLGSPLASPW  240

Query  966   FATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLD  1145
             FATANIAVG+FL+LYV TP+ YW +V+ AK FPIFSD LF  +GQ YNIS+IID NFH+D
Sbjct  241   FATANIAVGYFLLLYVVTPLMYWSNVYKAKNFPIFSDGLFKENGQDYNISSIIDQNFHID  300

Query  1146  LEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTR  1325
             LE Y+ EG+LYLS F +LTY   FA LTAT+VHV LFHG+E+W+ SKS+ K++KMD+HT+
Sbjct  301   LEKYEHEGRLYLSIFLSLTYAFSFACLTATVVHVFLFHGQELWQLSKSALKEKKMDVHTK  360

Query  1326  LMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIIT  1505
             LM KY+QVPEWWF  ILV NIA TVF CE YK QLQLPWWGVLLAC +A  FTLPIG+IT
Sbjct  361   LMRKYKQVPEWWFQIILVINIAATVFVCEIYKNQLQLPWWGVLLACGLAFFFTLPIGVIT  420

Query  1506  AITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPR  1685
             A TNQTPGLNIITEYI+GY+YPGYP ANMCFKVYGYISM Q + FLQD KLGHYMK PPR
Sbjct  421   ATTNQTPGLNIITEYIMGYLYPGYPAANMCFKVYGYISMKQGLTFLQDLKLGHYMKTPPR  480

Query  1686  TMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGL  1859
              MFMAQVVGT+I+ F +LGTAWWLM+T+P IC       ++ WTCP+DHVFYDASVIWGL
Sbjct  481   AMFMAQVVGTLISAFAHLGTAWWLMDTVPNICDRALLPQDSPWTCPTDHVFYDASVIWGL  540

Query  1860  IGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPP  2039
             IG +RI+G+LG Y A N FFL GA+AP  VWL  KAFP  +WIRLI++PV+++    MPP
Sbjct  541   IGSQRIYGNLGYYSATNCFFLLGAVAPAFVWLLQKAFPNHQWIRLISVPVVLAGIIKMPP  600

Query  2040  ATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVS  2219
             ATAVNY +WII+ F+SG+VV+RY  +LW RHNYVLSGALDAGLAFMGVLLYLCLG ENVS
Sbjct  601   ATAVNYNSWIIIAFISGFVVYRYYKNLWSRHNYVLSGALDAGLAFMGVLLYLCLGQENVS  660

Query  2220  LNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             L WWG+  D CP ASCP+A+GI V+GCP+
Sbjct  661   LKWWGSHTDICPLASCPTAEGITVDGCPI  689



>dbj|BAJ85522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=648

 Score =  1027 bits (2655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/646 (79%), Positives = 574/646 (89%), Gaps = 2/646 (0%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MAA + +R FF G  +EFTLNPGPFNVKEHVLITIFAN+GAGTVYAIHVVTAV+VFYGK+
Sbjct  1     MAAALPERAFFPGRPYEFTLNPGPFNVKEHVLITIFANAGAGTVYAIHVVTAVRVFYGKN  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             +TFFVSL++VLTTQVLGFGWAGIFRRYLVEPA MWWP+NLVQVSLFRALHEKE R KGG 
Sbjct  61    LTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPATMWWPSNLVQVSLFRALHEKEVRSKGGF  120

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR+QFF++AF+CSF YY+FPGYLFQMLTSLSWICW FP SV AQQLGSGL GLGIG+IGL
Sbjct  121   TRSQFFLVAFVCSFVYYIFPGYLFQMLTSLSWICWVFPNSVFAQQLGSGLYGLGIGSIGL  180

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DW+S+SSYLGSPLASPWFATAN+A GFF+I+YV TPI YW + + A+ FPIFSD LFT S
Sbjct  181   DWASVSSYLGSPLASPWFATANVAAGFFIIMYVITPIAYWFNFYKARNFPIFSDGLFTES  240

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             G  YNI++I+DS FH D +AY++ G LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW
Sbjct  241   GHKYNITSIVDSQFHFDTKAYEKNGPLYLSTFFAITYGVGFASLTATIVHVLLFHGSEIW  300

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
             + SKS+F+++++D+HT+LM +Y+QVPEWWF CIL+ NIA+TVFACEYY EQLQLPWWGVL
Sbjct  301   QLSKSAFQEKRVDVHTKLMRRYKQVPEWWFICILIVNIAVTVFACEYYIEQLQLPWWGVL  360

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC IA  FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+
Sbjct  361   LACAIAFFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQAL  420

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVW  1808
              FLQDFKLGHYMKIPPRTMFMAQVVGT+IA FVYLGTAWWLM++IP IC T      + W
Sbjct  421   TFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDSIPNICNTELLPPGSPW  480

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP DHVFYDASVIWGLI PRRIFGDLGTY AVNWFFL GAIAP+LVW A KAFP Q WI
Sbjct  481   TCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWFAHKAFPDQNWI  540

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
              LINMPVLI +T  MPPATAVNY TWI VGFLSGYVV+RYR D W+RHNY+LSGALDAGL
Sbjct  541   LLINMPVLIGSTGQMPPATAVNYITWIFVGFLSGYVVYRYRRDWWERHNYLLSGALDAGL  600

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             AFM VL+YLCLGLEN+SLNWWGNDLDGCP ASCP+AKGI VEGCPV
Sbjct  601   AFMAVLIYLCLGLENISLNWWGNDLDGCPLASCPTAKGIFVEGCPV  646



>ref|XP_004511249.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=739

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/721 (73%), Positives = 609/721 (84%), Gaps = 3/721 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
              ++ +ENSPI +VALTVP  DDPSLPV TFR W LGTL+CVLLSFLNQFF +R EPL++T
Sbjct  18    SSSGDENSPIEQVALTVPVNDDPSLPVFTFRTWTLGTLACVLLSFLNQFFGFRREPLSVT  77

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             AISAQIAVVPLG LMA+ +T RVF +GTKWEFTLNPG FNVKEHVLITIFA+SGA +VYA
Sbjct  78    AISAQIAVVPLGHLMASTVTKRVFLKGTKWEFTLNPGKFNVKEHVLITIFASSGAASVYA  137

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
             IH VTAVKVFY K IT  V+L++VLTTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLF
Sbjct  138   IHFVTAVKVFYRKEITVLVALLVVLTTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQVSLF  197

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKEER KG +TR QFF+I F+C FAYYVFPGYLF MLTSLSWICW FP SV+AQQL
Sbjct  198   RALHEKEERQKGELTRNQFFLITFVCGFAYYVFPGYLFPMLTSLSWICWVFPNSVIAQQL  257

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL GLG+GAIG DWSSI SYLGSPLASPWFATANIA GF + +YV  PI Y  ++++A
Sbjct  258   GSGLHGLGVGAIGFDWSSICSYLGSPLASPWFATANIAAGFAIFMYVIVPITYCLNLYHA  317

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             + FPIFSD LF S+GQ YNISAIIDSNFHLD EAY +EG LYLST FA++YG+GFA L+A
Sbjct  318   RRFPIFSDGLFKSNGQEYNISAIIDSNFHLDFEAYQREGPLYLSTMFAMSYGIGFACLSA  377

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFAC  1409
             TLVHV+LFHG +I E SKS+F+ +K+DIHT++M K Y+QVPEWWF CILV +I  T F C
Sbjct  378   TLVHVLLFHGSDILELSKSAFQGKKIDIHTKIMRKHYKQVPEWWFICILVFSITATTFVC  437

Query  1410  EYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVAN  1589
             EYY +QLQLPWWGV+LACV+A+ FTLP+GII A TNQ P LN+ITEYIIGYIYPGYPVA 
Sbjct  438   EYYNDQLQLPWWGVMLACVVAVSFTLPVGIIRATTNQAPALNVITEYIIGYIYPGYPVAV  497

Query  1590  MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETI  1769
             M FKVYG +SM QAI FLQDFKLGHYMKIPPR MF+AQV+GTVIAG V+L TAWWL++T+
Sbjct  498   MLFKVYGNVSMKQAIYFLQDFKLGHYMKIPPRAMFLAQVLGTVIAGAVHLITAWWLLDTV  557

Query  1770  PEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
              +IC        + WTCP DHVFYDASVIWGLIGPRRIFG+LG Y A+NWFFL GAIAP 
Sbjct  558   QDICHRELLPAGSPWTCPGDHVFYDASVIWGLIGPRRIFGNLGHYSAINWFFLVGAIAPF  617

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
             +VWLA KAFP ++WIRLI MPVL+ A S MPPAT VNYT+W++VGF SG++ +RY    W
Sbjct  618   IVWLAHKAFPNKQWIRLITMPVLLGALSEMPPATPVNYTSWVLVGFASGFIAYRYYRGWW  677

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
              RHNY+LSGALD+GLAFMGVL+YLCL ++++SLNWWG+D D CP ASC +A G+I +GCP
Sbjct  678   TRHNYLLSGALDSGLAFMGVLIYLCLEMQHISLNWWGSDPDRCPLASCSTAPGVISKGCP  737

Query  2304  V  2306
             V
Sbjct  738   V  738



>ref|XP_002275134.2| PREDICTED: oligopeptide transporter 6-like [Vitis vinifera]
Length=731

 Score =  1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/720 (70%), Positives = 615/720 (85%), Gaps = 2/720 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             EA      PI++V +TVP TDDP++PVLTFRMWVLG  SC++LSF+NQFFWYR++PL I+
Sbjct  11    EAGVSYECPIKQVDVTVPKTDDPTIPVLTFRMWVLGLSSCIVLSFVNQFFWYRSQPLIIS  70

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             +ISAQIAVVP+G LMA +IT RVF +G++WEFTLNPGPFNVKEHVLITIFANSGAGTVYA
Sbjct  71    SISAQIAVVPIGHLMAKKITKRVFLKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  130

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H++TAVK+ Y +++TF  +L+++ TTQVLGFGWAG+FR++LVEP  MWWP+NLVQVSLF
Sbjct  131   THILTAVKLLYKRNLTFIPALLVMTTTQVLGFGWAGLFRKFLVEPGEMWWPSNLVQVSLF  190

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKE+RPKGG TRTQFF+I FICSF YYV PGYL  MLTS SW+CW  P+S+L QQL
Sbjct  191   RALHEKEKRPKGGTTRTQFFLIVFICSFTYYVAPGYLINMLTSFSWVCWLAPKSILVQQL  250

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL+GLGIG+IGLDWS+ISSYLGSPLASPWFATAN+A+GF L++YV TP  YW +V+NA
Sbjct  251   GSGLEGLGIGSIGLDWSTISSYLGSPLASPWFATANVALGFCLVMYVMTPATYWSNVYNA  310

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             K FP++S++LFTS+G  YNI +IIDSNFHL  E Y + G L +STFFA+TYG+GFA L+A
Sbjct  311   KNFPLYSEKLFTSNGSRYNILSIIDSNFHLSKEQYVKSGPLNMSTFFAMTYGLGFATLSA  370

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             T+VHV LF+G E+W+Q+K +F ++KMDIHT LM KY+ VP WWF+ I V NIA  +FACE
Sbjct  371   TIVHVALFNGSELWKQTKGAFGEKKMDIHTWLMKKYKSVPNWWFFVIHVVNIATIIFACE  430

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY + LQLPWWGVLLAC IA  FTLPIGIITA TNQTPGLNI+TEY++GY+YPG PVANM
Sbjct  431   YYNDVLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIVTEYVMGYMYPGRPVANM  490

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFKVYGYISMTQA+ FL DFKLGHYMKIPPR+MFMAQVVGTV+A  VY+ TAWWLM TIP
Sbjct  491   CFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFMAQVVGTVVAVIVYVITAWWLMATIP  550

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C TT    ++ W CP D+VF+DASVIWGLIG RRIFG+LG Y  VNWFFL GAIAP+L
Sbjct  551   NLCDTTMLPADSPWRCPMDNVFFDASVIWGLIGTRRIFGNLGAYSNVNWFFLLGAIAPLL  610

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VWL  KAFP ++WI LI+MPVL+ +T+ MPPA+AVN+T+WIIVGFLSG+V+FR++P LW+
Sbjct  611   VWLMHKAFPKKKWIPLIHMPVLLGSTAMMPPASAVNFTSWIIVGFLSGFVIFRHKPKLWE  670

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYV+SG LDAG AFM +L++L LG  NVS++WWGN+ +GCP ASCP+AKGI+V+GCPV
Sbjct  671   RYNYVVSGGLDAGTAFMTILIFLTLGSRNVSIDWWGNNPEGCPLASCPTAKGIVVDGCPV  730



>ref|XP_010113336.1| Oligopeptide transporter 7 [Morus notabilis]
 gb|EXC35343.1| Oligopeptide transporter 7 [Morus notabilis]
Length=1062

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/747 (68%), Positives = 611/747 (82%), Gaps = 36/747 (5%)
 Frame = +3

Query  78    LPKVEE-YEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWV  254
             +PK ++  E  H  ++SS +        +  ENSPI +VALTVP +DDPSLP +TFR W 
Sbjct  349   VPKGDKASESDHAASTSSTTP-------SPGENSPIEQVALTVPISDDPSLPAVTFRTWT  401

Query  255   LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTL  434
             LG ++C++LSFL QFFWYR EP+++T+ISAQIAVVP+G LMA+ ITDRVFF+G ++EF+L
Sbjct  402   LGIVACLVLSFLKQFFWYRKEPMSLTSISAQIAVVPIGHLMASAITDRVFFKGRRFEFSL  461

Query  435   NPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGW  614
             NPGPFNVKEHVLITIFANSGA  VYAIH+V+AVKVFY ++++FFV+L++V+TTQVLGFGW
Sbjct  462   NPGPFNVKEHVLITIFANSGADNVYAIHIVSAVKVFYKRNLSFFVALMVVVTTQVLGFGW  521

Query  615   AGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFP  794
             AG+FRR+LVEPAAMWWP NLVQVSLFR                          FAYYV P
Sbjct  522   AGLFRRFLVEPAAMWWPQNLVQVSLFR--------------------------FAYYVLP  555

Query  795   GYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFAT  974
             GYLF  LTSLSWICW FP S+LA QLGSGL+GLG+GA G DWSSISSYL SPLASPWFAT
Sbjct  556   GYLFSRLTSLSWICWIFPASILANQLGSGLRGLGVGAFGFDWSSISSYLDSPLASPWFAT  615

Query  975   ANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEA  1154
             AN+AVGF L+LYV  P  YW +++ AKTFPIFSD LFTS+GQ YN++AI DS FHLDL+A
Sbjct  616   ANVAVGFALMLYVIVPAAYWLNLYKAKTFPIFSDGLFTSNGQNYNVTAITDSKFHLDLDA  675

Query  1155  YDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMS  1334
             Y+++G L+LST FA+ YG+ FA LTAT+VHV+LF+GR++ E +KS+F+++KMD+HTRLM 
Sbjct  676   YERQGPLHLSTLFAIAYGLNFACLTATIVHVILFNGRQMRELTKSAFQEKKMDVHTRLMR  735

Query  1335  KYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAIT  1514
              Y QVP+WWF  IL  NI  T+F C+YY  QLQLPWWG+LLAC +A+ FTLP+G+I A T
Sbjct  736   NYEQVPQWWFMSILFVNIVATIFTCQYYNGQLQLPWWGILLACGLAMFFTLPVGVIKATT  795

Query  1515  NQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMF  1694
             NQTPGLN+ITEYIIGYIYPGYPVANMCFKVYGYISM Q IAFLQDFKLGHYMKIPPR+MF
Sbjct  796   NQTPGLNVITEYIIGYIYPGYPVANMCFKVYGYISMKQGIAFLQDFKLGHYMKIPPRSMF  855

Query  1695  MAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGP  1868
             MAQVVGT+I+ F +LGTAWWLM+TIP+IC   +   ++ WTCP DHVFYDASVIWGL+GP
Sbjct  856   MAQVVGTIISAFGHLGTAWWLMDTIPDICDRASLPADSPWTCPGDHVFYDASVIWGLVGP  915

Query  1869  RRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATA  2048
             RRIFGDLG Y ++NWFFL GAIAPVLVWLA KAFP + WI L+NMPV+  A SNMPPATA
Sbjct  916   RRIFGDLGYYSSINWFFLVGAIAPVLVWLAHKAFPNKHWIGLVNMPVIFGAISNMPPATA  975

Query  2049  VNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNW  2228
             VNYT+W+++GF SG+V +RY    W RHNYVLSGALDAGLAFMGVLLYLCLG+E+V L W
Sbjct  976   VNYTSWVLIGFASGFVAYRYHRGWWSRHNYVLSGALDAGLAFMGVLLYLCLGMEHVGLKW  1035

Query  2229  WGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             WGND +GCP ASCP+ +G++V+GCP++
Sbjct  1036  WGNDSEGCPLASCPTQQGVVVKGCPLV  1062



>ref|XP_010048814.1| PREDICTED: oligopeptide transporter 6 [Eucalyptus grandis]
 gb|KCW89113.1| hypothetical protein EUGRSUZ_A01435 [Eucalyptus grandis]
Length=732

 Score =  1020 bits (2638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/727 (70%), Positives = 613/727 (84%), Gaps = 4/727 (1%)
 Frame = +3

Query  135   KVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRT  314
             +V+   E  +EE  P+ +V LTVP TDDP+LPVLTFRMWVLG  SCV+LSF+NQFFWYR 
Sbjct  6     QVQGKEEEVDEE-CPVEQVKLTVPITDDPTLPVLTFRMWVLGVGSCVVLSFVNQFFWYRQ  64

Query  315   EPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSG  494
              PL+IT+ISAQIAVVP+G LMA  IT RVF +GTKWEF+LNPGPFN+KEHVLITIFANSG
Sbjct  65    NPLSITSISAQIAVVPIGHLMARTITKRVFLQGTKWEFSLNPGPFNIKEHVLITIFANSG  124

Query  495   AGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANL  674
             AG+VYA H++++VK++Y + +TF  +L++++TTQVLGFGWAG+FR YLVEP  MWWP NL
Sbjct  125   AGSVYATHILSSVKLYYKRKLTFLPALLVMMTTQVLGFGWAGLFREYLVEPGEMWWPYNL  184

Query  675   VQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRS  854
             VQVSLFRALHEKE+R KG  TR QFF+IA I SFAYYV PGYLF MLT+ SW+CW  P S
Sbjct  185   VQVSLFRALHEKEKRQKGRFTRNQFFLIALITSFAYYVLPGYLFMMLTAFSWVCWIAPNS  244

Query  855   VlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW  1034
             VL QQLGSG +GLGIG++G DW++ISSYLGSPLASPWFATAN+AVGFFL++YV TP+ YW
Sbjct  245   VLVQQLGSGQKGLGIGSVGFDWATISSYLGSPLASPWFATANVAVGFFLVMYVMTPLSYW  304

Query  1035  CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVG  1214
              DV+NAKTFPIFS  LF S+G  Y I++I++S FHLD  AY + G ++LSTFFA+TYG+G
Sbjct  305   FDVYNAKTFPIFSQSLFLSNGTKYEIASIVNSEFHLDRAAYARNGPIHLSTFFAMTYGLG  364

Query  1215  FAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVANIA  1391
             FA L+AT+VH+ LF G ++W+QSK +F   ++MD+HTRLM +Y  VP WWF  +LV NIA
Sbjct  365   FATLSATIVHIFLFSGSDLWKQSKKAFGGSKRMDVHTRLMKRYNSVPMWWFLLLLVVNIA  424

Query  1392  LTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiyp  1571
               +FACEYYKE LQLPWWG+LLAC IA+ FTLPIGIITA TNQTPGLNIITEY+IGY+YP
Sbjct  425   CIIFACEYYKETLQLPWWGILLACGIALFFTLPIGIITATTNQTPGLNIITEYVIGYMYP  484

Query  1572  gypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAW  1751
               PVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPPR+MFMAQVVGTVI+  VYL TAW
Sbjct  485   ERPVANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRSMFMAQVVGTVISVIVYLLTAW  544

Query  1752  WLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLA  1925
             WLMET+P +C T+    N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y  VNWFFL 
Sbjct  545   WLMETVPNLCDTSLLPPNSPWTCPPDGVFFDASVIWGLVGPRRIFGDLGEYGNVNWFFLG  604

Query  1926  GAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFR  2105
             GA+AP+LVWLA KAFP Q WIRLI+MPVL+ +TS MPPA+A+N+T+WI++GFLSG+VVFR
Sbjct  605   GAVAPLLVWLAHKAFPNQNWIRLIHMPVLLGSTSMMPPASAINFTSWIVIGFLSGFVVFR  664

Query  2106  YRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGI  2285
             YRP+ W+R+NYVLSG LDAG AFM +LL+L L  +++S++WWGN+ +GCP ASCP+AKG+
Sbjct  665   YRPEWWKRYNYVLSGGLDAGTAFMTLLLFLTLQSKDISIDWWGNNPEGCPLASCPTAKGV  724

Query  2286  IVEGCPV  2306
              ++ CPV
Sbjct  725   AIKECPV  731



>ref|XP_004138770.1| PREDICTED: oligopeptide transporter 6-like [Cucumis sativus]
Length=880

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/724 (68%), Positives = 605/724 (84%), Gaps = 5/724 (1%)
 Frame = +3

Query  144   SLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL  323
             +L E  +++NSPI++V +TVP TDDPSLPVLTFRMW+LG  +CV+LSF+NQFFWYR+ PL
Sbjct  158   TLREEEDDDNSPIKQVDITVPKTDDPSLPVLTFRMWILGIAACVILSFVNQFFWYRSNPL  217

Query  324   TITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGT  503
             ++++I+AQIAVVPLG L+A  +  + FF+GT++EFT+NPGPFN+KEHVLITIFANSGAG+
Sbjct  218   SVSSIAAQIAVVPLGHLLAKTLPTQQFFKGTRFEFTMNPGPFNIKEHVLITIFANSGAGS  277

Query  504   VYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQV  683
             VYA H++TAVK+ Y + + FF +L+I++TTQ+LGFGWAGIFR+YLVEP  MWWP+ LVQV
Sbjct  278   VYATHILTAVKLLYKRQLDFFPALLIMITTQILGFGWAGIFRKYLVEPGEMWWPSTLVQV  337

Query  684   SLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVla  863
             SLFRALHEKE+RPK   T TQFF++A ICSF YY+FPGYLF MLTS SW+CWF  +S+L 
Sbjct  338   SLFRALHEKEKRPKQSTTLTQFFLLAMICSFGYYIFPGYLFMMLTSFSWLCWFNSKSLLL  397

Query  864   qqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDV  1043
              Q+GSG++GLGIGA G+DWS+ISSYLGSPLASPWFAT NIAVGF L++YV TP+ YW DV
Sbjct  398   HQMGSGMKGLGIGAFGIDWSTISSYLGSPLASPWFATVNIAVGFVLVMYVMTPLCYWLDV  457

Query  1044  FNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAA  1223
             + AKTFPI+S  LF ++G  YNIS+I++S+FHLD   Y   G++ LSTFFA+TYG+GFA 
Sbjct  458   YEAKTFPIYSSSLFMANGHKYNISSIVNSDFHLDRGVYSTTGRVNLSTFFAMTYGLGFAT  517

Query  1224  LTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTV  1400
             L+AT+VHV+LF+GREI  QSKS+F   RK+DIHT+LM  Y+QVP WWF  ILV NI L++
Sbjct  518   LSATVVHVLLFNGREILNQSKSAFGGKRKIDIHTKLMRAYKQVPTWWFIVILVLNIGLSL  577

Query  1401  FACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgyp  1580
             FAC+YY   LQLPWWG+LLAC IA  FTLPIGII A TNQ PGLNIITEYIIGY YP  P
Sbjct  578   FACQYYNISLQLPWWGLLLACFIAFFFTLPIGIICATTNQAPGLNIITEYIIGYAYPERP  637

Query  1581  VANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLM  1760
             VANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPP+TMFMAQ+VGT+IA FVY GTAWWLM
Sbjct  638   VANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPKTMFMAQIVGTIIAVFVYTGTAWWLM  697

Query  1761  ETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAI  1934
              +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y AVNWFFL GAI
Sbjct  698   GSIQDLCDTNLLPDNSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEYGAVNWFFLGGAI  757

Query  1935  APVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRP  2114
             AP+LVW+A K FP + WIR I+MPVL+ ATS MPPATAVN+T+W+I GF+ GY +FRY+ 
Sbjct  758   APLLVWIAHKMFPNKAWIRFIHMPVLLGATSMMPPATAVNFTSWLICGFVFGYYLFRYKT  817

Query  2115  DLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVE  2294
             + W+R+NY+LSG LDAG AFM +L++L LG  ++S++WWGN+ DGCP ASCPSAKG++  
Sbjct  818   EWWKRYNYILSGGLDAGTAFMTILIFLSLG--SISIDWWGNNTDGCPLASCPSAKGVVAH  875

Query  2295  GCPV  2306
             GCPV
Sbjct  876   GCPV  879



>ref|XP_003522539.1| PREDICTED: oligopeptide transporter 9-like [Glycine max]
 gb|KHN19520.1| Oligopeptide transporter 6 [Glycine soja]
Length=739

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/734 (69%), Positives = 607/734 (83%), Gaps = 3/734 (0%)
 Frame = +3

Query  114   FASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLN  293
             F   S  + E+   A  EE  P+++V LTVP TDDP++ +LTFRMWVLG LSCVLLSF+N
Sbjct  5     FEGGSDLEKENNNIAESEEECPVKQVELTVPKTDDPTMQLLTFRMWVLGVLSCVLLSFVN  64

Query  294   QFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLI  473
             QFFWYRT+PL +T+ISAQIAVVP+G  +A  +  RVFF+ T++EF+LN GPFN+KEHVLI
Sbjct  65    QFFWYRTQPLIVTSISAQIAVVPIGHFLARTLPTRVFFKDTRFEFSLNRGPFNIKEHVLI  124

Query  474   TIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAA  653
             TIFANSGAGTVYA H+++AVK+ Y + + F  +L+++LTTQVLGFGWAG+FR++LVEP  
Sbjct  125   TIFANSGAGTVYATHILSAVKLMYKRRLDFLPALLVMLTTQVLGFGWAGLFRKFLVEPGE  184

Query  654   MWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWI  833
             MWWP+NLVQVSLF ALHEK +RPKGG TRTQFF++A +   AYYVFPGYLF MLTS SW+
Sbjct  185   MWWPSNLVQVSLFSALHEKSKRPKGGTTRTQFFLLALVLGLAYYVFPGYLFSMLTSFSWM  244

Query  834   CWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYV  1013
             CW  P+S+L QQLGSGL+GLGI A G+DWS+ISSYLGSPLASPWFATANIAVGFFL++YV
Sbjct  245   CWLAPKSILVQQLGSGLRGLGIAAFGIDWSTISSYLGSPLASPWFATANIAVGFFLVMYV  304

Query  1014  FTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFF  1193
              TPI YW + + AKTFPIFS +LF  +G  Y+IS I++S FHLD +AY   G ++LSTFF
Sbjct  305   MTPIAYWSNAYEAKTFPIFSSKLFMGNGSLYDISTIVNSEFHLDRQAYSINGPVHLSTFF  364

Query  1194  ALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKD-RKMDIHTRLMSKYRQVPEWWFWC  1370
             A+TYG+GFAAL+AT+VHV+LFHGREI  QSK +F + +K+DIHTRLM +Y+ VP WWF+ 
Sbjct  365   AMTYGLGFAALSATVVHVLLFHGREILMQSKRAFGNSKKIDIHTRLMRRYKSVPMWWFYI  424

Query  1371  ILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEy  1550
             IL ANIAL +F CEYY E LQLPWWGVLLAC I+I FTLPIGII A TNQ PGLNIITEY
Sbjct  425   ILAANIALIIFICEYYNESLQLPWWGVLLACAISIFFTLPIGIINATTNQQPGLNIITEY  484

Query  1551  iigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGF  1730
             IIGY+YP  PVANMCFKVYGYISM QA++FLQDFKLGHYMKIPPRTMFMAQVVGT+++ F
Sbjct  485   IIGYMYPERPVANMCFKVYGYISMVQALSFLQDFKLGHYMKIPPRTMFMAQVVGTILSVF  544

Query  1731  VYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEA  1904
             +Y  TAWWLM TIP +C TT    ++ WTCP D+VF+DASVIWGL+GPRRIFGDLG Y  
Sbjct  545   IYTITAWWLMRTIPHLCDTTMLDPDSPWTCPMDNVFFDASVIWGLLGPRRIFGDLGEYAK  604

Query  1905  VNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFL  2084
             VN FF  GAIAP LVWLA KAFPGQ WI LI+MPVL+ ATS MPPATAVN+T+W++VGFL
Sbjct  605   VNLFFFGGAIAPFLVWLAHKAFPGQRWITLIHMPVLLGATSMMPPATAVNFTSWLLVGFL  664

Query  2085  SGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYAS  2264
             SGYV +RYR + W+R NYVLSG LDAG AFM +LL+L L   N+ LNWWGN+ +GCP A+
Sbjct  665   SGYVAYRYRQEWWKRCNYVLSGGLDAGTAFMTILLFLALNNNNIMLNWWGNNPEGCPLAT  724

Query  2265  CPSAKGIIVEGCPV  2306
             CP+ KGI+V+GCPV
Sbjct  725   CPTEKGIVVKGCPV  738



>ref|XP_011043664.1| PREDICTED: oligopeptide transporter 9-like [Populus euphratica]
Length=731

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/733 (68%), Positives = 615/733 (84%), Gaps = 7/733 (1%)
 Frame = +3

Query  123   SSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  302
             +  ++V+++ E  +EE  P+++V LTV  TDDP+LPVLTFRMWVLG  SCVLLSF+NQFF
Sbjct  2     AGANEVQAM-EIEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQFF  60

Query  303   WYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIF  482
             WYRT+P+ I++ISAQIAVVPLG LMA ++T R FF GT WEFT+NPGPFN+KEHVLITIF
Sbjct  61    WYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLITIF  120

Query  483   ANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWW  662
             ANSGAGTVYA H++TAVK++Y + +TF  +L +++TTQVLGFGWAG+FRRYLVEP  MWW
Sbjct  121   ANSGAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRRYLVEPGEMWW  180

Query  663   PANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWF  842
             P+NLVQVSLFRALHEK++R KG  TRTQFF++  ICSFAYYV PGYLF MLTS SW+CW 
Sbjct  181   PSNLVQVSLFRALHEKDKRLKGYTTRTQFFLLVIICSFAYYVLPGYLFTMLTSFSWVCWL  240

Query  843   FPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTP  1022
               +SVL QQLGSGLQGLGIGA+G DW+++S+YLGSPLASPWFATAN+AVGF LI+YV TP
Sbjct  241   GSKSVLVQQLGSGLQGLGIGAVGFDWATVSAYLGSPLASPWFATANVAVGFSLIMYVMTP  300

Query  1023  IFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALT  1202
             I YW +V+NAK FP++S+ELFT+ G+ Y+I  II+S FHLD +AY + G +++STFF++T
Sbjct  301   ICYWLNVYNAKNFPLYSNELFTAKGEEYDILNIINSKFHLDRDAYAKFGPVHMSTFFSMT  360

Query  1203  YGVGFAALTATLVHVVLFHGREIWEQSKSSFKD-RKMDIHTRLMSKYRQVPEWWFWCILV  1379
             YG+GFA L+AT++HV+LF+G ++W+QSK +F   RK+DIHTRLM KY+ VP WWF+ ILV
Sbjct  361   YGLGFATLSATVMHVLLFNGSDLWKQSKRAFGGRRKIDIHTRLMKKYKSVPTWWFYIILV  420

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA  +FACE+Y E LQLPWWGVLLAC IA  FTLPIGII+A TNQ PGLN+ITEYIIG
Sbjct  421   INIAAIIFACEHYNESLQLPWWGVLLACAIAFFFTLPIGIISATTNQQPGLNVITEYIIG  480

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y+YP  PVANMCFKVYGYISMTQA+ FL DFKLGHYMKIPPR+MFMAQVVGT++A  VYL
Sbjct  481   YMYPERPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFMAQVVGTLVAVLVYL  540

Query  1740  GTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
             GTAWW+M+ IP +C  +  N  W CP D VF+DASVIWGL+GPRRIFG+LG Y  VNWFF
Sbjct  541   GTAWWMMDAIPNLC--SQDNGPWKCPMDRVFFDASVIWGLVGPRRIFGNLGEYGGVNWFF  598

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GA+AP++VW+  KAFP +EWI LI+MPVL+ ATS MPPA+AVNYT+WIIVGFLSGYV+
Sbjct  599   LGGAVAPLIVWIFHKAFPRKEWISLIHMPVLLGATSMMPPASAVNYTSWIIVGFLSGYVL  658

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWG---NDLDGCPYASCP  2270
             FRYR + W+R+NYVLSG LDAG AFM +L++  LG  +V L WWG   N+ +GC  ASCP
Sbjct  659   FRYRTEWWKRYNYVLSGGLDAGTAFMTLLIFFALGYWDVGLTWWGSNSNNPEGCLLASCP  718

Query  2271  SAKGIIVEGCPVI  2309
             +AKGI+V+GCPV+
Sbjct  719   TAKGIVVDGCPVL  731



>ref|XP_006376657.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
 gb|ERP54454.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
Length=732

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/729 (67%), Positives = 611/729 (84%), Gaps = 6/729 (1%)
 Frame = +3

Query  132   SKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYR  311
             S+++++   A+ E   I++V LTVP TDDP++PVLTFRMWVLG  SC++LSF+NQFFWYR
Sbjct  5     SEIKAMEIEADHEECSIKQVDLTVPKTDDPTMPVLTFRMWVLGLGSCIILSFVNQFFWYR  64

Query  312   TEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANS  491
             ++PLT+T+ISAQIAVVPLG LMA +++ R FF GT+WEFTLNPGPFN+KEHVLITIFANS
Sbjct  65    SQPLTVTSISAQIAVVPLGHLMAKKLSTRKFFEGTRWEFTLNPGPFNIKEHVLITIFANS  124

Query  492   GAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
             GAGTVYA H++T+VK++Y + +TF  +L I++TTQ+LGFGWAGIFR+YLVEP  MWWP+N
Sbjct  125   GAGTVYAAHILTSVKIYYQRKLTFIPALFIMITTQMLGFGWAGIFRKYLVEPGEMWWPSN  184

Query  672   LVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPR  851
             LVQVSLFRALHE+E+RPKGG TRTQ+F++  I +FAYY+ PGYLF ML+S SWICW   +
Sbjct  185   LVQVSLFRALHEREKRPKGGTTRTQYFLLVMISAFAYYILPGYLFTMLSSFSWICWLGSK  244

Query  852   SVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFY  1031
             SVL QQLGSGL G GIGA+G DW++ISSYLGSPLASPWFATAN+AVGFFLI+YV TP+ Y
Sbjct  245   SVLVQQLGSGLSGFGIGAVGFDWATISSYLGSPLASPWFATANVAVGFFLIMYVMTPLCY  304

Query  1032  WCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGV  1211
             W +V+NAK FP++S++L+T++GQ Y I  II+S FHLD +AY + G +++STFFA+TYG+
Sbjct  305   WLNVYNAKNFPLYSNQLYTATGQEYKILEIINSKFHLDRDAYAEHGPVHMSTFFAMTYGL  364

Query  1212  GFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVANI  1388
             GFA L+AT++HV+LF GR++W+QSK +F   RKMDIHTRLM +Y+ VP WWF+ ILVANI
Sbjct  365   GFATLSATVMHVLLFSGRDLWKQSKMAFGARRKMDIHTRLMKRYKSVPMWWFFVILVANI  424

Query  1389  ALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiy  1568
             A  +FACEYY   LQL WWGVLLAC IA  FTLPIGII+A TNQ PGLN+ITEYIIGY+Y
Sbjct  425   AAIIFACEYYNAALQLRWWGVLLACAIAFFFTLPIGIISATTNQQPGLNVITEYIIGYLY  484

Query  1569  pgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTA  1748
             P  PVANMCFKVYGYISM QA+ FL DFKLGHYMKIPPR+MFMAQVVGT++A  VYLGTA
Sbjct  485   PERPVANMCFKVYGYISMAQALTFLADFKLGHYMKIPPRSMFMAQVVGTLVAVLVYLGTA  544

Query  1749  WWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             WW+M+ +P +C   A N  W CP D VF++ASVIWGL+GPRRIFG+LG Y  VNWFFL G
Sbjct  545   WWMMDAVPNLC--AADNGPWRCPQDSVFFNASVIWGLVGPRRIFGNLGEYGNVNWFFLGG  602

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             A+AP++VW+  KAFP + WI LI+MP+++ AT+ MPPA++VNYT+WIIVGFLSGYV+FR+
Sbjct  603   AVAPLIVWIFHKAFPSKTWIGLIHMPIMLGATAMMPPASSVNYTSWIIVGFLSGYVLFRH  662

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLD---GCPYASCPSAK  2279
             R + W+R+NYVLSG LDAG AFM +L++  LG  NV L WWG++ D   GCP ASCP+AK
Sbjct  663   RTEWWKRYNYVLSGGLDAGTAFMTLLIFFGLGFWNVGLLWWGSNPDNQEGCPLASCPTAK  722

Query  2280  GIIVEGCPV  2306
             GI V+GCPV
Sbjct  723   GIFVDGCPV  731



>gb|KDP42149.1| hypothetical protein JCGZ_03016 [Jatropha curcas]
Length=747

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/737 (68%), Positives = 599/737 (81%), Gaps = 7/737 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEA-AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLN  293
             A+++K K+ + P    EEE  P+++V LTVP TDDP+LPVLTFRMWVLG  SC++LS +N
Sbjct  10    ATAAKLKMPAAPGTDTEEEQCPVKQVELTVPKTDDPTLPVLTFRMWVLGLASCIILSVVN  69

Query  294   QFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLI  473
             QFFWYR++P+ ++AISAQIAVVPLG LMA  +T RVF  G KWEFTLNPGPFNVKEHVLI
Sbjct  70    QFFWYRSQPMFVSAISAQIAVVPLGHLMARTLTRRVFLNGRKWEFTLNPGPFNVKEHVLI  129

Query  474   TIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAA  653
             TIFANSGAGTVYA H+++AVK+ Y + +TF  + I+++TTQVLGFGWAG+FR+YLVEP  
Sbjct  130   TIFANSGAGTVYATHILSAVKLLYRRKLTFLPAFIVMVTTQVLGFGWAGLFRKYLVEPGE  189

Query  654   MWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWI  833
             MWWP+NLVQVSLF ALHEK +RPKG +TRTQFF+I  +CSFAYY+FPGYL  +LTS SW+
Sbjct  190   MWWPSNLVQVSLFSALHEKGKRPKGKVTRTQFFLIVLVCSFAYYIFPGYLMTILTSFSWV  249

Query  834   CWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYV  1013
             CW  P+S+  QQLGSGL GLGIGA+G DWS++S++LGSPLASPWFATAN+AVGFFL++YV
Sbjct  250   CWLAPKSIFVQQLGSGLNGLGIGALGFDWSTVSAFLGSPLASPWFATANVAVGFFLVMYV  309

Query  1014  FTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFF  1193
              TPI YW DV+ AKTFP+FS++LF   GQ Y+I +I+DS FHLD +AY   G ++LSTFF
Sbjct  310   MTPITYWLDVYKAKTFPLFSNDLFKGDGQFYDIKSIVDSQFHLDRKAYAINGPVHLSTFF  369

Query  1194  ALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWC  1370
             A+TYG GFAAL++T VHV+LFHG +IW+QSK  F   R +DIHTRLM KY+ VP WWF  
Sbjct  370   AMTYGAGFAALSSTFVHVLLFHGSDIWKQSKRVFGGKRNIDIHTRLMQKYKSVPSWWFLV  429

Query  1371  ILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEy  1550
             ILV NIA  VF CE+Y + LQL WWGVLLAC IA+ FTLPIGII A TNQ PGLNIITEY
Sbjct  430   ILVTNIAFVVFTCEFYNDTLQLHWWGVLLACAIALFFTLPIGIIAATTNQAPGLNIITEY  489

Query  1551  iigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGF  1730
             IIGY+YP  PVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPPR MFMAQVVGT ++ F
Sbjct  490   IIGYMYPERPVANMCFKVYGYISMTQALNFLQDFKLGHYMKIPPRIMFMAQVVGTFVSVF  549

Query  1731  VYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEA  1904
             VY  TAW +ME +P +C       N+ W CP D VF+DASVIWGL+GPRRIFG+LG Y  
Sbjct  550   VYQVTAWGMMEAVPNLCDKRKLPQNSPWKCPMDAVFFDASVIWGLVGPRRIFGNLGEYGM  609

Query  1905  VNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFL  2084
             VNWFF  GAIAP LVWL  K FP Q+WIR I+MPVLI +TS MPPA+AVNYT+W++VGFL
Sbjct  610   VNWFFAGGAIAPFLVWLVHKTFPSQKWIRHIHMPVLIGSTSMMPPASAVNYTSWVVVGFL  669

Query  2085  SGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLD---GCP  2255
             SG+V+FRYRP LW+R+NYVLSG LDAG AF  +L++L L   NV L+WWG+  D   GCP
Sbjct  670   SGFVLFRYRPLLWKRYNYVLSGGLDAGTAFKTMLIFLSLSYWNVKLDWWGSSQDNQEGCP  729

Query  2256  YASCPSAKGIIVEGCPV  2306
              ++CP+AKG+I EGCPV
Sbjct  730   LSTCPTAKGVIAEGCPV  746



>ref|XP_006441174.1| hypothetical protein CICLE_v10019012mg [Citrus clementina]
 gb|ESR54414.1| hypothetical protein CICLE_v10019012mg [Citrus clementina]
Length=737

 Score =  1009 bits (2610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/736 (66%), Positives = 610/736 (83%), Gaps = 6/736 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAE---EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFL  290
             ++  S+VE+  +      +E   I++V LTVP TDDP++P +TFRMWVLG +SCV+LSF+
Sbjct  2     AAEISEVEAREDGVVVVVDEECVIKQVDLTVPKTDDPTMPCVTFRMWVLGVVSCVVLSFV  61

Query  291   NQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVL  470
             NQFFWYRT+PL +T+ISAQIAVVPLG LMA  +  R+FF+ T +EF LN GPFN+KEHVL
Sbjct  62    NQFFWYRTQPLAVTSISAQIAVVPLGHLMARTLPHRIFFKDTMFEFDLNSGPFNIKEHVL  121

Query  471   ITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             ITIFANSGAGTVYA H+++AVK+ Y + + F  + +++LTTQVLGFGWAG+FR+YLVEP 
Sbjct  122   ITIFANSGAGTVYATHILSAVKLLYKRKLGFLPAFLVMLTTQVLGFGWAGLFRKYLVEPG  181

Query  651   AMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSW  830
              MWWP+NLVQVSLFRALHEKE+RPKGG+TR QFF+I  + SFAYYV PGYLF +LT++SW
Sbjct  182   EMWWPSNLVQVSLFRALHEKEKRPKGGMTRNQFFLIVLLTSFAYYVLPGYLFALLTTISW  241

Query  831   ICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILY  1010
             +CW  P+SVL  QLGSG+ GLGIG+IG+DWS+ISSYLGSPLASPWFATAN+AVGFFL++Y
Sbjct  242   VCWISPKSVLVHQLGSGMNGLGIGSIGIDWSTISSYLGSPLASPWFATANVAVGFFLVMY  301

Query  1011  VFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTF  1190
             V  P+ YW + + AK FPI+S +LF S+G+ Y+I +I+++NF LD  AY + G + LST 
Sbjct  302   VMVPLCYWLNFYKAKNFPIYSKDLFKSNGEDYDILSIVNANFRLDRAAYAKNGPVNLSTL  361

Query  1191  FALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFW  1367
             FA+TYG+GFA L+ATLVH+ LF GR++WEQ++ +F   +K+DIHT+LM KY+ VP WWFW
Sbjct  362   FAMTYGLGFATLSATLVHIFLFSGRDLWEQTRRAFGGHKKVDIHTKLMQKYKSVPMWWFW  421

Query  1368  CILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITE  1547
              ILV NIAL +FAC+YY E LQLPWWGVLLAC IA+ FTLPIGII A TNQ PGLNIITE
Sbjct  422   VILVVNIALIIFACQYYNESLQLPWWGVLLACGIAVFFTLPIGIINATTNQQPGLNIITE  481

Query  1548  yiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAG  1727
             Y+IGY+YP  PVANMCFKVYGYISM Q + FL DFKLGHYMKIPPR MFMAQVVGT+IA 
Sbjct  482   YVIGYLYPERPVANMCFKVYGYISMNQGLTFLADFKLGHYMKIPPRAMFMAQVVGTLIAV  541

Query  1728  FVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYE  1901
              VY  TAWWLM  IP +C TT    ++ WTCP D VF+DASVIWGL+GPRRIFGD G Y 
Sbjct  542   MVYTLTAWWLMGDIPYLCDTTMLPRDSPWTCPMDRVFFDASVIWGLVGPRRIFGDQGEYG  601

Query  1902  AVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGF  2081
              +NWFFL GA+AP+LVWLA KAFP ++WIRLI+MPVL+ +T+ MPPA+AVN+T+WII+GF
Sbjct  602   NINWFFLGGAVAPLLVWLAHKAFPSKKWIRLIHMPVLLGSTAMMPPASAVNFTSWIILGF  661

Query  2082  LSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYA  2261
             LSG+VVFRY+P++W+R+NY+LSG LDAG AFM VLL++ LGL+N+ L+WWGN  +GCP A
Sbjct  662   LSGFVVFRYKPEVWKRYNYILSGGLDAGTAFMTVLLFIALGLQNIGLDWWGNSGEGCPLA  721

Query  2262  SCPSAKGIIVEGCPVI  2309
             +CP+AKGI+V+GCPV+
Sbjct  722   TCPTAKGIMVDGCPVV  737



>ref|XP_002317799.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|EEE96019.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=731

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/733 (68%), Positives = 614/733 (84%), Gaps = 7/733 (1%)
 Frame = +3

Query  123   SSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  302
             +  ++V+++ E  +EE  P+++V LTV  TDDP+LPVLTFRMWVLG  SCVLLSF+NQFF
Sbjct  2     AGANEVQAM-EIEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQFF  60

Query  303   WYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIF  482
             WYRT+P+ I++ISAQIAVVPLG LMA ++T R FF GT WEFT+NPGPFN+KEHVLITIF
Sbjct  61    WYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLITIF  120

Query  483   ANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWW  662
             ANSGAGTVYA H++TAVK++Y + +TF  +L +++TTQVLGFGWAG+FR+YLVEP  MWW
Sbjct  121   ANSGAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVEPGEMWW  180

Query  663   PANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWF  842
             P+NLVQVSLFRALHEKE+R KG  +RTQFF++  ICSFAYYV PGYLF MLTS SW+CW 
Sbjct  181   PSNLVQVSLFRALHEKEKRLKGYTSRTQFFLLVIICSFAYYVLPGYLFTMLTSFSWVCWL  240

Query  843   FPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTP  1022
               +SVL QQLGSGLQGLGIGA+G DW+++S+YLGSPLASPWFATAN+AVGF LI+YV TP
Sbjct  241   GSKSVLVQQLGSGLQGLGIGAVGFDWATVSAYLGSPLASPWFATANVAVGFSLIMYVMTP  300

Query  1023  IFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALT  1202
             I YW +V+NAK FP++S+ELFT  G+ Y+I  II+S FHLD +AY + G +++STFF++T
Sbjct  301   ICYWLNVYNAKNFPLYSNELFTEKGEEYDILNIINSKFHLDRDAYAKFGPIHMSTFFSMT  360

Query  1203  YGVGFAALTATLVHVVLFHGREIWEQSKSSFKD-RKMDIHTRLMSKYRQVPEWWFWCILV  1379
             YG+GFA L+AT++HV+LF+G ++W+QSK +F   RK+DIHTRLM KY+ VP WWF+ ILV
Sbjct  361   YGLGFATLSATVMHVLLFNGSDLWKQSKRAFGGRRKIDIHTRLMKKYKSVPTWWFYIILV  420

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA  +FACE+Y E LQLPWWGVLLAC IA  FTLPIGII+A TNQ PGLN+ITEYIIG
Sbjct  421   INIAAIIFACEHYNESLQLPWWGVLLACAIAFFFTLPIGIISATTNQQPGLNVITEYIIG  480

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y+YP  PVANMCFKVYGYISMTQA+ FL DFKLGHYMKIPPR+MFMAQVVGT++A  VYL
Sbjct  481   YMYPERPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFMAQVVGTLVAVLVYL  540

Query  1740  GTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
             GTAWW+M+ IP +C  +  N  W CP D VF+DASVIWGL+GPRRIFG+LG Y  VNWFF
Sbjct  541   GTAWWMMDAIPNLC--SQDNGPWKCPMDRVFFDASVIWGLVGPRRIFGNLGEYGGVNWFF  598

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GA+AP++VW+  KAFP +EWI LI+MPVL+ ATS MPPA+AVNYT+WI+VGFLSGYV+
Sbjct  599   LGGAVAPLIVWIFHKAFPRKEWISLIHMPVLLGATSMMPPASAVNYTSWIVVGFLSGYVL  658

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDL---DGCPYASCP  2270
             FRYR + W+R+NYVLSG LDAG AFM +L++  LG  +V L WWG++    +GC  ASCP
Sbjct  659   FRYRTEWWKRYNYVLSGGLDAGTAFMTLLIFFALGYWDVDLTWWGSNSSNPEGCLLASCP  718

Query  2271  SAKGIIVEGCPVI  2309
             +AKGIIV+GCPV+
Sbjct  719   TAKGIIVDGCPVL  731



>ref|XP_010109222.1| Oligopeptide transporter 6 [Morus notabilis]
 gb|EXC21402.1| Oligopeptide transporter 6 [Morus notabilis]
Length=750

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/724 (68%), Positives = 599/724 (83%), Gaps = 6/724 (1%)
 Frame = +3

Query  153   EAAEEENSP---IREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL  323
             +   EE+S    +++V LTVP TDDP++PVLTFRMWVLG  SCVLLSF+NQFFWYRT+PL
Sbjct  26    DDNHEESSDERVVKQVDLTVPKTDDPTMPVLTFRMWVLGLASCVLLSFVNQFFWYRTQPL  85

Query  324   TITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGT  503
              I++ISAQIAVVPLG LMA  +  R+F +GT +EFT+NPGPFN+KEHVLITIFANSGAGT
Sbjct  86    IISSISAQIAVVPLGHLMAKSLPTRLFLQGTPFEFTMNPGPFNIKEHVLITIFANSGAGT  145

Query  504   VYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQV  683
             VYA H++TAVK+ Y + +TF  + I++LTTQVLGFGWAGIFR+YLVEP  MWWP+NLVQV
Sbjct  146   VYATHILTAVKLLYKRKLTFLPAFIVMLTTQVLGFGWAGIFRKYLVEPPEMWWPSNLVQV  205

Query  684   SLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVla  863
             SLFRALHEKE+R KG  +RTQ+F+I  ICSFAYY+ PGY F +LTS+SW+CW  P+++  
Sbjct  206   SLFRALHEKEKRVKGVTSRTQYFMIVLICSFAYYILPGYFFLLLTSISWVCWVAPKTITW  265

Query  864   qqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDV  1043
             QQ+GSG+QGLG+ + G+DWS+ISSYLGSPLASPWFATAN+A+GF LI+YV TPI YW +V
Sbjct  266   QQIGSGMQGLGLFSFGIDWSTISSYLGSPLASPWFATANVAIGFLLIMYVMTPITYWYNV  325

Query  1044  FNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAA  1223
             +NAKTFPIFS  LFTS+G  Y+I  IID  FHLD   Y + G + LSTFFA+TYG+GFA 
Sbjct  326   YNAKTFPIFSSGLFTSNGSDYDILNIIDPKFHLDRSTYAKVGPINLSTFFAMTYGLGFAT  385

Query  1224  LTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTV  1400
             L+ATLVHV+ F+GR++W Q+  +F+   K+DIH +LM KY+ VP WWF  ILV NI L +
Sbjct  386   LSATLVHVLFFNGRDLWRQTTRAFRGGNKLDIHAKLMKKYKSVPAWWFIVILVVNIGLII  445

Query  1401  FACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgyp  1580
             FACEYY E LQLPWWGVLLAC IAI+FTLPIGII A TNQ PGLN+ITEYIIGYIYP  P
Sbjct  446   FACEYYNESLQLPWWGVLLACGIAIVFTLPIGIIQATTNQQPGLNVITEYIIGYIYPERP  505

Query  1581  VANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLM  1760
             VANMCFKVYGYISM QA++F+ DFKLGHYMKIPPR MFMAQVVGT+++  +Y  TAWWLM
Sbjct  506   VANMCFKVYGYISMAQALSFVADFKLGHYMKIPPRAMFMAQVVGTLVSVMIYTLTAWWLM  565

Query  1761  ETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAI  1934
             E IP +C T+    ++ WTCP D VFYDASVIWGL+GPRRIFGDLG Y  VNWFFLAGAI
Sbjct  566   EEIPHLCDTSMLPHDSPWTCPMDRVFYDASVIWGLVGPRRIFGDLGEYGLVNWFFLAGAI  625

Query  1935  APVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRP  2114
             AP+LVW+A KAFP Q+WIRLI+MP+L+ +TS MPPATAVN+T+WI VGF SGY ++RY P
Sbjct  626   APILVWMAHKAFPQQKWIRLIHMPILLGSTSMMPPATAVNFTSWIAVGFFSGYYMYRYHP  685

Query  2115  DLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVE  2294
             + W+R+NYVLSG LDAG AFM +L++L LG +N+ LNWWGN+ + CP A+CP+A GIIV+
Sbjct  686   NWWKRNNYVLSGGLDAGTAFMTILIFLALGAQNIGLNWWGNNPESCPLAACPTAPGIIVD  745

Query  2295  GCPV  2306
             GCPV
Sbjct  746   GCPV  749



>ref|XP_006491962.1| PREDICTED: oligopeptide transporter 9-like [Citrus sinensis]
Length=737

 Score =  1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/736 (66%), Positives = 609/736 (83%), Gaps = 6/736 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAE---EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFL  290
             ++  S+VE+  +      +E   I++V LTVP TDDP++P +TFRMWVLG +SCV+LSF+
Sbjct  2     AAEISEVEAREDGVVVVVDEECVIKQVDLTVPKTDDPTMPCVTFRMWVLGVVSCVVLSFV  61

Query  291   NQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVL  470
             NQFFWYRT+PL +T+ISAQIAVVPLG LMA  +  R+FF+ T +EF LN GPFN+KEHVL
Sbjct  62    NQFFWYRTQPLAVTSISAQIAVVPLGHLMARTLPHRIFFKDTMFEFDLNSGPFNIKEHVL  121

Query  471   ITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             ITIFANSGAGTVYA H+++AVK+ Y + + F  + +++LTTQVLGFGWAG+FR+YLVEP 
Sbjct  122   ITIFANSGAGTVYATHILSAVKLLYKRKLGFLPAFLVMLTTQVLGFGWAGLFRKYLVEPG  181

Query  651   AMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSW  830
              MWWP+NLVQVSLFRALHEKE+RPKGG+TR QFF+I  + SFAYYV PGYLF +LT++SW
Sbjct  182   EMWWPSNLVQVSLFRALHEKEKRPKGGMTRNQFFLIVLLTSFAYYVLPGYLFGLLTTISW  241

Query  831   ICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILY  1010
             +CW  P+SVL  QLGSG+ GLGIG+IG+DWS+ISSYLGSPLASPWFATAN+AVGFFL++Y
Sbjct  242   VCWISPKSVLVHQLGSGMNGLGIGSIGIDWSTISSYLGSPLASPWFATANVAVGFFLVMY  301

Query  1011  VFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTF  1190
             V  P+ YW + + AK FPI+S +LF S+G+ Y+I +I+++NF LD  AY + G + LST 
Sbjct  302   VMVPLCYWLNFYKAKNFPIYSKDLFKSNGEDYDILSIVNTNFRLDRAAYAKNGPVNLSTL  361

Query  1191  FALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFW  1367
             FA+TYG+GFA L+ATLVH+ LF GR++WEQ++ +F   +K+DIHT+LM KY+ VP WWFW
Sbjct  362   FAMTYGLGFATLSATLVHIFLFSGRDLWEQTRRAFGGHKKVDIHTKLMQKYKSVPMWWFW  421

Query  1368  CILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITE  1547
              ILV NIAL +FAC+YY E LQLPWWGVLLAC IA+ FTLPIGII A TNQ PGLNIITE
Sbjct  422   VILVVNIALIIFACQYYNESLQLPWWGVLLACGIAVFFTLPIGIINATTNQQPGLNIITE  481

Query  1548  yiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAG  1727
             Y+IGY+YP  PVANMCFKVYGYISM Q + FL DFKLGHYMKIPPR MFM QVVGT+IA 
Sbjct  482   YVIGYLYPERPVANMCFKVYGYISMNQGLTFLADFKLGHYMKIPPRAMFMGQVVGTLIAV  541

Query  1728  FVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYE  1901
              VY  TAWWLM  IP +C TT    ++ WTCP D VF+DASVIWGL+GPRRIFGD G Y 
Sbjct  542   MVYTLTAWWLMGDIPYLCDTTMLPRDSPWTCPMDRVFFDASVIWGLVGPRRIFGDQGEYG  601

Query  1902  AVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGF  2081
              +NWFFL GA+AP+LVWLA KAFP ++WIRLI+MPVL+ +T+ MPPA+AVN+T+WII+GF
Sbjct  602   NINWFFLGGAVAPLLVWLAHKAFPSKKWIRLIHMPVLLGSTAMMPPASAVNFTSWIILGF  661

Query  2082  LSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYA  2261
             LSG+VVFRY+P++W+R+NY+LSG LDAG AFM VLL++ LGL+N+ L+WWGN  +GCP A
Sbjct  662   LSGFVVFRYKPEVWKRYNYILSGGLDAGTAFMTVLLFIALGLQNIGLDWWGNSGEGCPLA  721

Query  2262  SCPSAKGIIVEGCPVI  2309
             +CP+AKGI+V+GCPV+
Sbjct  722   TCPTAKGIMVDGCPVV  737



>ref|XP_004160804.1| PREDICTED: oligopeptide transporter 6-like [Cucumis sativus]
 gb|KGN62862.1| hypothetical protein Csa_2G377980 [Cucumis sativus]
Length=734

 Score =  1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/730 (67%), Positives = 604/730 (83%), Gaps = 5/730 (1%)
 Frame = +3

Query  126   SKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             S+++   LP    ++  PI++V +TVP TDDPSLPVLTFRMW+LG  +CV+LSF+NQFFW
Sbjct  6     SETQSGDLPMMTVDDECPIKQVDITVPKTDDPSLPVLTFRMWILGIAACVILSFVNQFFW  65

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YR+ PL++++I+AQIAVVPLG LMA  +  + FF+ T++EFT+NPGPFN+KEHVLITIFA
Sbjct  66    YRSNPLSVSSIAAQIAVVPLGHLMAKTLPTQPFFKDTRFEFTMNPGPFNIKEHVLITIFA  125

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSGAG+VYA H++TAVK+ Y + + FF +L+I++TTQ+LGFGWAGIFR+YLVEP  MWWP
Sbjct  126   NSGAGSVYATHILTAVKLLYKRQLDFFPALLIMITTQILGFGWAGIFRKYLVEPGEMWWP  185

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             + LVQVSLFRALHEKE+RPK   T TQFF++A ICSF YY+FPGYLF MLTS SW+CWF 
Sbjct  186   STLVQVSLFRALHEKEKRPKQSTTLTQFFLLAMICSFGYYIFPGYLFMMLTSFSWLCWFN  245

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
              +S+L  Q+GSG++GLGIGA G+DWS+ISSYLGSPLASPWFAT NIAVGF L++YV TP+
Sbjct  246   SKSLLLHQMGSGMKGLGIGAFGIDWSTISSYLGSPLASPWFATVNIAVGFVLVMYVMTPL  305

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              YW DV+ AKTFPI+S  LF ++G  YNIS+I++S+FHLD   Y   G++ LSTFFA+TY
Sbjct  306   CYWLDVYEAKTFPIYSSSLFMANGHKYNISSIVNSDFHLDRGVYSTTGRVNLSTFFAMTY  365

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVA  1382
             G+GFA L+AT+VHV+LF+GREI  QSKS+F   RK+DIHT+LM  Y+QVP WWF  ILV 
Sbjct  366   GLGFATLSATVVHVLLFNGREILNQSKSAFGGKRKIDIHTKLMRAYKQVPTWWFIVILVL  425

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             NI L++FAC+YY   LQLPWWG+LLAC IA  FTLPIGII A TNQ PGLNIITEYIIGY
Sbjct  426   NIGLSLFACQYYNISLQLPWWGLLLACFIAFFFTLPIGIICATTNQAPGLNIITEYIIGY  485

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
              YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPP+TMFMAQ+VGT+IA FVY G
Sbjct  486   AYPERPVANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPKTMFMAQIVGTIIAVFVYTG  545

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y AVNWF
Sbjct  546   TAWWLMGSIQDLCDTNLLPDNSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEYGAVNWF  605

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FL GAIAP+LVW+A K FP + WIR I+MPVL+ ATS MPPATAVN+T+W+I GF+ GY 
Sbjct  606   FLGGAIAPLLVWIAHKMFPNKAWIRFIHMPVLLGATSMMPPATAVNFTSWLICGFVFGYY  665

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             +FRY+ + W+R+NY+LSG LDAG AFM +L++L LG  ++S++WWGN+ DGCP ASCPSA
Sbjct  666   LFRYKTEWWKRYNYILSGGLDAGTAFMTILIFLSLG--SISIDWWGNNTDGCPLASCPSA  723

Query  2277  KGIIVEGCPV  2306
             KG++  GCPV
Sbjct  724   KGVVAHGCPV  733



>ref|XP_003628537.1| Oligopeptide transporter [Medicago truncatula]
 gb|AET03013.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=739

 Score =  1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/719 (71%), Positives = 604/719 (84%), Gaps = 3/719 (0%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
             +  ENSPI +VALTVP TDDPSLPV TFR W LGTL+CVLLSFLNQFF +R EPL++TAI
Sbjct  20    SNGENSPIEQVALTVPVTDDPSLPVFTFRTWTLGTLACVLLSFLNQFFGFRREPLSVTAI  79

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVPLG LMA+ IT RVF +G KWEFTLNPG FNVKEHVLITIFA+SGA +VYAIH
Sbjct  80    SAQIAVVPLGHLMASTITKRVFMKGKKWEFTLNPGKFNVKEHVLITIFASSGAASVYAIH  139

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
              V+ VKVFY K IT  V+L++VLTTQVLGFGWAG+FRRYLVEPA MWWP NLVQVSLFRA
Sbjct  140   FVSTVKVFYRKEITVLVALLVVLTTQVLGFGWAGVFRRYLVEPAGMWWPQNLVQVSLFRA  199

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LHEKEER KGG+TR QFF+I FICSFAYYV PGYLF MLTSLSWICW FP S++AQQLGS
Sbjct  200   LHEKEERQKGGLTRNQFFLITFICSFAYYVLPGYLFPMLTSLSWICWVFPNSIIAQQLGS  259

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             GL GLG+GAIG DWSSI SYLGSPLASPWFATANIA GF + +YV  PI Y  ++++ ++
Sbjct  260   GLHGLGVGAIGFDWSSICSYLGSPLASPWFATANIAAGFGIFMYVVVPIAYGLNLYHGRS  319

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPIFSD LF ++GQ YNISAIIDSNFHLDL+AY +EG LYLST FA++YG+ FA L+A L
Sbjct  320   FPIFSDGLFNTNGQEYNISAIIDSNFHLDLDAYQREGPLYLSTMFAMSYGIDFACLSAIL  379

Query  1239  VHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             VHV+LFHG +I + SKS+F+ +++DIHT++M K Y+QVPEWWF+CIL+ +I  + F CEY
Sbjct  380   VHVLLFHGSDILQLSKSAFQGKEIDIHTKIMRKHYKQVPEWWFFCILLFSITASTFVCEY  439

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y +QLQLPWWGV+LAC++A+ FTLP+G+I A TNQ P LN+ITEYIIGYIYPGYPVA M 
Sbjct  440   YNDQLQLPWWGVMLACILALSFTLPVGVIRATTNQAPALNVITEYIIGYIYPGYPVAVML  499

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKV G +SM QAI FLQDFKLGHYMKIPPR MF+AQV+GT+IA  V+L TAWWL+ET+P 
Sbjct  500   FKVIGNVSMKQAIFFLQDFKLGHYMKIPPRAMFLAQVLGTIIAAIVHLLTAWWLIETVPN  559

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             IC        + WTCP DHVFYD+SV+WGLIGPRRIFG+LG Y A+NWFFL GA+AP +V
Sbjct  560   ICHRELLPAGSPWTCPGDHVFYDSSVVWGLIGPRRIFGNLGHYSAINWFFLVGAVAPFIV  619

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLA KA P ++WI+LI MPV++ A + MPPAT VNYT+W++VGF SG+V +RY    W R
Sbjct  620   WLAHKALPDKQWIKLITMPVILGALTEMPPATPVNYTSWVLVGFASGFVAYRYYRGWWTR  679

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             HNYVLSGALDAGLAFMGVL+YLCLG++++SL+WWG+D D CP ASCP+A G+I  GCP+
Sbjct  680   HNYVLSGALDAGLAFMGVLIYLCLGMQHISLDWWGSDPDRCPLASCPTAPGVISAGCPL  738



>ref|XP_007136469.1| hypothetical protein PHAVU_009G047800g [Phaseolus vulgaris]
 gb|ESW08463.1| hypothetical protein PHAVU_009G047800g [Phaseolus vulgaris]
Length=737

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/725 (69%), Positives = 608/725 (84%), Gaps = 3/725 (0%)
 Frame = +3

Query  141   ESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
             +S  E+ + E  P+++V LTVP TDDP++ +LTFRMWVLG +SCVLLSF+NQFFWYRT+P
Sbjct  12    DSESESIKNEECPVKQVELTVPKTDDPNMQILTFRMWVLGVVSCVLLSFVNQFFWYRTQP  71

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             L +T++SAQIAVVP+G  MA  +  RVFF+GT++EF+LN GPFN+KEHVLITIFANSGAG
Sbjct  72    LIVTSVSAQIAVVPIGHFMARTLPTRVFFKGTRFEFSLNRGPFNIKEHVLITIFANSGAG  131

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             TVYA H+++AVK+ Y + + F  +L+++LTTQVLGFGWAG+FR++LVEP  MWWP+NLVQ
Sbjct  132   TVYATHILSAVKLMYKRKLDFLPALLVMLTTQVLGFGWAGLFRKFLVEPGEMWWPSNLVQ  191

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLF ALHEK +RPKGG TRTQFF++  +   AYYVFPGYLF MLTS SW+CW  P+S+L
Sbjct  192   VSLFSALHEKGKRPKGGTTRTQFFLLVLVSGLAYYVFPGYLFSMLTSFSWMCWVAPKSIL  251

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
              QQLGSGL+GLGI A G DWS+ISSYLGSPLASPWFATANIAVGFFL++YV TPI YW +
Sbjct  252   VQQLGSGLRGLGIAAFGFDWSTISSYLGSPLASPWFATANIAVGFFLVMYVMTPISYWFN  311

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
              +NAKTFPIFS +LF  +G  Y+IS I++S+FHLD  AY   G ++LSTFFA+TYG+GFA
Sbjct  312   AYNAKTFPIFSSKLFRGNGSLYDISTIVNSDFHLDRHAYSINGPVHLSTFFAMTYGLGFA  371

Query  1221  ALTATLVHVVLFHGREIWEQSKSSFKD-RKMDIHTRLMSKYRQVPEWWFWCILVANIALT  1397
             AL+AT+VHV+LFHGREIW QS+ +F + +KMDIHTRLM +Y+ VP WWF+ ILV NIAL 
Sbjct  372   ALSATVVHVLLFHGREIWNQSRRAFGNSKKMDIHTRLMKRYKSVPTWWFYIILVVNIALI  431

Query  1398  VFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgy  1577
             +F CE+Y+E LQLPWWGVLLAC I+I FTLPIGII A TNQ PGLNIITEYIIGY+YP  
Sbjct  432   IFICEHYEESLQLPWWGVLLACAISIFFTLPIGIINATTNQQPGLNIITEYIIGYMYPER  491

Query  1578  pVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWL  1757
             PVANMCFKVYGYISMTQA+ FLQDFKLGHYMKIPPRTMFMAQV GT+++ FVY  TAWWL
Sbjct  492   PVANMCFKVYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVAGTILSVFVYTITAWWL  551

Query  1758  METIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGA  1931
             M TIP +C TT    ++ WTCP D+VF+DASVIWGL+GPRRIFG+LG Y  VN+FFL GA
Sbjct  552   MGTIPNLCDTTILPPDSPWTCPMDNVFFDASVIWGLLGPRRIFGNLGEYAKVNFFFLGGA  611

Query  1932  IAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYR  2111
             IAP LVWLA KAFPGQ+WI LI+MPVL+ ATS MPPATAVN+T+WI++ FLSG+VV+RY+
Sbjct  612   IAPFLVWLAHKAFPGQKWITLIHMPVLLGATSIMPPATAVNFTSWILLAFLSGFVVYRYK  671

Query  2112  PDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIV  2291
                W+R NYVLSG LDAG AFM +LL+L L   N+ LNWWGN+ +GCP A+CP+ KGI++
Sbjct  672   QQWWKRCNYVLSGGLDAGTAFMTILLFLALNNNNILLNWWGNNPEGCPLATCPTEKGIVI  731

Query  2292  EGCPV  2306
             +GCPV
Sbjct  732   KGCPV  736



>ref|XP_003527991.1| PREDICTED: oligopeptide transporter 9-like [Glycine max]
Length=738

 Score =  1003 bits (2592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/727 (69%), Positives = 603/727 (83%), Gaps = 11/727 (2%)
 Frame = +3

Query  159   AEEENS--------PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRT  314
             +E+EN+        P+++V LTVP TDDP++ +LTFRMWVLG LSCVLLSF+NQFFWYRT
Sbjct  11    SEKENTVESEEEECPVKQVELTVPKTDDPTMQLLTFRMWVLGVLSCVLLSFVNQFFWYRT  70

Query  315   EPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSG  494
             +PL +T+ISAQIAVVP+G  MA  +  RVFF+ +++EF+LN GPFN+KEHVLITIFANSG
Sbjct  71    QPLIVTSISAQIAVVPIGHFMARTLPTRVFFKDSRFEFSLNRGPFNIKEHVLITIFANSG  130

Query  495   AGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANL  674
             AGTVYA H+++AVK+ Y + + F  +L+++LTTQ+LGFGWAG+FR++LVEP  MWWP+NL
Sbjct  131   AGTVYATHILSAVKLMYKRRLDFLPALLVMLTTQILGFGWAGLFRKFLVEPGEMWWPSNL  190

Query  675   VQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRS  854
             VQVSLF ALHEK +RPKGG TRTQFF++  +   AYYVFPGYLF MLTS SW+CW  P+S
Sbjct  191   VQVSLFSALHEKSKRPKGGTTRTQFFLLVLVSGLAYYVFPGYLFSMLTSFSWMCWLAPKS  250

Query  855   VlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW  1034
             VL QQLGSGL+GLGI A G+DWS+IS+YLGSPLASPWFATANIAVGFFL++YV TPI YW
Sbjct  251   VLVQQLGSGLRGLGIAAFGIDWSTISAYLGSPLASPWFATANIAVGFFLVMYVMTPIAYW  310

Query  1035  CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVG  1214
              + + AKTFPIFS +LF  +G  Y+IS I++S FHLD +AY   G ++LSTFFA+TYG+G
Sbjct  311   SNAYEAKTFPIFSSKLFMGNGSLYDISTIVNSEFHLDRQAYSINGPVHLSTFFAMTYGLG  370

Query  1215  FAALTATLVHVVLFHGREIWEQSKSSFKD-RKMDIHTRLMSKYRQVPEWWFWCILVANIA  1391
             FAAL+AT+VHV+LFHGREI  QSK +F + +K+DIHTRLM +Y+ VP WWF+ IL ANIA
Sbjct  371   FAALSATVVHVLLFHGREILMQSKRAFGNSKKIDIHTRLMRRYKSVPTWWFYIILAANIA  430

Query  1392  LTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiyp  1571
             L +F CEYY E LQLPWWGVLLAC I+I FTLPIGII A TNQ PGLNIITEYIIGY+YP
Sbjct  431   LIIFICEYYNESLQLPWWGVLLACAISIFFTLPIGIINATTNQQPGLNIITEYIIGYMYP  490

Query  1572  gypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAW  1751
               PVANMCFKVYGYISM QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+++ F+Y  TAW
Sbjct  491   ERPVANMCFKVYGYISMVQALTFLQDFKLGHYMKIPPRTMFMAQVVGTILSVFIYTVTAW  550

Query  1752  WLMETIPEICQTTAT--NTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLA  1925
             WLM TIP +C TT    ++ WTCP D+VF+DASVIWGL+GPRRIFGDLG Y  VN FFL 
Sbjct  551   WLMRTIPHLCDTTMLDPDSPWTCPMDNVFFDASVIWGLLGPRRIFGDLGEYAKVNLFFLG  610

Query  1926  GAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFR  2105
             GAIAP LVWLA KAFP Q WI LI+MPVL+ ATS MPPATAVN+T+WI+VGFLSGY+ +R
Sbjct  611   GAIAPFLVWLAHKAFPEQRWITLIHMPVLLGATSMMPPATAVNFTSWILVGFLSGYIAYR  670

Query  2106  YRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGI  2285
             YR + W+R NYVLSG LDAG AFM +LL+L L   N+ LNWWGN+ +GCP A+CP+ KGI
Sbjct  671   YRQEWWKRCNYVLSGGLDAGTAFMTILLFLALNNNNIMLNWWGNNPEGCPLANCPTEKGI  730

Query  2286  IVEGCPV  2306
             +V+GCPV
Sbjct  731   VVKGCPV  737



>ref|XP_008445079.1| PREDICTED: oligopeptide transporter 6-like [Cucumis melo]
 ref|XP_008445080.1| PREDICTED: oligopeptide transporter 6-like [Cucumis melo]
Length=737

 Score =  1002 bits (2590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/735 (67%), Positives = 604/735 (82%), Gaps = 10/735 (1%)
 Frame = +3

Query  126   SKSKVESLPEAAE-----EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFL  290
             S S V  +P A       ++  PI++V +TVP TDDP+LPVLTFRMWVLG  +CV+LSF+
Sbjct  4     STSVVSEIPTAEPADVTVDDACPIKQVDITVPKTDDPNLPVLTFRMWVLGIAACVILSFV  63

Query  291   NQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVL  470
             NQFFWYR+ PL++++I+AQIAVVPLG LMA  +  + FF+GT++EF++NPGPFN+KEHVL
Sbjct  64    NQFFWYRSNPLSVSSIAAQIAVVPLGHLMAKTLPTQPFFKGTRFEFSMNPGPFNIKEHVL  123

Query  471   ITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             ITIFANSGAG+VYA H++TAVK+ Y + +TF  +L+I+ TTQ+LGFGWAGIFR+YLVEP 
Sbjct  124   ITIFANSGAGSVYATHILTAVKLLYKRQLTFVPALLIMFTTQILGFGWAGIFRKYLVEPG  183

Query  651   AMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSW  830
              MWWP+NLVQVSLFRALHEKE+RPK   TRTQFF++A ICSFAYYVFPGYLF MLTS SW
Sbjct  184   EMWWPSNLVQVSLFRALHEKEKRPKRSTTRTQFFLLAMICSFAYYVFPGYLFMMLTSFSW  243

Query  831   ICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILY  1010
             +CWF   S+L  Q+GSG+ GLG+GA G+DWS+ISSYLGSPLASPWFATAN+AVGF +++Y
Sbjct  244   LCWFNSNSLLLHQVGSGMNGLGLGAFGIDWSTISSYLGSPLASPWFATANVAVGFVIVMY  303

Query  1011  VFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTF  1190
             V TP+ YW +V+ AK FPI+S  LF ++G  YNIS+I++S+FHLD   Y   G + LSTF
Sbjct  304   VMTPLSYWLNVYGAKRFPIYSSSLFMANGHEYNISSIVNSDFHLDRSVYSTTGPVNLSTF  363

Query  1191  FALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFW  1367
             FA+TYG+GFA L+AT++HV LF+GR++  QS S+F   RK+DIHT+LM  Y+QVP WWF 
Sbjct  364   FAMTYGLGFATLSATVMHVFLFNGRDLLNQSMSAFGGKRKIDIHTKLMQAYKQVPTWWFI  423

Query  1368  CILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITE  1547
              ILV NIAL++FAC+YY   LQLPWWGVLLAC IA  FTLPIGII A TNQ PGLNIITE
Sbjct  424   IILVLNIALSIFACQYYNASLQLPWWGVLLACFIAFFFTLPIGIINATTNQAPGLNIITE  483

Query  1548  yiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAG  1727
             YIIGY YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPRTMFMAQVVGT+IA 
Sbjct  484   YIIGYAYPERPVANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPRTMFMAQVVGTIIAV  543

Query  1728  FVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYE  1901
             FVY+GTAWWLM +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y 
Sbjct  544   FVYIGTAWWLMGSIQDLCDTNLLPENSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEYG  603

Query  1902  AVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGF  2081
             AVNWFFL GAIAP+LVW+A K FP + WIRLI+MPVL+ ATS MPPA+AVN+T+W+  GF
Sbjct  604   AVNWFFLGGAIAPLLVWIAHKMFPNKTWIRLIHMPVLLGATSMMPPASAVNFTSWLTCGF  663

Query  2082  LSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYA  2261
             L GY +FRY+ + W+R+NY+LSG LDAG AF+ +L++L LG + +  +WWGN+ DGCP A
Sbjct  664   LFGYFLFRYKTEWWKRYNYILSGGLDAGTAFITILVFLTLGSKGI--DWWGNNTDGCPLA  721

Query  2262  SCPSAKGIIVEGCPV  2306
             SCPSA+G++V+GCPV
Sbjct  722   SCPSARGVVVDGCPV  736



>ref|XP_008445076.1| PREDICTED: oligopeptide transporter 6-like [Cucumis melo]
 ref|XP_008445077.1| PREDICTED: oligopeptide transporter 6-like [Cucumis melo]
 ref|XP_008445078.1| PREDICTED: oligopeptide transporter 6-like [Cucumis melo]
Length=734

 Score =  1001 bits (2588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/730 (67%), Positives = 601/730 (82%), Gaps = 5/730 (1%)
 Frame = +3

Query  126   SKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             S+++   LP    ++  PI++V +TVP TDDP+LPVLTFRMW+LG  +CV+LSF+NQFFW
Sbjct  6     SETQSGDLPMTTVDDECPIKQVDITVPKTDDPNLPVLTFRMWILGIAACVILSFVNQFFW  65

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YRT PL++++I+AQIAVVPLG LMA  +  + FF+ T++EFT+NPGPFN+KEHVLITIFA
Sbjct  66    YRTNPLSVSSIAAQIAVVPLGHLMAKTLPTQPFFKDTRFEFTMNPGPFNIKEHVLITIFA  125

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSGAG+VYA H++TAVK+ Y + + FF +L+++LTTQVLGFGWAGIFR+YLVEP  MWWP
Sbjct  126   NSGAGSVYATHILTAVKLLYKRQLHFFPALLVMLTTQVLGFGWAGIFRKYLVEPGEMWWP  185

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             + LVQVSLFRALHEKE+RPK   T  QFF++A ICSFAYYVFPGYLF MLTS SW+CWF 
Sbjct  186   STLVQVSLFRALHEKEKRPKQSTTLIQFFLLALICSFAYYVFPGYLFMMLTSFSWLCWFN  245

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
              +S+L  Q+GSG++GLGIGA G+DWS+ISSYLGSPLASPWFAT NIAVGF L++YV TP+
Sbjct  246   SKSLLLHQMGSGMKGLGIGAFGIDWSTISSYLGSPLASPWFATVNIAVGFVLVMYVMTPL  305

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              YW +V+ AK FPI+S  LF ++G  YNIS+I++S+FHLD   Y   G++ LSTFFA+TY
Sbjct  306   CYWLNVYEAKKFPIYSSSLFMANGHKYNISSIVNSDFHLDRGVYSTTGRVNLSTFFAMTY  365

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVA  1382
             G+GFA L+AT+VHV+LF+G EI  QSKS+F   RK+DIHT+LM  Y+QVP WWF  ILV 
Sbjct  366   GLGFATLSATVVHVLLFNGSEILNQSKSAFGGKRKIDIHTKLMRAYKQVPTWWFVVILVL  425

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             NI L++FAC+YY   LQLPWWG+LLAC IA  FTLPIGII A TNQ PGLNIITEYIIGY
Sbjct  426   NIGLSLFACQYYNISLQLPWWGLLLACFIAFFFTLPIGIIYATTNQAPGLNIITEYIIGY  485

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
              YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPRTMFMAQVVGT+IA FVY G
Sbjct  486   AYPERPVANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPRTMFMAQVVGTIIAVFVYTG  545

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y AVNWF
Sbjct  546   TAWWLMGSIQDLCDTNLLPDNSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEYGAVNWF  605

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FL GAIAP+LVW+A K FP + WIRLI+MPVL+ ATS MPPA AVN+T+W+I GF+ GY 
Sbjct  606   FLGGAIAPLLVWIAHKMFPNKTWIRLIHMPVLLGATSMMPPAAAVNFTSWLICGFVFGYY  665

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             +FRY+ + W+R+NY+LSG LDAG AFM + ++L LG  ++S++WWGN+ DGCP ASCPSA
Sbjct  666   LFRYKTEWWKRYNYILSGGLDAGTAFMTIFIFLSLG--SISIDWWGNNTDGCPLASCPSA  723

Query  2277  KGIIVEGCPV  2306
             KG++  GCPV
Sbjct  724   KGVVAHGCPV  733



>ref|XP_008234693.1| PREDICTED: oligopeptide transporter 6-like [Prunus mume]
Length=729

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/721 (68%), Positives = 598/721 (83%), Gaps = 7/721 (1%)
 Frame = +3

Query  156   AAEEENS--PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTI  329
             A++EEN   PI++V LTVP TDDP++PVLTFRMWVLG  SC+LLSF+NQFFWYRT+PL+I
Sbjct  11    ASDEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQFFWYRTQPLSI  70

Query  330   TAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVY  509
             T+ISAQIAV+P+G LMA  +  R+ F+GT++EFT+NPGPFN+KEHVLITIFANSGAG+VY
Sbjct  71    TSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLITIFANSGAGSVY  130

Query  510   AIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSL  689
             A H+++AVK+FY + +TF  +L+++ TTQVLGFGWAGIFRR LV+P  MWWP+NLVQVSL
Sbjct  131   ATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVDPVQMWWPSNLVQVSL  190

Query  690   FRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqq  869
             FRALHEKE+RPKGG++RTQFF++  ICSFAYY+FPGYLF M+TS SW+CW  P+SVL QQ
Sbjct  191   FRALHEKEKRPKGGMSRTQFFLVVMICSFAYYIFPGYLFVMITSFSWVCWLAPKSVLVQQ  250

Query  870   lgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFN  1049
             LGSGL+GLGIG+ G+DWS+ISSYLGSPLASPWFATANIA GF L++YV TPI YW D +N
Sbjct  251   LGSGLRGLGIGSFGIDWSTISSYLGSPLASPWFATANIAFGFALVMYVMTPITYWLDFYN  310

Query  1050  AKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALT  1229
             AK FPIFS +LF S+G  Y++ +IIDS F LD   Y + G + LSTFFA+TYG+GFA L 
Sbjct  311   AKKFPIFSSDLFMSNGTKYDVLSIIDSKFQLDHGMYTKTGPVNLSTFFAMTYGLGFATLP  370

Query  1230  ATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFAC  1409
             ATL+HV+LF+  ++    +   + +K+DIH RLM  Y+ VP WWF  ILV NIAL  FAC
Sbjct  371   ATLMHVLLFNISDLRNAYR---RQKKLDIHARLMKHYKSVPTWWFLAILVVNIALIFFAC  427

Query  1410  EYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVAN  1589
             +YY E LQLPWWGVLLAC IAI++T+PIGIITA TNQ PGLNIITEY+IGY+YP +PVAN
Sbjct  428   QYYSESLQLPWWGVLLACAIAIVYTVPIGIITATTNQQPGLNIITEYVIGYLYPEHPVAN  487

Query  1590  MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETI  1769
             MCFKVYGYISMTQA+ FL DFKLGHYMKIPPR MF AQVVGT++A  VYLGTAWWLM  I
Sbjct  488   MCFKVYGYISMTQALTFLADFKLGHYMKIPPRAMFTAQVVGTIVAVIVYLGTAWWLMGDI  547

Query  1770  PEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
             P +C T+    ++ WTCP D VF+DASVIWGL+GPRRIFG+LG Y  VNWFFL GAIAP 
Sbjct  548   PNLCDTSKLPQDSPWTCPMDRVFFDASVIWGLVGPRRIFGNLGEYMNVNWFFLGGAIAPA  607

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
             LV LA  AFP   WIR INMP+L+ ATS MPPA+AVN+T+WI+VGFL G+VV+RYRPD+W
Sbjct  608   LVKLAHWAFPKHNWIRFINMPILLGATSMMPPASAVNFTSWILVGFLFGFVVYRYRPDVW  667

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
              R+NYVLSG LDAG AF+ +L++L L   N+ L+WWGN  +GCP A+CP+AKG++V+GCP
Sbjct  668   SRYNYVLSGGLDAGTAFVTILMFLTLQSRNIGLDWWGNRGEGCPLAACPTAKGVVVDGCP  727

Query  2304  V  2306
             V
Sbjct  728   V  728



>ref|XP_007220230.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
 gb|EMJ21429.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
Length=729

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/721 (68%), Positives = 598/721 (83%), Gaps = 7/721 (1%)
 Frame = +3

Query  156   AAEEENS--PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTI  329
             A+EEEN   PI++V LTVP TDDP++PVLTFRMWVLG  SC+LLSF+NQFFWYRT+PL+I
Sbjct  11    ASEEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQFFWYRTQPLSI  70

Query  330   TAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVY  509
             T+ISAQIAV+P+G LMA  +  R+ F+GT++EFT+NPGPFN+KEHVLITIFANSGAG+VY
Sbjct  71    TSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLITIFANSGAGSVY  130

Query  510   AIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSL  689
             A H+++AVK+FY + +TF  +L+++ TTQVLGFGWAGIFRR LV+P  MWWP+NLVQVSL
Sbjct  131   ATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVDPVQMWWPSNLVQVSL  190

Query  690   FRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqq  869
             FRALHEKE+RPKGG++RTQFF++  ICSFAYY+FPGYLF M+TS SW+CW  P+SVL QQ
Sbjct  191   FRALHEKEKRPKGGMSRTQFFLVVMICSFAYYIFPGYLFIMITSFSWVCWLAPKSVLVQQ  250

Query  870   lgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFN  1049
             LGSGL+GLGIG+ G+DWS+ISSYLGSPLASPWFATANIA GF L++YV TPI YW D +N
Sbjct  251   LGSGLRGLGIGSFGIDWSTISSYLGSPLASPWFATANIAFGFALVMYVMTPITYWLDFYN  310

Query  1050  AKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALT  1229
             AK FPIFS +LF S+G  Y++ +IIDS F LD   Y + G + LSTFFA+TYG+GFA L 
Sbjct  311   AKKFPIFSSDLFMSNGTKYDVLSIIDSKFQLDHGMYTKTGPVNLSTFFAMTYGLGFATLP  370

Query  1230  ATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFAC  1409
             ATL+HV+LF+   I + + +  + +K+DIH RLM  Y+ VP WWF  ILV NIAL  FAC
Sbjct  371   ATLMHVLLFN---ISDLTNAYRRQKKLDIHARLMKHYKSVPTWWFLAILVVNIALIFFAC  427

Query  1410  EYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVAN  1589
             +YY E LQLPWWGVLLAC IAI++T+PIGIITA TNQ PGLNIITEY+IGY+YP +PVAN
Sbjct  428   QYYSESLQLPWWGVLLACAIAIVYTVPIGIITATTNQQPGLNIITEYVIGYLYPEHPVAN  487

Query  1590  MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETI  1769
             MCFKVYGYISMTQA+ FL DFKLGHYMKIPPR MF AQVVGT++A  VYLGTAWWLM  I
Sbjct  488   MCFKVYGYISMTQALTFLADFKLGHYMKIPPRAMFTAQVVGTIVAVIVYLGTAWWLMGDI  547

Query  1770  PEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
             P +C T+    ++ WTCP D VF+DASVIWGL+GPRRIFG+LG Y  VNWFFL GAIAP 
Sbjct  548   PNLCDTSKLPQDSPWTCPMDRVFFDASVIWGLVGPRRIFGNLGEYMNVNWFFLGGAIAPA  607

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
             LV LA  AFP   WI  INMP+L+ ATS MPPA+AVN+T+WI+VGFL G+VV+RYRPD+W
Sbjct  608   LVKLAHLAFPKHNWICFINMPILLGATSMMPPASAVNFTSWILVGFLFGFVVYRYRPDVW  667

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
              R+NYVLSG LDAG AF+ +L++L L   N+ L+WWGN  +GCP A+CP+AKG++V+GCP
Sbjct  668   SRYNYVLSGGLDAGTAFVTILMFLTLQSRNIGLDWWGNRGEGCPLAACPTAKGVVVDGCP  727

Query  2304  V  2306
             V
Sbjct  728   V  728



>ref|XP_011043662.1| PREDICTED: oligopeptide transporter 9-like [Populus euphratica]
Length=732

 Score =   993 bits (2568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/729 (66%), Positives = 606/729 (83%), Gaps = 6/729 (1%)
 Frame = +3

Query  132   SKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYR  311
             S+++++   A+ E   I++V LTVP TDDP++ VLTFRMWVLG  SC++LS +NQFFWYR
Sbjct  5     SEIKAVEIEADHEECSIKQVDLTVPKTDDPTMSVLTFRMWVLGLGSCIILSSVNQFFWYR  64

Query  312   TEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANS  491
             ++PLT+++ISAQIAVVPLG LMA +++ R FF GT+WEF LNPGPFN+KEHVLITIFANS
Sbjct  65    SQPLTVSSISAQIAVVPLGHLMAKKLSTRKFFEGTRWEFALNPGPFNIKEHVLITIFANS  124

Query  492   GAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
             GAGTVYA H++T+VK++Y + +TF  +L I++TTQ+LGFGWAGIFR+YLVEP  MWWP+N
Sbjct  125   GAGTVYAAHILTSVKIYYQRKLTFIPALFIMITTQMLGFGWAGIFRKYLVEPGEMWWPSN  184

Query  672   LVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPR  851
             LVQVSLFRALHE+E RPKGG TRTQ+F++  I +FAYY+ PGYLF ML+S SW+CW   +
Sbjct  185   LVQVSLFRALHERERRPKGGTTRTQYFLLVMISAFAYYILPGYLFTMLSSFSWVCWLGSK  244

Query  852   SVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFY  1031
             SVL QQLGSGL G GIGA+G DW++ISSYLGSPLASPWFATAN+AVGFFLI+YV TP+ Y
Sbjct  245   SVLVQQLGSGLSGFGIGAVGFDWATISSYLGSPLASPWFATANVAVGFFLIMYVMTPLCY  304

Query  1032  WCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGV  1211
               +V+NAK FP++S++L+T++GQ Y I  II+S FHLD +AY + G +++STFFA+TYG+
Sbjct  305   CLNVYNAKNFPLYSNDLYTATGQEYKILEIINSKFHLDRDAYAEHGPVHMSTFFAMTYGL  364

Query  1212  GFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWFWCILVANI  1388
             GFA L+AT++HV+LF G ++W+QSK +F   RKMDIHTRLM KY+ +P WWF+ ILVANI
Sbjct  365   GFATLSATVMHVLLFSGSDLWKQSKMAFGARRKMDIHTRLMKKYKSIPMWWFFLILVANI  424

Query  1389  ALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiy  1568
             A  +FACE+Y   LQL WWGVLLAC IA  FTLPIGII+A TNQ PGLNIITEYIIGY+Y
Sbjct  425   AAIIFACEHYNAALQLRWWGVLLACAIAFFFTLPIGIISATTNQQPGLNIITEYIIGYLY  484

Query  1569  pgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTA  1748
             P  PVANMCFKVYGYISM QA+ FL DFKLGHYMKIPPR+MFMAQVVGT++A  VYLGTA
Sbjct  485   PERPVANMCFKVYGYISMAQALTFLADFKLGHYMKIPPRSMFMAQVVGTLVAVLVYLGTA  544

Query  1749  WWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             WW+M+ +P +C   A N  W CP D VF++ASVIWGL+GPRRIFG+LG Y  VNWFFL G
Sbjct  545   WWMMDAVPNLC--AADNGPWRCPQDSVFFNASVIWGLVGPRRIFGNLGEYGNVNWFFLGG  602

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             A+AP++VW+  KAFP + WI LI+MP+++ AT+ MPPA++VNYT+WII+GFLSGYV+FR+
Sbjct  603   AVAPLIVWIFHKAFPSKTWIGLIHMPIMLGATAMMPPASSVNYTSWIIIGFLSGYVLFRH  662

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLD---GCPYASCPSAK  2279
             R + W+R+NYVLSG LDAG AFM +L++  LG  NV L WWG++ D   GCP ASCP+AK
Sbjct  663   RTEWWKRYNYVLSGGLDAGTAFMTLLIFFGLGFWNVGLLWWGSNPDNQEGCPLASCPTAK  722

Query  2280  GIIVEGCPV  2306
             GI+V+GCPV
Sbjct  723   GILVDGCPV  731



>ref|XP_007039132.1| Oligopeptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY23633.1| Oligopeptide transporter 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/728 (68%), Positives = 604/728 (83%), Gaps = 4/728 (1%)
 Frame = +3

Query  132   SKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYR  311
             S+++++ E    E  P+++V LTVP TDDP+LP +TFRMWVLG  + V+LSF+NQFFWYR
Sbjct  5     SEIQAM-ELEVVEECPVKQVELTVPKTDDPTLPAVTFRMWVLGLGTSVILSFVNQFFWYR  63

Query  312   TEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANS  491
               PL IT+ISA IAVVPLG LMA  +  R F   T+WEFT+NPGPFN+KEHVLITIFANS
Sbjct  64    KMPLNITSISAMIAVVPLGHLMARTLPHRRFLSNTRWEFTMNPGPFNMKEHVLITIFANS  123

Query  492   GAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
             GAGTVYA H+++AVK++Y + +TF  +L++++TTQVLGFGWAGIFR+YLVEP  MWWP+N
Sbjct  124   GAGTVYATHILSAVKLYYKRKLTFLPALLVMITTQVLGFGWAGIFRKYLVEPGEMWWPSN  183

Query  672   LVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPR  851
             LV VSLFRALHEKE+R KGG T  QFF++  I SFAYYV PGYLF  LTS SW+CW  P+
Sbjct  184   LVMVSLFRALHEKEKRAKGGTTLNQFFLLVLISSFAYYVLPGYLFSTLTSFSWVCWLAPK  243

Query  852   SVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFY  1031
             S+L QQLGSGL GLGIG+ G+DW++ISSYLGSPLASPWFATANIAVGFFL++YV TP+ Y
Sbjct  244   SILVQQLGSGLHGLGIGSFGIDWATISSYLGSPLASPWFATANIAVGFFLVMYVMTPLTY  303

Query  1032  WCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGV  1211
             W DV+ AK FPI+S ELF S+G++Y+I +I++  FHLD + Y Q G+++LSTFFA+TYG+
Sbjct  304   WFDVYKAKNFPIYSSELFKSNGESYDILSIVNPMFHLDKKVYAQNGRVHLSTFFAMTYGL  363

Query  1212  GFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSKYRQVPEWWFWCILVANI  1388
             GFA LTAT+ HV+LF GRE+W Q+KS+FK D+KMDIHT+LM KY+ VP WWF  IL++NI
Sbjct  364   GFATLTATIFHVLLFDGRELWRQTKSAFKGDKKMDIHTKLMQKYKLVPTWWFVVILLSNI  423

Query  1389  ALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiy  1568
             AL +FACE+Y E LQLPWWGVLLAC IA  FTLPIGII A TNQ PGLNIITEY+IGY+Y
Sbjct  424   ALILFACEHYNESLQLPWWGVLLACAIAFFFTLPIGIIAATTNQAPGLNIITEYVIGYMY  483

Query  1569  pgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTA  1748
             P +PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY  TA
Sbjct  484   PEHPVANMCFKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTITA  543

Query  1749  WWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFL  1922
             WWLME IP +C T+    ++ WTCP D VF+DASVIWGL+GPRRIFG  G Y  VNWFFL
Sbjct  544   WWLMEEIPHLCDTSLLPPDSPWTCPMDRVFFDASVIWGLVGPRRIFGVEGEYGNVNWFFL  603

Query  1923  AGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVF  2102
             AGA+APVLVWLA K FP +EWIRLI+MPVLI ATS MPPA+AVN+++W+IVGFLSG+VVF
Sbjct  604   AGAVAPVLVWLAHKTFPNREWIRLIHMPVLIGATSMMPPASAVNFSSWLIVGFLSGFVVF  663

Query  2103  RYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKG  2282
             +YRP  W+R+NYVLSG LDAG AFM VLL++ L  +++ L WWGN  +GCP A+CP+AKG
Sbjct  664   KYRPQWWKRYNYVLSGGLDAGTAFMTVLLFITLQSKDIDLQWWGNKGEGCPLAACPTAKG  723

Query  2283  IIVEGCPV  2306
             ++ +GCPV
Sbjct  724   VMADGCPV  731



>ref|XP_006656581.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=719

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/758 (68%), Positives = 593/758 (78%), Gaps = 69/758 (9%)
 Frame = +3

Query  54    ADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPV  233
              D I +PLL             S+S+   E   E  E  NSPI +VALTVP  D+P  P 
Sbjct  22    GDRITSPLLRP-----------STSRGSPEHGGEVVE--NSPIEQVALTVPVGDEPETPG  68

Query  234   LTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRG  413
             LTFRM   G                                                 RG
Sbjct  69    LTFRMVGAG-------------------------------------------------RG  79

Query  414   TKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTT  593
               WEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV+TAV+VFYGK I+ FVSL++VLTT
Sbjct  80    RPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKPISLFVSLLVVLTT  139

Query  594   QV-----LGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             QV     LGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TR QFF++
Sbjct  140   QVHQDQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARKKGGMTRNQFFLV  199

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
             AFICSFAYY+FPGYLFQMLTS+SWICW FP SVLA QLGSGL+GLGI AIGLDWS++SSY
Sbjct  200   AFICSFAYYIFPGYLFQMLTSVSWICWVFPHSVLAHQLGSGLRGLGIAAIGLDWSTVSSY  259

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISA  1118
             LGSPLASPWFAT N+  GFF+I+Y+ TPI YW + + A+ FPIFSD LFTS+GQ YNIS+
Sbjct  260   LGSPLASPWFATVNVGAGFFIIMYIITPIIYWFNFYKAQNFPIFSDGLFTSTGQKYNISS  319

Query  1119  IIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFK  1298
             I+DS F  D  AY++ G LY+STFF +TYGVGFA LTAT+VHV+LFHG EIW+ SKS+F 
Sbjct  320   IVDSQFQFDAVAYEKNGPLYISTFFVVTYGVGFATLTATIVHVLLFHGSEIWQLSKSAFN  379

Query  1299  DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAII  1478
             +R+MD+HT+LM +Y+QVPEWWF CIL+++I +++FAC Y  E LQLPWWG LLAC +A  
Sbjct  380   ERRMDVHTKLMRRYKQVPEWWFVCILISSIVMSIFACAYNIEMLQLPWWGFLLACTVAFF  439

Query  1479  FTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKL  1658
             FTLPIGII A TNQTP LN+ITEYIIGY+YPG PVANMCFKVYGYISM QA+AFL+DFKL
Sbjct  440   FTLPIGIIKATTNQTPALNVITEYIIGYLYPGRPVANMCFKVYGYISMKQALAFLEDFKL  499

Query  1659  GHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVF  1832
             GHYMKIPPRTMFMAQVVGT IA FV++GTAWW+MET+P IC T   ++++ WTCP DHVF
Sbjct  500   GHYMKIPPRTMFMAQVVGTSIAAFVHIGTAWWMMETVPNICNTELLSSDSPWTCPGDHVF  559

Query  1833  YDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVL  2012
             YDASVIWGLIGPRRIFGDLGTY AVNWFFL GAIAP+L+W   K+FP Q WI LIN+PVL
Sbjct  560   YDASVIWGLIGPRRIFGDLGTYSAVNWFFLGGAIAPLLIWFTHKSFPSQSWILLINIPVL  619

Query  2013  ISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLY  2192
             I +T  MPPATAVNYTTWI+ GFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+Y
Sbjct  620   IGSTVQMPPATAVNYTTWILFGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIY  679

Query  2193  LCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
              CLGLEN+SLNWWGNDLDGCP ASCP+AKG++V+GCPV
Sbjct  680   FCLGLENISLNWWGNDLDGCPLASCPTAKGVVVDGCPV  717



>ref|XP_004160803.1| PREDICTED: oligopeptide transporter 6-like [Cucumis sativus]
 gb|KGN62864.1| hypothetical protein Csa_2G377985 [Cucumis sativus]
Length=735

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/736 (67%), Positives = 610/736 (83%), Gaps = 9/736 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAE---EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             +SS  S+++S  E AE   ++  PI++V +TVP TDDP+LPVLTFRMW+LG  +CV+LSF
Sbjct  2     SSSVVSEIQS-AEPAEVTVDDACPIKQVDITVPKTDDPNLPVLTFRMWILGIAACVILSF  60

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHV  467
             +NQFFWYR+ PL++++I+AQIAVVPLG L+A  +  + FF+GT++EFT+NPGPFN+KEHV
Sbjct  61    VNQFFWYRSNPLSVSSIAAQIAVVPLGHLLAKTLPTQQFFKGTRFEFTMNPGPFNIKEHV  120

Query  468   LITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             LITIFANSGAG+VYA H++TAVK+ Y + +TF  +L+I+ TTQ+LGFGWAGIFR+YLVEP
Sbjct  121   LITIFANSGAGSVYATHILTAVKLLYKRQLTFVPALLIMFTTQILGFGWAGIFRKYLVEP  180

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
               MWWP+NLVQVSLFRALH+KE+RPK   TRTQFF++A ICSFAYYVFPGYL  MLTS S
Sbjct  181   GEMWWPSNLVQVSLFRALHDKEKRPKRSTTRTQFFLLAMICSFAYYVFPGYLVMMLTSFS  240

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CWF   S+L  Q+GSG+ GLG+GA G+DWS+ISSYLGSPLASPWFATAN+AVGF +++
Sbjct  241   WLCWFNSNSLLLHQVGSGMNGLGLGAFGIDWSTISSYLGSPLASPWFATANVAVGFVIVM  300

Query  1008  YVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLST  1187
             YV TP+ YW +V+ AK FPI+S  LF ++G  YNIS+I++SNFHLD   Y   G + LST
Sbjct  301   YVMTPLSYWLNVYGAKRFPIYSSSLFMANGHEYNISSIVNSNFHLDRGVYSTTGPVNLST  360

Query  1188  FFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWF  1364
             FFALTYG+GFA L+AT++HV LF+GRE+  QS S+F   RK+DIHT+LM  Y+QVP WWF
Sbjct  361   FFALTYGLGFATLSATVMHVFLFNGRELLNQSMSAFGGKRKIDIHTKLMQAYKQVPTWWF  420

Query  1365  WCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIIT  1544
               IL+ NIAL+VFAC+YY   LQLPWWGVLLAC IA+ FTLPIGII A TNQ PGLNIIT
Sbjct  421   IIILILNIALSVFACQYYNASLQLPWWGVLLACFIALFFTLPIGIINATTNQAPGLNIIT  480

Query  1545  EyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIA  1724
             EYIIGY YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPRTMFMAQVVGT+IA
Sbjct  481   EYIIGYAYPERPVANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPRTMFMAQVVGTIIA  540

Query  1725  GFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
              FVY+GTAWWLM +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y
Sbjct  541   VFVYIGTAWWLMGSIQDLCDTNLLPENSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEY  600

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
              AVNWFFL GAIAP+LVW+A K FP + WIRLI+MPVL+ AT+ MPPA+AVN+T+W+  G
Sbjct  601   GAVNWFFLGGAIAPLLVWIAHKMFPNKTWIRLIHMPVLLGATAMMPPASAVNFTSWLTCG  660

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPY  2258
             FL GY +FRY+ + W+R+NY+LSG LDAG AF+ +LL+L LG + +  +WWGN++DGCP 
Sbjct  661   FLFGYFLFRYKTEWWKRYNYILSGGLDAGTAFITILLFLTLGSKGI--DWWGNNIDGCPL  718

Query  2259  ASCPSAKGIIVEGCPV  2306
             ASCPSA+G++V+GCPV
Sbjct  719   ASCPSARGVVVDGCPV  734



>ref|XP_009801973.1| PREDICTED: oligopeptide transporter 6-like [Nicotiana sylvestris]
Length=732

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/722 (67%), Positives = 597/722 (83%), Gaps = 3/722 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
               A+E+  PI+EV +TVP TDDP+ PVLTFRMW LG  SCVLLSF+NQFFWYRTEPLTI+
Sbjct  12    NEADEDLCPIKEVDMTVPKTDDPTTPVLTFRMWFLGITSCVLLSFVNQFFWYRTEPLTIS  71

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             + + QIAVVP+G LMA  IT R+FF GT+WEFTLNPGPFN+KEHVLITIFAN+GAG+VYA
Sbjct  72    STAVQIAVVPIGHLMAKTITKRLFFEGTRWEFTLNPGPFNIKEHVLITIFANAGAGSVYA  131

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++AVK++Y + ++FF +L+I+ TTQ+LGFGWAGIFR++LVEPA MWWP +LVQVSLF
Sbjct  132   THILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKHLVEPAEMWWPGSLVQVSLF  191

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKE RPKGG TR QFF+IA + SFAYY+FPGYLFQML+S SWICW  P+S+L QQL
Sbjct  192   RALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICWLAPKSILVQQL  251

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG++GLGIGA+G DW++ISSYLGSPLASPWFATAN+A GF L++Y+ TP+ YW +V+NA
Sbjct  252   GSGMRGLGIGALGFDWTTISSYLGSPLASPWFATANVAAGFVLVMYLMTPLTYWFNVYNA  311

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             K FPIFS  LFT +G  YN   +I+S+F LD+ AY+Q G+L+LSTFFA+TYG+GFA LTA
Sbjct  312   KNFPIFSSSLFTLNGTKYNTEGVINSHFQLDIAAYNQYGQLHLSTFFAMTYGLGFAGLTA  371

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             TLVHV LFHGRE+W +S+ + K  K D+HTRLM  Y+QVP WWF  +LVAN+ L  F C+
Sbjct  372   TLVHVFLFHGREMWNRSREALK-HKPDVHTRLMKSYKQVPMWWFHVVLVANMVLIFFTCQ  430

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             +Y E  QLPWWG+LLA  IA+ FTLPIGII+A TNQ PGLN+ITEYIIGY+YPG PVANM
Sbjct  431   HYLETFQLPWWGILLAFAIALGFTLPIGIISATTNQQPGLNVITEYIIGYLYPGRPVANM  490

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
              FKVYGYISM+QA++F+ DFKLGHYMKIPPR MFMAQ++GT I+  +Y  TAWWLM+TIP
Sbjct  491   LFKVYGYISMSQALSFVYDFKLGHYMKIPPRAMFMAQMLGTFISIIIYTITAWWLMDTIP  550

Query  1773  EICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C  +    N+ W CP D VFYDASVIWGLI P RIFG LG Y  VNWFFL GAIAPVL
Sbjct  551   NLCDISVLPDNSPWQCPMDRVFYDASVIWGLIAPLRIFGPLGVYPNVNWFFLGGAIAPVL  610

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VWLA KAFP Q+WI  I+MPVL+ AT+ MPPA++VNYT+W+I+ FLSGYVV+R  P LW+
Sbjct  611   VWLAHKAFPKQKWISHIHMPVLLGATAMMPPASSVNYTSWLILAFLSGYVVYRRWPHLWE  670

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG LDAG AF+ +LL+L +  ++++++WWGN+ DGCP A+CP+A GI  +GCP 
Sbjct  671   RYNYVLSGGLDAGTAFIAILLFLAIQSKDINIDWWGNNTDGCPLAACPTAPGISAKGCPA  730

Query  2307  IY  2312
             I+
Sbjct  731   IF  732



>ref|XP_004138881.1| PREDICTED: oligopeptide transporter 6-like [Cucumis sativus]
Length=735

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/736 (67%), Positives = 609/736 (83%), Gaps = 9/736 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAE---EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             +SS  S+++S  E AE   ++  PI++V +TVP TDDP+LPVLTFRMW+LG  +CV+LSF
Sbjct  2     SSSVVSEIQS-AEPAEVTVDDACPIKQVDITVPKTDDPNLPVLTFRMWILGIAACVILSF  60

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHV  467
             +NQFFWYR+ PL++++I+AQIAVVPLG L+A  +  + FF+GT++EFT+NPGPFN+KEHV
Sbjct  61    VNQFFWYRSNPLSVSSIAAQIAVVPLGHLLAKTLPTQQFFKGTRFEFTMNPGPFNIKEHV  120

Query  468   LITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             LITIFANSGAG+VYA H++TAVK+ Y + +TF  +L+I+ TTQ+LGFGWAGIFR+YLVEP
Sbjct  121   LITIFANSGAGSVYATHILTAVKLLYKRQLTFVPALLIMFTTQILGFGWAGIFRKYLVEP  180

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
               MWWP+NLVQVSLFRALH+KE+RPK   TRTQFF++A ICSF YY+FPGYL  MLTS S
Sbjct  181   GEMWWPSNLVQVSLFRALHDKEKRPKRSTTRTQFFLLAMICSFGYYIFPGYLVMMLTSFS  240

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CWF   S+L  Q+GSG+ GLG+GA G+DWS+ISSYLGSPLASPWFATAN+AVGF +++
Sbjct  241   WLCWFNSNSLLLHQVGSGMNGLGLGAFGIDWSTISSYLGSPLASPWFATANVAVGFVIVM  300

Query  1008  YVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLST  1187
             YV TP+ YW +V+ AK FPI+S  LF ++G  YNIS+I++SNFHLD   Y   G + LST
Sbjct  301   YVMTPLSYWLNVYGAKRFPIYSSSLFMANGHKYNISSIVNSNFHLDRGVYSTTGPVNLST  360

Query  1188  FFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWF  1364
             FFALTYG+GFA L+AT++HV LF+GRE+  QS S+F   RK+DIHT+LM  Y+QVP WWF
Sbjct  361   FFALTYGLGFATLSATVMHVFLFNGRELLNQSMSAFGGKRKIDIHTKLMQAYKQVPTWWF  420

Query  1365  WCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIIT  1544
               IL+ NIAL+VFAC+YY   LQLPWWGVLLAC IA+ FTLPIGII A TNQ PGLNIIT
Sbjct  421   IIILILNIALSVFACQYYNASLQLPWWGVLLACFIALFFTLPIGIINATTNQAPGLNIIT  480

Query  1545  EyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIA  1724
             EYIIGY YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPRTMFMAQVVGT+IA
Sbjct  481   EYIIGYAYPERPVANMCFKVYGYISMTQALTFVSDFKLGHYMKIPPRTMFMAQVVGTIIA  540

Query  1725  GFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
              FVY+GTAWWLM +I ++C T     N+ WTCP D VF+DASVIWGL+GPRRIFGDLG Y
Sbjct  541   VFVYIGTAWWLMGSIQDLCDTNLLPENSPWTCPMDRVFFDASVIWGLVGPRRIFGDLGEY  600

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
              AVNWFFL GAIAP+LVW+A K FP + WIRLI+MPVL+ AT+ MPPA+AVN+T+W+  G
Sbjct  601   GAVNWFFLGGAIAPLLVWIAHKMFPNKTWIRLIHMPVLLGATAMMPPASAVNFTSWLTCG  660

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPY  2258
             FL GY +FRY+ + W+R+NY+LSG LDAG AF+ +LL+L LG + +  +WWGN++DGCP 
Sbjct  661   FLFGYFLFRYKTEWWKRYNYILSGGLDAGTAFITILLFLTLGSKGI--DWWGNNIDGCPL  718

Query  2259  ASCPSAKGIIVEGCPV  2306
             ASCPSA+G++V+GCPV
Sbjct  719   ASCPSARGVVVDGCPV  734



>ref|XP_009361323.1| PREDICTED: oligopeptide transporter 6-like [Pyrus x bretschneideri]
Length=732

 Score =   987 bits (2551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/735 (67%), Positives = 599/735 (81%), Gaps = 10/735 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEE---NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             A    +KV +   AAEEE   +  I++V LTVP TDDP++PVLTFRMWVLG  SC+LLSF
Sbjct  2     AEIDAAKVNA--SAAEEEEVNDCSIKQVDLTVPKTDDPTIPVLTFRMWVLGLSSCILLSF  59

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHV  467
             +NQFFWYR  PL+I++I AQIAVVP+G LMA  +    FF+GT +EFT+NPGPFN+KEHV
Sbjct  60    VNQFFWYRKNPLSISSICAQIAVVPIGHLMARTLPTSPFFKGTWFEFTMNPGPFNIKEHV  119

Query  468   LITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             LITIFANSGAG+VYA H+++AVK+ Y + +TF  +L+++ TTQVLGFGWAGIFRR LV+P
Sbjct  120   LITIFANSGAGSVYATHILSAVKLLYKRKLTFIPALLVMFTTQVLGFGWAGIFRRILVDP  179

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
               MWWP+NLVQVSLFRALHEK++RPKGG+TR+QFF+I  ICSF YYVFPGYL  ++TS S
Sbjct  180   EQMWWPSNLVQVSLFRALHEKDKRPKGGMTRSQFFLIVMICSFCYYVFPGYLVYIITSFS  239

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CW  P+S+L QQLGSGL GLGIG+  +DW++ISSYLG+PLASPWFATANIA+GFFL++
Sbjct  240   WVCWLAPKSILVQQLGSGLSGLGIGSFAIDWAAISSYLGTPLASPWFATANIAIGFFLVM  299

Query  1008  YVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLST  1187
             YV TPI Y+ DV+NAK FPI+S +LFTS+G TY++ +IIDS F LD   Y + G + LST
Sbjct  300   YVMTPITYFFDVYNAKKFPIYSSDLFTSNGTTYDVLSIIDSKFELDRPTYAKSGPVNLST  359

Query  1188  FFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFW  1367
             FFA+TYG+GFA L ATLVHV+LF+ R+I    +   + +K+DIH RLM KY+ VP WWF 
Sbjct  360   FFAMTYGLGFATLPATLVHVLLFNARDIGNAFR---RQKKLDIHARLMKKYKSVPTWWFL  416

Query  1368  CILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITE  1547
              ILV NIAL +FAC+YY E LQLPWWGVLLAC IAI++T+PIGIITA TNQ PGLNIITE
Sbjct  417   GILVVNIALILFACQYYNESLQLPWWGVLLACAIAILYTVPIGIITATTNQQPGLNIITE  476

Query  1548  yiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAG  1727
             Y+IGY+YP +PVANMCFKVYGYISMTQA+ FL DFKLGHYMKIPPR+MF+AQVVGT +A 
Sbjct  477   YVIGYLYPEHPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPRSMFIAQVVGTTVAV  536

Query  1728  FVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYE  1901
              VYL TAWWLM  IP +C T+    ++ WTCP D VF+DASVIWGL+GPRRIFG+LG Y 
Sbjct  537   IVYLVTAWWLMGDIPNLCDTSKLPKDSQWTCPMDRVFFDASVIWGLVGPRRIFGNLGEYM  596

Query  1902  AVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGF  2081
              VNWFF  GAIAPVLV LA  AFP   WIRLINMPVL+ ATS MPPA+AVN+T+WIIV F
Sbjct  597   NVNWFFFGGAIAPVLVKLAHMAFPQHNWIRLINMPVLLGATSMMPPASAVNFTSWIIVAF  656

Query  2082  LSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYA  2261
             L GYVV+RYRPD+W R+NYVLSG LDAG AF+ +L+++ L    + L WWGN+ +GCP A
Sbjct  657   LFGYVVYRYRPDVWSRYNYVLSGGLDAGTAFVTILMFITLQNRGIELKWWGNNGEGCPLA  716

Query  2262  SCPSAKGIIVEGCPV  2306
             +CP+AKGI+V+GCPV
Sbjct  717   TCPTAKGIVVDGCPV  731



>ref|XP_008376782.1| PREDICTED: oligopeptide transporter 6 [Malus domestica]
Length=732

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/735 (67%), Positives = 599/735 (81%), Gaps = 10/735 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEE---NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             A    +KV++   AAEEE   +  I++V LTVP TDDP++PVLTFRMWVLG  SC+LLSF
Sbjct  2     AEIDAAKVDA--SAAEEEEVNDCSIKQVDLTVPKTDDPTIPVLTFRMWVLGLSSCILLSF  59

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHV  467
             +NQFFWYR  PL+I++I AQIAVVP+G LMA  +    FF+GT +EFT+NPGPFN+KEHV
Sbjct  60    VNQFFWYRKNPLSISSICAQIAVVPIGHLMARTLPTSPFFKGTWFEFTMNPGPFNIKEHV  119

Query  468   LITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             LITIFANSGAG+VYA H+++AVK+ Y + +TF  +L+++ TTQVLGFGWAGIFRR LV+P
Sbjct  120   LITIFANSGAGSVYATHILSAVKLLYKRKLTFIPALLVMFTTQVLGFGWAGIFRRILVDP  179

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
               MWWP+NLVQVSLFRALHEK++R KGG+TR+QFF+I  ICSF YYVFPGYL  ++TS S
Sbjct  180   EQMWWPSNLVQVSLFRALHEKDKRAKGGMTRSQFFLIVMICSFCYYVFPGYLIYIITSFS  239

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CW  P+S+L QQLGSGL GLGIG+  +DW++ISSYLG+PLASPWFATANIA+GFFL++
Sbjct  240   WVCWLAPKSILVQQLGSGLSGLGIGSFAIDWAAISSYLGTPLASPWFATANIAIGFFLVM  299

Query  1008  YVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLST  1187
             YV TPI Y+ DV+NAK FPI+S +LFTS+G TY++ +IIDS F LD   Y + G + LST
Sbjct  300   YVMTPITYFFDVYNAKKFPIYSSDLFTSNGTTYDVLSIIDSKFELDRPTYAKSGPVNLST  359

Query  1188  FFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFW  1367
             FFA+TYG+GFA L ATLVHV+LF+ R+I    +   + +K+DIH RLM KY+ VP WWF 
Sbjct  360   FFAMTYGLGFATLPATLVHVLLFNARDIGNAFR---RQKKLDIHARLMKKYKSVPTWWFL  416

Query  1368  CILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITE  1547
              ILV NIAL +FAC+YY E LQLPWWGVLLAC IAI++T+PIGIITA TNQ PGLNIITE
Sbjct  417   GILVVNIALILFACQYYNESLQLPWWGVLLACAIAILYTVPIGIITATTNQQPGLNIITE  476

Query  1548  yiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAG  1727
             Y+IGY+YP +PVANMCFKVYGYISM QA+ FL DFKLGHYMKIPPR+MF+AQVVGT++A 
Sbjct  477   YVIGYLYPEHPVANMCFKVYGYISMAQALTFLADFKLGHYMKIPPRSMFIAQVVGTIVAV  536

Query  1728  FVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYE  1901
              VYL TAWWLM  IP +C T+    ++ WTCP D VF+DASVIWGL+GPRRIFG+LG Y 
Sbjct  537   IVYLVTAWWLMGDIPNLCDTSKLPKDSQWTCPMDRVFFDASVIWGLVGPRRIFGNLGAYM  596

Query  1902  AVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGF  2081
              VNWFF  GAIAPVLV LA  AFP   WIRLINMPVL+ ATS MPPA+AVN+T+WIIV F
Sbjct  597   NVNWFFFGGAIAPVLVKLAHMAFPQHNWIRLINMPVLLGATSMMPPASAVNFTSWIIVAF  656

Query  2082  LSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYA  2261
             L GYVV+RYRPD+W R+NYVLSG LDAG AF+ +L+++ L    + L WWGN+ +GCP A
Sbjct  657   LFGYVVYRYRPDVWSRYNYVLSGGLDAGTAFVTILMFITLQNRGIELKWWGNNGEGCPLA  716

Query  2262  SCPSAKGIIVEGCPV  2306
             +CP+AKGI+V+GCPV
Sbjct  717   TCPTAKGIVVDGCPV  731



>ref|XP_011075935.1| PREDICTED: oligopeptide transporter 6 [Sesamum indicum]
Length=728

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/725 (66%), Positives = 594/725 (82%), Gaps = 3/725 (0%)
 Frame = +3

Query  141   ESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
             E+  +   ++   I++V +TVP TDDP++PV TFR+W+LG  +C+LLSF+NQFFWYR+EP
Sbjct  3     ETAQDFDFDDECVIKQVDVTVPKTDDPTMPVYTFRVWLLGITACMLLSFVNQFFWYRSEP  62

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             L I++IS QIAVVP+G LMA  +T R F +GT  EFTLNPGPFN+KEHV+IT+ AN+GAG
Sbjct  63    LIISSISMQIAVVPIGHLMARMVTKRSFLKGTMLEFTLNPGPFNIKEHVMITMLANAGAG  122

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             TVYA H+++AVK++Y K   F  + I++LTTQ+LG+GWAGIFR+YLVEP  MWWP+NLVQ
Sbjct  123   TVYATHILSAVKLYYKKSFGFVPAFIVMLTTQLLGYGWAGIFRKYLVEPGEMWWPSNLVQ  182

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLFRALHEKE+RPKGG +RTQFF+IA  CSFAYY+ PGY F MLTS+SWICW  P+SVL
Sbjct  183   VSLFRALHEKEKRPKGGTSRTQFFLIALACSFAYYIIPGYFFVMLTSISWICWINPKSVL  242

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
               Q+GSGL GLGIGA+G DWS+IS+YLGSPLASPWFA+AN+A GF L++YV TP+ YW +
Sbjct  243   VNQVGSGLNGLGIGALGFDWSTISAYLGSPLASPWFASANVAAGFVLVMYVLTPVGYWFN  302

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
             ++NAK FPI+S  LF   G  YN +AII+S+F+LD  AY + G LYLST FALTYG+GFA
Sbjct  303   LYNAKNFPIYSANLFQFDGSKYNTTAIINSHFNLDKAAYAKAGPLYLSTMFALTYGLGFA  362

Query  1221  ALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSKYRQVPEWWFWCILVANIALT  1397
              L+ATLVHV+LF+GR++W+Q+K++FK ++KMD+HTRLM  Y+QVP WWF  ILV NIA+ 
Sbjct  363   TLSATLVHVLLFNGRDLWKQTKTAFKGNKKMDVHTRLMKAYKQVPMWWFLAILVVNIAVV  422

Query  1398  VFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgy  1577
             +FAC  Y   LQLPWWGVLLAC +A I+TLPIGII A TNQ PGLN+ITEYIIGY YPG 
Sbjct  423   LFACAKYGSSLQLPWWGVLLACAVAFIYTLPIGIIVATTNQQPGLNVITEYIIGYAYPGR  482

Query  1578  pVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWL  1757
             PVANMCFKVYGYISM QA+ F+ DFKLGHYMKIPPR MF  Q+VGTVI+  +Y  TAWWL
Sbjct  483   PVANMCFKVYGYISMVQALTFIADFKLGHYMKIPPRAMFSVQLVGTVISVIIYTTTAWWL  542

Query  1758  METIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGA  1931
             M TIP +C T+    ++ WTCP DHVFYDASVIWGL+GP+RIFG+LG Y A+NWFFL GA
Sbjct  543   MATIPNLCDTSLLPDDSPWTCPMDHVFYDASVIWGLVGPQRIFGNLGIYPAINWFFLGGA  602

Query  1932  IAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYR  2111
             IAP+LVWLA KAFP Q+WI LI+MPVL+ +T+ MPPATAVNYT+W++V FL G+V++R +
Sbjct  603   IAPLLVWLAAKAFPNQKWIGLIHMPVLLGSTAMMPPATAVNYTSWVLVAFLFGFVLYRNQ  662

Query  2112  PDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIV  2291
             P  WQR+NYVLSG LDAG AF+ VL++  L  + +S+ WWGN+LDGCP A+CP+AKGI  
Sbjct  663   PQWWQRYNYVLSGGLDAGTAFVTVLMFFALQSKGISVQWWGNNLDGCPLAACPTAKGITA  722

Query  2292  EGCPV  2306
             +GCPV
Sbjct  723   QGCPV  727



>ref|XP_010671377.1| PREDICTED: oligopeptide transporter 6 [Beta vulgaris subsp. vulgaris]
Length=744

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/739 (66%), Positives = 584/739 (79%), Gaps = 8/739 (1%)
 Frame = +3

Query  114   FASSSKSKVESLPEAAEEEN--SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             F    + K++  P   EE+     I++V LTV  TDDP++PVLTFRMWVLG  +C+LLSF
Sbjct  5     FEEEREVKMDYFPTKVEEKEVECSIKQVELTVLKTDDPNMPVLTFRMWVLGLAACILLSF  64

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHV  467
             +NQF WYR  P+ IT+I AQIAVVPLG LMA  IT RVFF+GTKWEFTLNPGPFNVKEHV
Sbjct  65    INQFMWYRQNPMLITSICAQIAVVPLGHLMARTITTRVFFQGTKWEFTLNPGPFNVKEHV  124

Query  468   LITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             LITIFAN+GAG+VYA H+++AVK+FY + ++   +++I+LTTQ+LGFGWAG+FR+YLVEP
Sbjct  125   LITIFANAGAGSVYATHILSAVKLFYKRKLSLLPAILIMLTTQLLGFGWAGLFRKYLVEP  184

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
             + MWWP NLVQVS+FRALH+ E+R KGGI RTQ F+I   C+ AY V P YLF M TS S
Sbjct  185   SEMWWPGNLVQVSIFRALHDHEKRAKGGINRTQGFLIILCCAAAYCVLPTYLFIMTTSFS  244

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CW  P+SVL  QLGSG Q LGIG+  +DWS+ISSYLGSPLASPWFATAN+A GF +++
Sbjct  245   WLCWIKPKSVLVNQLGSGTQALGIGSFAIDWSTISSYLGSPLASPWFATANVAAGFVIMM  304

Query  1008  YVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLST  1187
             YV  PI YW DV  AK+FPIFS  LF   G  Y+I  I+ SNF LD  AY  +G LYLST
Sbjct  305   YVLMPICYWFDVLKAKSFPIFSQSLFKGDGSVYDIKTIVSSNFELDKAAYASDGPLYLST  364

Query  1188  FFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSKYRQVPEWWF  1364
             FFA+TYG+GFA L+AT+VHV++F+GREIW Q K +F    KMDIH +LM  Y+QVP WWF
Sbjct  365   FFAMTYGLGFATLSATIVHVLIFNGREIWGQVKGAFGGSEKMDIHMKLMKAYKQVPNWWF  424

Query  1365  WCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIIT  1544
               +LV NI LTVF CEYYKE LQLPWWGVLLAC +A  FTLP+G+I A TNQ PGLNIIT
Sbjct  425   HILLVLNIVLTVFTCEYYKESLQLPWWGVLLACALAFFFTLPVGVIQATTNQQPGLNIIT  484

Query  1545  EyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIA  1724
             EYIIGY+YPG PVANM FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQ VGTV++
Sbjct  485   EYIIGYLYPGRPVANMLFKVYGYISMTQALNFIMDFKLGHYMKIPPRSMFMAQTVGTVVS  544

Query  1725  GFVYLGTAWWLMETIPEICQTTAT--NTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
               VY GTAWW+ME+IP IC  +    ++ WTC  D  FY ASVIWGL+GPRRIFG+LG Y
Sbjct  545   VAVYTGTAWWMMESIPHICDKSQLPPDSPWTCSFDRTFYSASVIWGLVGPRRIFGNLGYY  604

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
               VNWFFLAGAIAP L+WLA KAFP Q WIRLINMPVL+ AT  MPPA+AVN+ +WIIVG
Sbjct  605   SHVNWFFLAGAIAPCLIWLAHKAFPKQNWIRLINMPVLLGATMMMPPASAVNFISWIIVG  664

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLG-LENVSLNWWGNDLDG--  2249
             FLSGY+ FRYRP LW+R+NY+LSG LDAG AFM +L++ CL  + N+SL+WWGN  D   
Sbjct  665   FLSGYIFFRYRPKLWERYNYILSGGLDAGTAFMTILIFFCLQYVTNISLDWWGNHSDDVM  724

Query  2250  CPYASCPSAKGIIVEGCPV  2306
             CP A CP+AKGI+V+GCPV
Sbjct  725   CPLAKCPTAKGIVVDGCPV  743



>emb|CBI23049.3| unnamed protein product [Vitis vinifera]
Length=690

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/689 (71%), Positives = 592/689 (86%), Gaps = 2/689 (0%)
 Frame = +3

Query  246   MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWE  425
             MWVLG  SC++LSF+NQFFWYR++PL I++ISAQIAVVP+G LMA +IT RVF +G++WE
Sbjct  1     MWVLGLSSCIVLSFVNQFFWYRSQPLIISSISAQIAVVPIGHLMAKKITKRVFLKGSRWE  60

Query  426   FTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLG  605
             FTLNPGPFNVKEHVLITIFANSGAGTVYA H++TAVK+ Y +++TF  +L+++ TTQVLG
Sbjct  61    FTLNPGPFNVKEHVLITIFANSGAGTVYATHILTAVKLLYKRNLTFIPALLVMTTTQVLG  120

Query  606   FGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYY  785
             FGWAG+FR++LVEP  MWWP+NLVQVSLFRALHEKE+RPKGG TRTQFF+I FICSF YY
Sbjct  121   FGWAGLFRKFLVEPGEMWWPSNLVQVSLFRALHEKEKRPKGGTTRTQFFLIVFICSFTYY  180

Query  786   VFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPW  965
             V PGYL  MLTS SW+CW  P+S+L QQLGSGL+GLGIG+IGLDWS+ISSYLGSPLASPW
Sbjct  181   VAPGYLINMLTSFSWVCWLAPKSILVQQLGSGLEGLGIGSIGLDWSTISSYLGSPLASPW  240

Query  966   FATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLD  1145
             FATAN+A+GF L++YV TP  YW +V+NAK FP++S++LFTS+G  YNI +IIDSNFHL 
Sbjct  241   FATANVALGFCLVMYVMTPATYWSNVYNAKNFPLYSEKLFTSNGSRYNILSIIDSNFHLS  300

Query  1146  LEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTR  1325
              E Y + G L +STFFA+TYG+GFA L+AT+VHV LF+G E+W+Q+K +F ++KMDIHT 
Sbjct  301   KEQYVKSGPLNMSTFFAMTYGLGFATLSATIVHVALFNGSELWKQTKGAFGEKKMDIHTW  360

Query  1326  LMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIIT  1505
             LM KY+ VP WWF+ I V NIA  +FACEYY + LQLPWWGVLLAC IA  FTLPIGIIT
Sbjct  361   LMKKYKSVPNWWFFVIHVVNIATIIFACEYYNDVLQLPWWGVLLACAIAFFFTLPIGIIT  420

Query  1506  AITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPR  1685
             A TNQTPGLNI+TEY++GY+YPG PVANMCFKVYGYISMTQA+ FL DFKLGHYMKIPPR
Sbjct  421   ATTNQTPGLNIVTEYVMGYMYPGRPVANMCFKVYGYISMTQALTFLADFKLGHYMKIPPR  480

Query  1686  TMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGL  1859
             +MFMAQVVGTV+A  VY+ TAWWLM TIP +C TT    ++ W CP D+VF+DASVIWGL
Sbjct  481   SMFMAQVVGTVVAVIVYVITAWWLMATIPNLCDTTMLPADSPWRCPMDNVFFDASVIWGL  540

Query  1860  IGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPP  2039
             IG RRIFG+LG Y  VNWFFL GAIAP+LVWL  KAFP ++WI LI+MPVL+ +T+ MPP
Sbjct  541   IGTRRIFGNLGAYSNVNWFFLLGAIAPLLVWLMHKAFPKKKWIPLIHMPVLLGSTAMMPP  600

Query  2040  ATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVS  2219
             A+AVN+T+WIIVGFLSG+V+FR++P LW+R+NYV+SG LDAG AFM +L++L LG  NVS
Sbjct  601   ASAVNFTSWIIVGFLSGFVIFRHKPKLWERYNYVVSGGLDAGTAFMTILIFLTLGSRNVS  660

Query  2220  LNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ++WWGN+ +GCP ASCP+AKGI+V+GCPV
Sbjct  661   IDWWGNNPEGCPLASCPTAKGIVVDGCPV  689



>gb|EMT05930.1| Oligopeptide transporter 7 [Aegilops tauschii]
Length=833

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/732 (71%), Positives = 584/732 (80%), Gaps = 20/732 (3%)
 Frame = +3

Query  105   RHGFASS--SKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVL  278
             RH  + S  S   V  LP  A+E+NSPI +VALTVP  DDP  PVLTFRMWVLG  SC +
Sbjct  34    RHLCSPSPCSAVPVAELP-GAQEDNSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAV  92

Query  279   LSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVK  458
             LSFLNQFFWYR EPLTITAISAQIAVVPLG+LMA  +  R FFRG  +EFTLNPGPFNVK
Sbjct  93    LSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAGALPGRAFFRGRPYEFTLNPGPFNVK  152

Query  459   EHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYL  638
             EHVLITIFAN+GAGTVYAIHVVTAV+VFYGK++TF VSL++VLTTQVLGFGWAG F    
Sbjct  153   EHVLITIFANAGAGTVYAIHVVTAVRVFYGKNLTFLVSLLVVLTTQVLGFGWAGSF----  208

Query  639   VEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICS---FAYYVFPGYLFQ  809
               PA         Q    R LH +   P G   R Q  +          A  V PG L  
Sbjct  209   --PAGAPREGGAEQ----RRLHAQPVLPGG--LRLQLRLEGGAEQRRLHAQPVLPGGLRL  260

Query  810   MLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAV  989
              L  L       P + L   LG GL GLGIG+IGLDW+S+SSYLGSPLASPWFATAN+A 
Sbjct  261   QLRLLHIPRLPVPDAHLTLLLGPGLYGLGIGSIGLDWASVSSYLGSPLASPWFATANVAA  320

Query  990   GFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEG  1169
             GFF+I+YV TPI YW + + A+ FPIFSD LFT SGQ YNI++I+DS FH D +AY++ G
Sbjct  321   GFFIIMYVITPIAYWFNFYKARNFPIFSDGLFTESGQKYNITSIVDSQFHFDTKAYEKNG  380

Query  1170  KLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQV  1349
              LYLSTFFA+TYGVGFA+LTAT+VHV+LFHG EIW+ SKS+F+++++D+HT+LM +Y+QV
Sbjct  381   PLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKSAFQEKRVDVHTKLMRRYKQV  440

Query  1350  PEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPG  1529
             PEWWF CIL+ NIA+TVFACEYY EQLQLPWWGVLLAC IA  FTLPIGIITA TNQTPG
Sbjct  441   PEWWFICILIVNIAVTVFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPG  500

Query  1530  LNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVV  1709
             LNIITEYI+GY+YPG PVANMCFKVYGYISM+QA+ FLQDFKLGHYMKIPPRTMFMAQVV
Sbjct  501   LNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVV  560

Query  1710  GTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFG  1883
             GT+IA FVYLGTAWWLM++IP IC T      + WTCP DHVFYDASVIWGLI PRRIFG
Sbjct  561   GTLIAAFVYLGTAWWLMDSIPNICDTELLPAGSPWTCPGDHVFYDASVIWGLISPRRIFG  620

Query  1884  DLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTT  2063
             DLGTY AVNWFFL GAIAP+LVW A KAFPGQ WI LINMPVLI +T  MPPATAVNY T
Sbjct  621   DLGTYSAVNWFFLGGAIAPLLVWFAHKAFPGQNWILLINMPVLIGSTGQMPPATAVNYIT  680

Query  2064  WIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDL  2243
             WI VGFLSGYVV+RYR D W+RHNY+LSGALDAGLAFM VL+YLCLGLEN+SLNWWGNDL
Sbjct  681   WIFVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWGNDL  740

Query  2244  DGCPYASCPSAK  2279
             DGCP ASCP+AK
Sbjct  741   DGCPLASCPTAK  752



>ref|XP_009601745.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
 ref|XP_009601746.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=732

 Score =   979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/722 (67%), Positives = 592/722 (82%), Gaps = 3/722 (0%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
               A+E+  PI+EV +TVP TDDP+ PV+TFRMW LG  SCVLLSF+NQFFWYRTEPLTI+
Sbjct  12    NEADEDLCPIKEVDMTVPKTDDPTTPVVTFRMWFLGITSCVLLSFVNQFFWYRTEPLTIS  71

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
             + + QIAVVP+G LMA  IT RVFF GT+WEFTLNPGPFN+KEHVLITIFAN+GAG+VYA
Sbjct  72    STAVQIAVVPIGHLMAKTITKRVFFEGTRWEFTLNPGPFNIKEHVLITIFANAGAGSVYA  131

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++AVK++Y + ++FF +L+I+ TTQ+LGFGWAGIFR+ LVEPA MWWP +LVQVSLF
Sbjct  132   THILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKQLVEPAEMWWPGSLVQVSLF  191

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
             RALHEKE RPKGG TR QFF+IA + SFAYY+FPGYLFQML+S SWICW  P+S+L QQL
Sbjct  192   RALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICWLAPKSILVQQL  251

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG++GLGIGA+G DW++ISSYLGSPLASPWFATAN+A GF L++Y+ TP+ YW +V+NA
Sbjct  252   GSGMRGLGIGALGFDWTTISSYLGSPLASPWFATANVAAGFVLVMYLMTPLTYWFNVYNA  311

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             K FPIFS  LFT +G  YN   +I+S+F LD  AY+Q G+L+LSTFFA+TYG+GFA LTA
Sbjct  312   KNFPIFSSGLFTLNGTKYNTEGVINSHFELDKAAYNQYGQLHLSTFFAMTYGLGFAGLTA  371

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             TLVHV LFHGRE+  +S+ + K  K D+HTRLM  Y+QVP WWF  +LVAN+ L  F C+
Sbjct  372   TLVHVFLFHGREMCNRSREALK-HKPDVHTRLMKSYKQVPMWWFHVVLVANMVLIFFTCQ  430

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY E  QL WWG+LLA  IA+ FTLPIGII+A TNQ PGLNIITEY+IGY+YPG PVANM
Sbjct  431   YYLETFQLTWWGILLAFAIALGFTLPIGIISATTNQQPGLNIITEYVIGYLYPGRPVANM  490

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
              FKVYGYISM+QA++F+ DFKLGHYMKIPPR MFMAQ++GT I+  +Y  TAWWLM+TIP
Sbjct  491   LFKVYGYISMSQALSFVYDFKLGHYMKIPPRAMFMAQMLGTFISIIIYTITAWWLMDTIP  550

Query  1773  EICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C  +    N+ W CP D VFYDASVIWGLI P RIFG LG Y  VNWFFL GAIAPVL
Sbjct  551   NLCDISVLPDNSPWQCPMDRVFYDASVIWGLIAPLRIFGSLGVYPNVNWFFLGGAIAPVL  610

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VWLA KAFP  +WI  INMPVL+ AT+ MPPA++VNYT+W+I+ FLSGYVV+R  P LW+
Sbjct  611   VWLAHKAFPKHKWISHINMPVLLGATAMMPPASSVNYTSWLILAFLSGYVVYRRWPHLWE  670

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG LD+G AF+ +LL+L +  ++++++WWGN+ DGCP A+CP+A GI  +GCP 
Sbjct  671   RYNYVLSGGLDSGTAFIAILLFLAIQSKDINIDWWGNNTDGCPLAACPTAPGISAKGCPA  730

Query  2307  IY  2312
             I+
Sbjct  731   IF  732



>ref|XP_002515831.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF46573.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/720 (68%), Positives = 589/720 (82%), Gaps = 9/720 (1%)
 Frame = +3

Query  177   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAV  356
             PI++V LTVP TDDP +PVLTFRMWVLG  +CV+LS +NQFFWYR +P+ ++AISAQIAV
Sbjct  25    PIKQVELTVPKTDDPDMPVLTFRMWVLGISACVILSAVNQFFWYRKQPMFLSAISAQIAV  84

Query  357   VPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVK  536
             VPLG L+A  +  R++F+GTKWEFT+NPGPFNVKEHVLITIFANSGAGTVYA HV++AVK
Sbjct  85    VPLGHLLARTLPTRLYFQGTKWEFTMNPGPFNVKEHVLITIFANSGAGTVYATHVLSAVK  144

Query  537   VFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEE  716
             +FY + +TF  SLI+++TTQV+GFGWAG+FRRYLVEP  +WWPAN+VQVSLFRALHEK++
Sbjct  145   LFYKRKLTFLPSLIVMITTQVVGFGWAGLFRRYLVEPGEIWWPANMVQVSLFRALHEKDK  204

Query  717   RPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglg  896
             R KGGITRTQFF+I  + SF YYV PGYL Q+LTS SWICW  P+SV+ QQLGSGL+GLG
Sbjct  205   RAKGGITRTQFFLIVLVSSFCYYVLPGYLVQILTSFSWICWIAPKSVIVQQLGSGLEGLG  264

Query  897   igaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSD  1076
             IGAIG DWS++S+YLGSPLASPWFATANIAVGF L++YV  PI YW +V+NAKTFPIFS 
Sbjct  265   IGAIGFDWSTVSAYLGSPLASPWFATANIAVGFSLVMYVLIPISYWGNVYNAKTFPIFSS  324

Query  1077  ELFTSSGQTYNISAIIDSNFH------LDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
              LF  +G+ Y+I +I+DS FH      LD  AY   G ++LSTFFA+TYG GFAAL AT 
Sbjct  325   SLFQGNGEEYDIHSIVDSKFHLDKXVSLDKNAYASSGPVHLSTFFAMTYGAGFAALAATF  384

Query  1239  VHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEY  1415
             +HV+LF+G ++W QSK + +  RKMDIHTRLM KY+ VP WWF  I + NIA  +  CEY
Sbjct  385   MHVLLFNGSDLWMQSKMALRGKRKMDIHTRLMKKYKSVPLWWFIVIAIINIAAIIITCEY  444

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y E LQL WWGVLLAC I++ FTLPIGII A TNQ PGLNIITEYIIGYI PG PVANMC
Sbjct  445   YNESLQLRWWGVLLACGISLFFTLPIGIIFATTNQAPGLNIITEYIIGYINPGLPVANMC  504

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ FLQDFKLGHYMKIPPR+MFMAQVVGT+++  VYL TAW +M+ IP 
Sbjct  505   FKVYGYISMTQALTFLQDFKLGHYMKIPPRSMFMAQVVGTILSVLVYLLTAWGMMDAIPN  564

Query  1776  ICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C        + WTCP D VF+DASVIWGL+GPRRIFG+LG Y  +NWFFL GAIAP+LV
Sbjct  565   LCDKAQLPKGSPWTCPMDKVFFDASVIWGLLGPRRIFGNLGEYGMINWFFLGGAIAPLLV  624

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLA KAFP Q+WIRLI+MPVLI +T  MPPATAVNYT+W+I+GFLSGYV +RYRP LW+R
Sbjct  625   WLAHKAFPSQKWIRLIHMPVLIGSTGLMPPATAVNYTSWLILGFLSGYVFYRYRPGLWKR  684

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             +NYVLSG LDAG AF+ +L++  L    V  NWWG + +GCP ASCP+AKG+  +GCPV+
Sbjct  685   YNYVLSGGLDAGTAFITLLIFFSLNYWGVIFNWWGTNDEGCPLASCPTAKGVFKDGCPVV  744



>ref|XP_004235114.1| PREDICTED: oligopeptide transporter 6 [Solanum lycopersicum]
Length=738

 Score =   971 bits (2511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/719 (66%), Positives = 586/719 (82%), Gaps = 3/719 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             ++E  PI+EV +TVP TDDP++PVLTFRMW+LG  SC+LLSF+NQFFWYRT+PLTI++ +
Sbjct  19    DDEECPIKEVEMTVPKTDDPTIPVLTFRMWLLGITSCILLSFVNQFFWYRTQPLTISSTA  78

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
              QIAVVP+G LMA  IT RVFF GT W FTLNPG FN+KEHVLITIFAN+GAGTVYA H+
Sbjct  79    VQIAVVPIGHLMAKIITKRVFFEGTSWAFTLNPGRFNIKEHVLITIFANAGAGTVYATHI  138

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++AVK++Y + + FF +L+I++TTQ+LGFGWAGIFR+ LVEPA MWWP +LVQVSLFRAL
Sbjct  139   LSAVKLYYKRPLDFFPALLIMVTTQMLGFGWAGIFRKLLVEPAEMWWPGSLVQVSLFRAL  198

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE R KGG TR QFF+IA + SFAYYVFPGYLFQMLTS SW+CWF P+S+  QQLGSG
Sbjct  199   HEKENRAKGGTTRIQFFLIALVFSFAYYVFPGYLFQMLTSFSWLCWFAPKSIFVQQLGSG  258

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             + GLGIGAIG DW++ISSYLGSPLASPWFATANI VGF L++Y  TP+ YW +V+NAKTF
Sbjct  259   MHGLGIGAIGFDWTTISSYLGSPLASPWFATANIGVGFVLVMYFMTPLTYWYNVYNAKTF  318

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS  L+T +G  YN   +ID +F LD  AY++ G+L+LSTFFA+TYG+GFAAL A  V
Sbjct  319   PIFSSNLYTLNGTKYNTEGVIDPHFQLDYAAYNRYGQLHLSTFFAMTYGLGFAALGAIFV  378

Query  1242  HVVLFHGREIWEQSKSSFKDR-KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYY  1418
             H+ LFHG E+W   +  F  R K+D+HTRLM  Y+QVP WWF  +LV N+AL +F C++Y
Sbjct  379   HIFLFHGSEVWNGFREVFDQRKKLDVHTRLMKNYKQVPMWWFTIVLVVNMALILFICQHY  438

Query  1419  KEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCF  1598
              E LQL WWGVLLA VIA  FTLPIGII A TNQ PGLNIITEY+ GY+YPG+PVANM F
Sbjct  439   LETLQLTWWGVLLAFVIAFGFTLPIGIIVATTNQQPGLNIITEYVWGYMYPGFPVANMLF  498

Query  1599  KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEI  1778
             KVYGYISM QA+ F+ DFKLGHYMKIPPR MFMAQ++GT I+  +Y  TAWWLM ++P +
Sbjct  499   KVYGYISMAQALTFVYDFKLGHYMKIPPRAMFMAQMLGTFISIIIYTITAWWLMGSVPNL  558

Query  1779  CQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
             C  +    N+ W CP D VFYDASVIWGLIGP+RIFG LG Y  VNWFFL GAI+P+LVW
Sbjct  559   CDISVLPANSPWQCPQDRVFYDASVIWGLIGPKRIFGSLGVYSNVNWFFLGGAISPILVW  618

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             LA K FP Q+WI LI+MPVL+ +T+ MPPA++VNYT+W+IV FLSGYVV+R  P LW+R+
Sbjct  619   LAQKIFPKQKWISLIHMPVLLGSTAMMPPASSVNYTSWLIVAFLSGYVVYRRWPHLWERY  678

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             NYVLSG LDAG AF+ VLL++ +  ++++++WWGN++DGCP A+CP+AKG+  +GCP I
Sbjct  679   NYVLSGGLDAGTAFIAVLLFITIQSKDINIDWWGNNIDGCPLAACPTAKGVPAKGCPAI  737



>ref|XP_006350626.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=738

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/719 (67%), Positives = 584/719 (81%), Gaps = 3/719 (0%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             ++E  PI+EV +TVP TDDP+ PVLTFRMW LG  SC+LLSF+NQFFWYRT+PLTI++ +
Sbjct  19    DDEECPIKEVEMTVPKTDDPTTPVLTFRMWFLGITSCILLSFVNQFFWYRTQPLTISSTA  78

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
              QIAVVP+G LMA  IT RVFF GT W FTLNPG FN+KEHVLITIFAN+GAGTVYA H+
Sbjct  79    VQIAVVPIGHLMAKIITKRVFFEGTGWAFTLNPGRFNIKEHVLITIFANAGAGTVYATHI  138

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++AVK++Y + + FF +L+I+ TTQ+LGFGWAGIFR+ LVEPA MWWP +LVQVSLFRAL
Sbjct  139   LSAVKLYYKRPLDFFPALLIMATTQMLGFGWAGIFRKLLVEPAEMWWPGSLVQVSLFRAL  198

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE R KGG TR QFF+IA + SFAYYVFPGYLFQMLTS SW+CWF P+S+  QQLGSG
Sbjct  199   HEKENRAKGGTTRIQFFLIALVFSFAYYVFPGYLFQMLTSFSWLCWFAPKSIFVQQLGSG  258

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
             +QGLGIGAIG DW++ISSYLGSPLASPWFATANI VGF L++Y  TP+ YW +V+ AKTF
Sbjct  259   MQGLGIGAIGFDWTTISSYLGSPLASPWFATANIGVGFVLVMYFMTPLTYWYNVYKAKTF  318

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +L+T +G  YN   +ID +F LD  AY+Q G+L+LSTFFA+TYG+GFAAL A  V
Sbjct  319   PIFSSDLYTVNGTEYNTEGVIDPHFQLDYAAYNQYGQLHLSTFFAMTYGLGFAALGAIFV  378

Query  1242  HVVLFHGREIWEQSKSSFKDR-KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYY  1418
             HV LFHG E+W   +  F  R K+D+HTRLM KY+QVP WWF  +LV N+AL  F C++Y
Sbjct  379   HVFLFHGSEVWNGFREVFDQRKKLDVHTRLMKKYKQVPMWWFHIVLVVNMALIFFICQHY  438

Query  1419  KEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCF  1598
              E  QL WWGVLLA VIA  FTLPIGII A TNQ PGLNIITEY+ GY+YPG+PVANM F
Sbjct  439   LETFQLTWWGVLLAFVIAFGFTLPIGIIVATTNQQPGLNIITEYVWGYMYPGFPVANMLF  498

Query  1599  KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEI  1778
             KVYGYISM QA++F+ DFKLGHYMKIPPR MFMAQ++GT I+  +Y  TAWWLM ++P +
Sbjct  499   KVYGYISMAQALSFVYDFKLGHYMKIPPRAMFMAQMLGTFISVIIYTITAWWLMGSVPNL  558

Query  1779  CQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
             C  +    N+ W CP D VFYDASVIWGLIGP+RIFG LG Y  VNWFFL GAI+P+LVW
Sbjct  559   CDVSVLPANSPWKCPQDRVFYDASVIWGLIGPKRIFGSLGVYSNVNWFFLGGAISPILVW  618

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             LA K FP Q+WI LI+MPVL+ +T+ MPPA++VNYT+W+IV FLSGYVV+R  P LW+R+
Sbjct  619   LAQKIFPKQKWISLIHMPVLLGSTAMMPPASSVNYTSWLIVAFLSGYVVYRRWPHLWERY  678

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             NYVLSG LDAG AF+ VLL++ +  ++++++WWGN++DGCP A+CP+AKG+  +GCP I
Sbjct  679   NYVLSGGLDAGTAFIAVLLFITIQSKDINIDWWGNNIDGCPLAACPTAKGVPAKGCPAI  737



>gb|KCW53166.1| hypothetical protein EUGRSUZ_J02448 [Eucalyptus grandis]
Length=647

 Score =   963 bits (2489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/646 (75%), Positives = 555/646 (86%), Gaps = 2/646 (0%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MA  IT RVFF G +W+FTLNPGPFNVKEHVLITIFANSGA +VYAIH+++ VK+FY K 
Sbjct  1     MAGVITRRVFFEGRRWQFTLNPGPFNVKEHVLITIFANSGASSVYAIHIISVVKIFYRKE  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             ++F V+L+IVLTTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLFRALHEKE+RPKGG+
Sbjct  61    MSFPVALVIVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALHEKEQRPKGGL  120

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
              R  FF+IAFICSF+YYVFPGYLF MLTSLSWICW FP SVLAQQLGSGL GLGIGA+GL
Sbjct  121   MRNHFFLIAFICSFSYYVFPGYLFPMLTSLSWICWLFPASVLAQQLGSGLHGLGIGAVGL  180

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSIS+YLGSPLASPWFATANIAVGF L++YV TPI YW +++ AKTF +FSD LFTSS
Sbjct  181   DWSSISAYLGSPLASPWFATANIAVGFALVMYVITPIAYWLNIYRAKTFSLFSDSLFTSS  240

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAII+ +F LD EAY++EG LYL T F++ YG+ FA LTAT+VH  LFHG+EIW
Sbjct  241   GQEYNISAIINEHFQLDAEAYEREGPLYLCTVFSVYYGISFACLTATVVHGFLFHGKEIW  300

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
               SKS+F ++KMDIHT+LM +Y+QVPEWWF CIL+ NI  T+F CEY+K+QLQLPWWGVL
Sbjct  301   LLSKSAFSEKKMDIHTKLMRRYKQVPEWWFTCILLVNIVATIFICEYFKDQLQLPWWGVL  360

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC +AI FTLP+G+ITA TNQTP LN+ITE+IIGYIYPGYPVAN+ FKVYGYISM Q I
Sbjct  361   LACALAIFFTLPVGVITATTNQTPALNVITEFIIGYIYPGYPVANILFKVYGYISMKQGI  420

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVW  1808
              FLQDFKLGHYMKIPPR MFMAQVVGT++A  V+L TAWWLM+T+P+IC        + W
Sbjct  421   TFLQDFKLGHYMKIPPREMFMAQVVGTIVAALVHLRTAWWLMDTVPDICNRALLPAGSPW  480

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP D VF+D SVIWGLIGPRRIFGDLG Y A+NWFFL GAIAP +VWLA KAFP +EWI
Sbjct  481   TCPGDTVFFDGSVIWGLIGPRRIFGDLGYYSAINWFFLVGAIAPFIVWLAHKAFPDKEWI  540

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             RLI MPVL+ AT +MPPATAVNYT+WII GFLSG+V +RY    W RHNY LSGALDAGL
Sbjct  541   RLITMPVLLGATVSMPPATAVNYTSWIIAGFLSGFVAYRYYRGWWSRHNYALSGALDAGL  600

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             AFM VLLYLCLG+++VSL+WWG D DGCP A+CP+AKG++VEGCPV
Sbjct  601   AFMAVLLYLCLGMKHVSLSWWGEDPDGCPLAACPTAKGVVVEGCPV  646



>gb|KDO71234.1| hypothetical protein CISIN_1g006390mg [Citrus sinensis]
Length=647

 Score =   958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/647 (73%), Positives = 554/647 (86%), Gaps = 2/647 (0%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MA  +  +VFF G ++EFT NPGPF+VKEHVLITIFAN+GAG VYAIH+V+ +K+FY K 
Sbjct  1     MAKTLPKKVFFEGRRFEFTFNPGPFHVKEHVLITIFANAGAGNVYAIHIVSVLKLFYKKE  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             +TF V+L++V+TTQVLGFGWAG+FRRYLV+P  MWWP NLVQVSLFRALHEKE+R  GG+
Sbjct  61    LTFLVALLVVITTQVLGFGWAGLFRRYLVDPPTMWWPQNLVQVSLFRALHEKEKRSAGGL  120

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR QFF+IAF+CSFAYYVFPGYLF ML S+SWICW +P SVLA QLGSGL GLGIGAIG 
Sbjct  121   TRNQFFLIAFVCSFAYYVFPGYLFPMLVSVSWICWIYPNSVLAHQLGSGLHGLGIGAIGF  180

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSIS+YLGSPLASPWFATANIA GFFLI+YV TPI YW ++F AKTFPIFSD LFTS+
Sbjct  181   DWSSISAYLGSPLASPWFATANIAAGFFLIMYVITPIAYWLNIFKAKTFPIFSDGLFTST  240

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAII++NF  D EAY++EG LY+STFFA++YGVGFA LTAT+VHV+LFHGREIW
Sbjct  241   GQNYNISAIINNNFLFDTEAYEREGPLYISTFFAMSYGVGFACLTATVVHVLLFHGREIW  300

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
             + SK++F+++ MD+HT+LM KY+QVPEWWF CIL+ NIA T+F C+YY  QLQLPWWGVL
Sbjct  301   QLSKAAFEEKGMDVHTKLMRKYKQVPEWWFTCILLINIAATIFTCQYYNNQLQLPWWGVL  360

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LACV+A+ FTLP+G+ITA TNQTP LN+ITEYIIGYIYPG+P AN+CFKVYGYISM Q I
Sbjct  361   LACVLALFFTLPVGVITATTNQTPALNVITEYIIGYIYPGFPAANICFKVYGYISMKQGI  420

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVW  1808
              FLQD KLGHYMKIPPR MFMAQV GT+I+   +LGTAWWLM TIP+IC  +   + + W
Sbjct  421   TFLQDLKLGHYMKIPPRAMFMAQVFGTIISALAHLGTAWWLMNTIPDICDREMLPSGSPW  480

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP DHVFYDAS+IWGLIGPRRIFGDLG Y +VNWFF AGA+APVLVW+A KAFP + WI
Sbjct  481   TCPGDHVFYDASIIWGLIGPRRIFGDLGYYSSVNWFFFAGAVAPVLVWIAHKAFPNRPWI  540

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             R I MPVL+ AT NMPPATAVNYT+WI++GF SG++ +RY  D W RHNYVLSGALDAGL
Sbjct  541   RHITMPVLLGATVNMPPATAVNYTSWILIGFASGFIAYRYYRDWWSRHNYVLSGALDAGL  600

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             AFMGVLLYLCLG+E++SLNW     DGCP ASCP+  G +V+GCPV+
Sbjct  601   AFMGVLLYLCLGMEHISLNWLKMQSDGCPLASCPTEPGTVVKGCPVL  647



>ref|XP_006425446.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
 gb|ESR38686.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
Length=647

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/647 (73%), Positives = 554/647 (86%), Gaps = 2/647 (0%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MA  +  +VFF G ++EFT NPGPF+VKEHVLITIFAN+GAG VYAIH+V+ +++FY K 
Sbjct  1     MAKTLPKKVFFEGRRFEFTFNPGPFHVKEHVLITIFANAGAGNVYAIHIVSVLQLFYKKE  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             +TF V+L++V+TTQVLGFGWAG+FRRYLV+P  MWWP NLVQVSLFRALHEKE+R  GG+
Sbjct  61    LTFLVALLVVITTQVLGFGWAGLFRRYLVDPPTMWWPQNLVQVSLFRALHEKEKRSAGGL  120

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR QFF+IAF+CSFAYYVFPGYLF ML S+SWICW +P SVLA QLGSGL GLGIGAIG 
Sbjct  121   TRNQFFLIAFVCSFAYYVFPGYLFPMLVSVSWICWIYPNSVLAHQLGSGLHGLGIGAIGF  180

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSIS+YLGSPLASPWFATANIA GFFLI+YV TPI YW ++F AKTFPIFSD LFTS+
Sbjct  181   DWSSISAYLGSPLASPWFATANIAAGFFLIMYVITPIAYWLNIFKAKTFPIFSDGLFTST  240

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YN+SAII++NF  D EAY++EG LY+STFFA++YGVGFA LTAT+VHV+LFHGREIW
Sbjct  241   GQNYNVSAIINNNFLFDTEAYEREGPLYISTFFAMSYGVGFACLTATVVHVLLFHGREIW  300

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
             + SK++F+++ MD+HT+LM KY+QVPEWWF CIL+ NIA T+F C+YY  QLQLPWWGVL
Sbjct  301   QLSKAAFEEKGMDVHTKLMRKYKQVPEWWFTCILLINIAATIFTCQYYNNQLQLPWWGVL  360

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LACV+A+ FTLP+G+ITA TNQTP LN+ITEYIIGYIYPG+P AN+CFKVYGYISM Q I
Sbjct  361   LACVLALFFTLPVGVITATTNQTPALNVITEYIIGYIYPGFPAANICFKVYGYISMKQGI  420

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVW  1808
              FLQD KLGHYMKIPPR MFMAQV GT+I+   +LGTAWWLM TIP+IC  +   + + W
Sbjct  421   TFLQDLKLGHYMKIPPRAMFMAQVFGTIISALAHLGTAWWLMNTIPDICDREMLPSGSPW  480

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP DHVFYDAS+IWGLIGPRRIFGDLG Y +VNWFF AGA+APVLVW+A KAFP + WI
Sbjct  481   TCPGDHVFYDASIIWGLIGPRRIFGDLGYYSSVNWFFFAGAVAPVLVWIAHKAFPNRPWI  540

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             R I MPVL+ AT NMPPATAVNYT+WI++GF SG++ +RY  D W RHNYVLSGALDAGL
Sbjct  541   RHITMPVLLGATVNMPPATAVNYTSWILIGFASGFIAYRYYRDWWSRHNYVLSGALDAGL  600

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             AFMGVLLYLCLG+E++SLNW     DGCP ASCP+  G +V+GCPV+
Sbjct  601   AFMGVLLYLCLGMEHISLNWLKMQSDGCPLASCPTEPGTVVKGCPVL  647



>ref|XP_009143920.1| PREDICTED: oligopeptide transporter 6 [Brassica rapa]
Length=735

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/721 (64%), Positives = 589/721 (82%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDDPSLPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  14    DDDRCVVPEVELTVPKTDDPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGIS  73

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  74    AQIAVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  133

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  134   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  193

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ KG ++RTQFF+I  + SFAYY+ PGYLF MLTS+SW+CWF P+S+L  QLGSG
Sbjct  194   HEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNPKSILVNQLGSG  253

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLG+G+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW +++ AKTF
Sbjct  254   EHGLGVGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPICYWLNIYEAKTF  313

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF ++G  Y++ +IIDS FHLD   Y   G + +STFFA+TYG+GFA L+AT+V
Sbjct  314   PIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSNTGSINMSTFFAVTYGLGFATLSATIV  373

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F KD+KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  374   HVLVFNGSDLWKQTRGAFQKDKKMDIHTRIMKKNYREVPMWWFLVILLLNIALIMFISVH  433

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  434   YNATVQLPWWGVLLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  493

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP 
Sbjct  494   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVMVYTGTAWWLMEEIPH  553

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C T+   +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LV
Sbjct  554   LCDTSLLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYSSVNWFFLVGAIAPLLV  613

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLA KAFP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W++
Sbjct  614   WLAAKAFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFVFGHFIFKYRREWWKK  673

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG++V+GCP
Sbjct  674   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCP  733

Query  2304  V  2306
             V
Sbjct  734   V  734



>emb|CDY19030.1| BnaC01g20380D [Brassica napus]
Length=735

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/721 (64%), Positives = 588/721 (82%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDDPSLPVLTFRMW LG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  14    DDDRCVVPEVELTVPKTDDPSLPVLTFRMWFLGISACIVLSFINQFFWYRTMPLSITGIS  73

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  74    AQIAVVPLGHLMARVLPSRRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  133

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  134   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  193

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ KG ++RTQFF+I  + SFAYY+ PGYLF MLTS+SW+CWF P+S+L  QLGSG
Sbjct  194   HEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNPKSILVNQLGSG  253

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLG+G+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW +++ AKTF
Sbjct  254   EHGLGVGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPICYWLNIYEAKTF  313

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF ++G  Y++ +IIDS FHLD   Y   G + +STFFA+TYG+GFA L+AT+V
Sbjct  314   PIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSNTGSINMSTFFAVTYGLGFATLSATIV  373

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F KD+KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  374   HVLVFNGSDLWKQTRGAFQKDKKMDIHTRIMKKNYREVPMWWFLVILLLNIALIMFISVH  433

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  434   YNATVQLPWWGVLLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  493

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MF+AQVVGT++A  VY GTAWWLME IP 
Sbjct  494   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFIAQVVGTLVAVMVYTGTAWWLMEEIPH  553

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C TT   +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LV
Sbjct  554   LCDTTLLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYSSVNWFFLVGAIAPLLV  613

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLA KAFP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W++
Sbjct  614   WLAAKAFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFVFGHFIFKYRREWWKK  673

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG++V+GCP
Sbjct  674   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCP  733

Query  2304  V  2306
             V
Sbjct  734   V  734



>ref|XP_004309115.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
Length=728

 Score =   945 bits (2443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/731 (65%), Positives = 583/731 (80%), Gaps = 8/731 (1%)
 Frame = +3

Query  123   SSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  302
              S+S V+      E++   I +V LTVP TDDP+LPVLTFRMWVLG +SC+LLSF+NQFF
Sbjct  4     DSRSAVDM---EKEDDRCLIEQVELTVPKTDDPTLPVLTFRMWVLGLVSCILLSFVNQFF  60

Query  303   WYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIF  482
             WYRT+PLTI+AISAQIAVVPLG  MA  +  R FF+GT+ EFT+NPGPFNVKEHVLITIF
Sbjct  61    WYRTQPLTISAISAQIAVVPLGHFMARVLPTRSFFQGTQLEFTMNPGPFNVKEHVLITIF  120

Query  483   ANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWW  662
             AN GAGTVYA H++TAVK+ Y + +TF  + I++LTTQVLGFGWAGIFR+YLVEP  MWW
Sbjct  121   ANCGAGTVYASHILTAVKLLYKRKLTFLPAFIVMLTTQVLGFGWAGIFRKYLVEPEKMWW  180

Query  663   PANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWF  842
             P NLVQVSLF ALHEK +RPKG +TRTQFF++  I SFAYY+FPGYL  MLT++SW+CW 
Sbjct  181   PGNLVQVSLFSALHEKSKRPKGSMTRTQFFLVVMIASFAYYIFPGYLLIMLTTISWVCWI  240

Query  843   FPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTP  1022
              P+S+L  QLGSG+ GLGIG+  +DWS+ISSYLG+PLASPWFA+AN+AVGFFL++YV TP
Sbjct  241   RPKSILVNQLGSGMNGLGIGSFAIDWSTISSYLGTPLASPWFASANVAVGFFLVMYVMTP  300

Query  1023  IFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALT  1202
             I YW ++++AKTFPIFS  LF ++G  Y +  +IDS F LD   Y ++G L+LSTFFA T
Sbjct  301   ITYWSNIYSAKTFPIFSSHLFMANGSMYEVLDVIDSRFQLDHGEYAKKGPLHLSTFFACT  360

Query  1203  YGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVA  1382
             YG+GFAAL+AT++HV+LF+ R+I +       ++K D+HTRLM  Y+ VP  WF  ILV 
Sbjct  361   YGLGFAALSATVMHVLLFNARDILDAFHG---NKKKDVHTRLMKSYKSVPTLWFIIILVI  417

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             NIAL +FA  YYKE LQLPWWG +LAC +A  FT PIG+I A TN  PGLN+ITEY+IGY
Sbjct  418   NIALIIFASVYYKESLQLPWWGAMLACFMAFAFTYPIGVIYATTNMEPGLNVITEYVIGY  477

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
             +YP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPR MF AQ+VGTV+A  VY  
Sbjct  478   LYPERPVANMCFKVYGYISMTQALQFVMDFKLGHYMKIPPRAMFTAQMVGTVVAVVVYQC  537

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM  I  +C T+     + WTCP D VF+DASVIWGL+GPRRIFG+LG Y  +NWF
Sbjct  538   TAWWLMSDIRNLCDTSLLPPGSPWTCPMDRVFFDASVIWGLVGPRRIFGNLGEYSNINWF  597

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FL GA+APVLVWLA +AFP Q+WI  +NMPVL+ AT  MPPATA+N+T+WI V F+SG+V
Sbjct  598   FLGGAVAPVLVWLAHRAFPKQKWILAVNMPVLLGATGMMPPATAINFTSWIFVAFVSGFV  657

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             VFRYR D W+++NYV+SG LDAG AF+ +LL+L L  +N++L WWGN  + CP A+CP+A
Sbjct  658   VFRYRQDWWKKYNYVVSGGLDAGTAFVTILLFLTLQSQNINLEWWGNKGEPCPLATCPTA  717

Query  2277  KGIIVEGCPVI  2309
             KG+IV+GCPV+
Sbjct  718   KGVIVDGCPVL  728



>ref|XP_002867483.1| ATOPT6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43742.1| ATOPT6 [Arabidopsis lyrata subsp. lyrata]
Length=735

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/721 (64%), Positives = 585/721 (81%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDD SLPVLTFRMWVLG  +C++LSF+NQFFWYRT PL++T I 
Sbjct  14    DDDRCVVPEVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSVTGIC  73

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVP+G LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  74    AQIAVVPIGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  133

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  134   LSAIKLYYKRPLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  193

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ +GG++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CW  P+S+L  QLGSG
Sbjct  194   HEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWLNPKSILVNQLGSG  253

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TP+ YW ++++AKTF
Sbjct  254   EHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVCYWLNIYDAKTF  313

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF  +G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA L+AT+V
Sbjct  314   PIFSSQLFMGNGSRYDVLSIIDSKFHLDRAVYSRTGSINMSTFFAVTYGLGFATLSATIV  373

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F KD+KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  374   HVLVFNGSDLWKQTRGAFQKDKKMDIHTRIMKKNYREVPLWWFLVILLLNIALIMFISVH  433

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  434   YNATVQLPWWGVLLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  493

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQV GT++A  VY GTAWWLME IP 
Sbjct  494   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVFGTLVAVVVYTGTAWWLMEEIPH  553

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C T    +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  VNWFFL GAIAP+LV
Sbjct  554   LCDTALLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYSNVNWFFLVGAIAPLLV  613

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W +
Sbjct  614   WLATKMFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRREWWTK  673

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG++V+GCP
Sbjct  674   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCP  733

Query  2304  V  2306
             V
Sbjct  734   V  734



>ref|XP_006413036.1| hypothetical protein EUTSA_v10024519mg [Eutrema salsugineum]
 gb|ESQ54489.1| hypothetical protein EUTSA_v10024519mg [Eutrema salsugineum]
Length=734

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/728 (64%), Positives = 590/728 (81%), Gaps = 6/728 (1%)
 Frame = +3

Query  141   ESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
             E  P   E++   + EV LTV  TDDPSLPVLTFRMWVLG  +C++LSF+NQFFWYRT P
Sbjct  6     EDFPAVMEDDRCVVPEVELTVLKTDDPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMP  65

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             L+IT ISAQIAVVPLG LMA  +  R F  GT++EFTLNPG FNVKEHVLITIFANSGAG
Sbjct  66    LSITGISAQIAVVPLGHLMARVLPTRRFLEGTRFEFTLNPGAFNVKEHVLITIFANSGAG  125

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             +VYA H+++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQ
Sbjct  126   SVYATHILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  185

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLF ALHEKE++ KG ++RTQFF+I  + SFAYY+ PGYLF MLTS+SW+CWF P+S+L
Sbjct  186   VSLFGALHEKEKKSKGAMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNPKSIL  245

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
               QLGSG  GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GFFL++Y  TPI YW +
Sbjct  246   VNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFFLVMYFVTPICYWLN  305

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
             ++ AKTFPIFS +LF ++G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA
Sbjct  306   IYEAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRLVYSKTGSINMSTFFAVTYGLGFA  365

Query  1221  ALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIAL  1394
              L+AT+VHV++F+G ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ NIAL
Sbjct  366   TLSATIVHVLVFNGSDLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILLLNIAL  425

Query  1395  TVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypg  1574
              +F   +Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP 
Sbjct  426   IMFISVHYNATVQLPWWGVLLACAIAITFTPLIGVIAATTNQAPGLNIITEYVIGYIYPE  485

Query  1575  ypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWW  1754
              PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWW
Sbjct  486   RPVANMCFKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTGTAWW  545

Query  1755  LMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             LME IP +C T    +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL G
Sbjct  546   LMEEIPHLCDTALLPSDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWFFLVG  605

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             AIAP+LVWLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+Y
Sbjct  606   AIAPLLVWLATKVFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFVFGHFIFKY  665

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKG  2282
             R + W+++NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG
Sbjct  666   RTEWWKKYNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKG  725

Query  2283  IIVEGCPV  2306
             ++++GCPV
Sbjct  726   VVIKGCPV  733



>ref|NP_194503.1| oligopeptide transporter [Arabidopsis thaliana]
 sp|Q9T095.1|OPT6_ARATH RecName: Full=Oligopeptide transporter 6; Short=AtOPT6 [Arabidopsis 
thaliana]
 emb|CAB38285.1| putative protein [Arabidopsis thaliana]
 emb|CAB81423.1| putative protein [Arabidopsis thaliana]
 gb|AAN13068.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85386.1| oligopeptide transporter [Arabidopsis thaliana]
Length=736

 Score =   943 bits (2437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/721 (64%), Positives = 586/721 (81%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDD +LPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  15    DDDRCVVPEVELTVPKTDDSTLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGIS  74

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  + F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  75    AQIAVVPLGHLMARVLPTKRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  134

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  135   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  194

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ +GG++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CW  P+S+L  QLGSG
Sbjct  195   HEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWLNPKSILVNQLGSG  254

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TP+ YW ++++AKTF
Sbjct  255   EHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVCYWLNIYDAKTF  314

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF  +G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA L+AT+V
Sbjct  315   PIFSSQLFMGNGSRYDVLSIIDSKFHLDRVVYSRTGSINMSTFFAVTYGLGFATLSATIV  374

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  375   HVLVFNGSDLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILLLNIALIMFISVH  434

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  435   YNATVQLPWWGVLLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  494

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQV GT++A  VY GTAWWLME IP 
Sbjct  495   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVAGTLVAVVVYTGTAWWLMEEIPH  554

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C T+   +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  VNWFFL GAIAP+LV
Sbjct  555   LCDTSLLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYSNVNWFFLVGAIAPLLV  614

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR   W +
Sbjct  615   WLATKMFPAQTWIAKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRRVWWTK  674

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG++V+GCP
Sbjct  675   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCP  734

Query  2304  V  2306
             V
Sbjct  735   V  735



>ref|XP_010442919.1| PREDICTED: oligopeptide transporter 8-like [Camelina sativa]
Length=737

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/730 (62%), Positives = 592/730 (81%), Gaps = 5/730 (1%)
 Frame = +3

Query  129   KSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             +S+ ES    A++E S + EV LTVP TDDPS P +TFRMWVLG  +CVLLSFLNQFFWY
Sbjct  8     RSESES-DSYADDEISVVPEVELTVPKTDDPSSPTVTFRMWVLGITACVLLSFLNQFFWY  66

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFAN  488
             RT PLTI+++SAQIAVVP+G LMA  +  R FF GT+W FT+NPGPF+ KEHVLIT+FAN
Sbjct  67    RTNPLTISSVSAQIAVVPIGHLMARVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITVFAN  126

Query  489   SGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
             SG+G VYA H+++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP 
Sbjct  127   SGSGAVYASHIISAVKLYYKRRLDFLPALLVMITTQVLGFGWAGMYRKHLVEPGEMWWPI  186

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
             NLVQVSLFRALHEKE+R K GI+R QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P
Sbjct  187   NLVQVSLFRALHEKEKRSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWISP  246

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             +S+L  QLGSG  GLGIG+ GLDWS+I+SYLGSPLASP+FA+ANIA GFFL++YV TP+ 
Sbjct  247   KSILVNQLGSGSAGLGIGSFGLDWSTIASYLGSPLASPFFASANIAAGFFLVMYVITPLC  306

Query  1029  YWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             Y+ D++NAKTFPI+S +LF +SG+ Y++ +IID+NF LD +AY + G +++STFFA+TYG
Sbjct  307   YYLDIYNAKTFPIYSGKLFVASGKEYDVRSIIDANFRLDHKAYAETGPIHMSTFFAVTYG  366

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVA  1382
             +GFA LTA++VHV+LF+G+++W Q+K +  K++K+DIHT++M + Y++VP WWF CI   
Sbjct  367   LGFATLTASVVHVLLFNGKDLWNQTKGALGKNKKIDIHTKIMKRNYKEVPLWWFLCIFAV  426

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             N+A+ +F C YY+ Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIGY
Sbjct  427   NLAVIIFICIYYESQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIGY  486

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
              YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  
Sbjct  487   AYPERPVANICFKTYGYISMSQSLTFLADLKLGTYMKIPPRTMFMAQVVGTLVAVFVYAF  546

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM  IP IC T+     + WTCP+D VF+DASVIWGL+GPRR+FG+LG Y  +NWF
Sbjct  547   TAWWLMAEIPNICDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRVFGNLGEYSNINWF  606

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             F+ GAIAP LV+LATK FP ++WI +I++PVLI AT+ MPPA++VN+T+W+++ F+ G+ 
Sbjct  607   FVGGAIAPALVYLATKLFPNRKWISMIHIPVLIGATAIMPPASSVNFTSWLVLAFVFGHF  666

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             VF+YR + WQR+NYVLSG +DAG  FM VLL+L L    +S++WWGN  +GC  A CP+A
Sbjct  667   VFKYRREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSEISIDWWGNSGEGCSVAKCPTA  726

Query  2277  KGIIVEGCPV  2306
             KG+IV GCPV
Sbjct  727   KGVIVHGCPV  736



>emb|CDX96230.1| BnaC02g14210D [Brassica napus]
Length=740

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/720 (63%), Positives = 586/720 (81%), Gaps = 4/720 (1%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
              ++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQFFWYRT PLTI+++
Sbjct  20    GDDEMSIVPQVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFWYRTNPLTISSV  79

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVP+G LMA  +  R+FF GT+W FT+NPGPF+ KEHVLIT+FANSG+G VYA H
Sbjct  80    SAQIAVVPVGHLMARVLPTRIFFEGTRWSFTMNPGPFSTKEHVLITVFANSGSGAVYASH  139

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             +++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP+NLVQVSLFRA
Sbjct  140   ILSAVKLYYKRRLDFIPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQVSLFRA  199

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LHEKE+R + G+TR QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P+S+L  QLGS
Sbjct  200   LHEKEKRSEWGVTRNQFFVITLITSFSYYLLPGYLFTLLTTVSWLCWISPKSILVNQLGS  259

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             G  GLGIG+ GLDWS+I+SYLGSPLASP+FATANIAVG+F+++YV TP+ Y+ D FNAKT
Sbjct  260   GSAGLGIGSFGLDWSTIASYLGSPLASPFFATANIAVGYFILMYVITPLCYYLDFFNAKT  319

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPI+S +LF ++GQ YN+ +II+ +F LD +AY + G +++STFFA+TYG+GFA LTA++
Sbjct  320   FPIYSGKLFVANGQEYNVRSIINDDFRLDHKAYAETGPVHMSTFFAVTYGLGFATLTASV  379

Query  1239  VHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACE  1412
             VHV LF+G+++W Q+K +  KD+KMDIHT++M + Y++VP WWF  I   NIA+ VF C 
Sbjct  380   VHVFLFYGKDLWNQTKGALRKDKKMDIHTKIMKRNYKEVPLWWFLSIFAVNIAVIVFICV  439

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY++Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIGY YP  PVAN+
Sbjct  440   YYEKQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIGYAYPERPVANI  499

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  TAWWLM  IP
Sbjct  500   CFKTYGYISMSQSLTFLADLKLGSYMKIPPRTMFMAQVVGTLVAVFVYALTAWWLMAEIP  559

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NWFFL GAIAP L
Sbjct  560   NLCDTSLLPPESQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFLGGAIAPTL  619

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             V+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+ +F+Y+ + WQ
Sbjct  620   VYLATRVFPKKKWISSIHMPVLIGATAIMPPATAVNFTSWLVMAFVFGHFLFKYKTEWWQ  679

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG +DAG  FM VLL+L L   ++ L+WWGN  +GCP A CP+AKG++V GCPV
Sbjct  680   RYNYVLSGGMDAGTGFMSVLLFLALQRSDIMLDWWGNSGEGCPVAKCPTAKGVVVHGCPV  739



>emb|CDY28832.1| BnaA02g10240D [Brassica napus]
Length=740

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/720 (63%), Positives = 587/720 (82%), Gaps = 4/720 (1%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
              ++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQFFWYRT PLTI+++
Sbjct  20    GDDEMSIVPQVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFWYRTNPLTISSV  79

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVP+G LMA  +  R+FF GT+W FT+NPGPF+ KEHVLIT+FANSG+G VYA H
Sbjct  80    SAQIAVVPIGHLMARVLPTRIFFEGTRWSFTMNPGPFSTKEHVLITVFANSGSGAVYASH  139

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             +++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP+NLVQVSLFRA
Sbjct  140   ILSAVKLYYKRRLDFIPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQVSLFRA  199

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LHEKE+R + G+TR QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P+S+L  QLGS
Sbjct  200   LHEKEKRSEWGVTRNQFFVITLIASFSYYLLPGYLFTLLTTISWLCWISPKSILVNQLGS  259

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             G  GLGIG+ GLDWS+I+SYLGSPLASP+FATANIAVG+F+++YV TP+ Y+ D F+AKT
Sbjct  260   GSAGLGIGSFGLDWSTIASYLGSPLASPFFATANIAVGYFIVMYVITPLCYYLDFFDAKT  319

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPI+S +LF ++GQ YN+++II+  F LD +AY + G +++STFFA+TYG+GFA LTA++
Sbjct  320   FPIYSGKLFVANGQEYNVTSIINDEFRLDHKAYAETGPVHMSTFFAVTYGLGFATLTASV  379

Query  1239  VHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACE  1412
             VHV LF+G+++W Q+K +  KD+KMDIHT++M + Y++VP WWF  I V NIA+ VF C 
Sbjct  380   VHVFLFYGKDLWNQTKGALRKDKKMDIHTKIMKRNYKEVPLWWFLSIFVVNIAVIVFICV  439

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY++Q+QLPWWG  LAC+IA+ FT  +G+I A TNQ PGLNIITEYIIGY YP  PVAN+
Sbjct  440   YYEKQIQLPWWGAFLACLIALFFTPLVGVIMATTNQAPGLNIITEYIIGYAYPERPVANI  499

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  TAWWLM  IP
Sbjct  500   CFKTYGYISMSQSLTFLADLKLGSYMKIPPRTMFMAQVVGTLVAVFVYALTAWWLMAEIP  559

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NWFFL GAIAP L
Sbjct  560   NLCDTSLLPPESQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFLGGAIAPTL  619

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             V+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+ +F+Y+ + WQ
Sbjct  620   VYLATRVFPNKKWISSIHMPVLIGATAIMPPATAVNFTSWLVMAFVFGHFLFKYKTEWWQ  679

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG +DAG  FM VLL+L L   ++ L+WWGN  +GCP A CP+AKG++V GCPV
Sbjct  680   RYNYVLSGGMDAGTGFMSVLLFLALQRSDIMLDWWGNTGEGCPVAKCPTAKGVVVHGCPV  739



>ref|XP_010445886.1| PREDICTED: oligopeptide transporter 8 [Camelina sativa]
Length=737

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/730 (62%), Positives = 594/730 (81%), Gaps = 5/730 (1%)
 Frame = +3

Query  129   KSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             +S+ ES    A++E S + EV LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQFFWY
Sbjct  8     RSESES-DSYADDEISVVPEVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFWY  66

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFAN  488
             RT PLTI+++SAQIAVVP+G LMA  +  R FF GT+W FT+NPGPF+ KEHVLIT+FAN
Sbjct  67    RTNPLTISSVSAQIAVVPIGHLMARVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITVFAN  126

Query  489   SGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
             SG+G+VYA H+++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP 
Sbjct  127   SGSGSVYASHIISAVKLYYKRRLDFLPALLVMITTQVLGFGWAGMYRKHLVEPGEMWWPI  186

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
             NLVQVSLFRALHEKE+R K GI+R QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P
Sbjct  187   NLVQVSLFRALHEKEKRTKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWISP  246

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             +S+L  QLGSG  GLGIG+ GLDWS+++SYLGSPLASP+FA+ANIAVGFFL++YV TP+ 
Sbjct  247   KSILVNQLGSGSAGLGIGSFGLDWSTVASYLGSPLASPFFASANIAVGFFLVMYVITPLC  306

Query  1029  YWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             Y+ D++NAKTFPI+S +LF +SG+ Y++ +IID+NF LD +AY + G +++STFFA+TYG
Sbjct  307   YYLDIYNAKTFPIYSGKLFVASGKEYDVRSIIDANFRLDHKAYAETGPVHMSTFFAVTYG  366

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVA  1382
             +GFA LTA++VHV+LF+G+++W Q+K +  K++K+DIHT++M + Y++VP WWF CI   
Sbjct  367   LGFATLTASVVHVLLFNGKDLWNQTKGALGKNKKIDIHTKIMKRNYKEVPLWWFLCIFAV  426

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             N+A+ +F C YY+ Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIGY
Sbjct  427   NLAVIIFICIYYESQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIGY  486

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
              YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  
Sbjct  487   AYPERPVANICFKTYGYISMSQSLTFLADLKLGTYMKIPPRTMFMAQVVGTLVAVFVYAF  546

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM  IP IC T+     + WTCP+D VF+DASVIWGL+GPRR+FG+LG Y  +NWF
Sbjct  547   TAWWLMAEIPNICDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRVFGNLGEYSNINWF  606

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             F+ GAIAP LV+LAT+ FP ++WI +I++PVLI AT+ MPPA+AVN+T+W+I+ F+ G+ 
Sbjct  607   FVGGAIAPALVYLATRLFPNRKWISMIHIPVLIGATAIMPPASAVNFTSWLILAFVFGHF  666

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             VF+YR + WQR+NYVLSG +DAG  FM VLL+L L    ++++WWGN  +GC  A CP+A
Sbjct  667   VFKYRREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSEIAIDWWGNSGEGCSVAKCPTA  726

Query  2277  KGIIVEGCPV  2306
             KG+IV GCPV
Sbjct  727   KGVIVHGCPV  736



>ref|XP_010438561.1| PREDICTED: oligopeptide transporter 6 [Camelina sativa]
Length=735

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/721 (64%), Positives = 591/721 (82%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDD SLPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  14    DDDRCVVPEVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGIS  73

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  74    AQIAVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  133

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  134   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  193

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ +GG++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CWF P+S+L  QLGSG
Sbjct  194   HEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNPKSILVNQLGSG  253

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW ++++AKTF
Sbjct  254   EHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPICYWFNIYDAKTF  313

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF ++G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA L+AT+V
Sbjct  314   PIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSRTGSINMSTFFAVTYGLGFATLSATIV  373

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  374   HVLVFNGSDLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILLLNIALIMFISVH  433

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  434   YNATVQLPWWGVLLACAIAITFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  493

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP 
Sbjct  494   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTGTAWWLMEEIPH  553

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C T    +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LV
Sbjct  554   LCDTALLPSDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWFFLVGAIAPLLV  613

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W +
Sbjct  614   WLATKMFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRREWWTK  673

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + +NWWGN  D D CP ASCP+AKG++++GCP
Sbjct  674   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVNWWGNSGDRDTCPLASCPTAKGVVIKGCP  733

Query  2304  V  2306
             V
Sbjct  734   V  734



>ref|XP_009127158.1| PREDICTED: oligopeptide transporter 8 [Brassica rapa]
 ref|XP_009127159.1| PREDICTED: oligopeptide transporter 8 [Brassica rapa]
 ref|XP_009127160.1| PREDICTED: oligopeptide transporter 8 [Brassica rapa]
Length=740

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/720 (63%), Positives = 587/720 (82%), Gaps = 4/720 (1%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
              ++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQFFWYRT PLTI+++
Sbjct  20    GDDEMSIVPQVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFWYRTNPLTISSV  79

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVP+G LMA  +  R+FF GT+W FT+NPGPF+ KEHVLIT+FANSG+G VYA H
Sbjct  80    SAQIAVVPIGHLMARVLPTRIFFEGTRWSFTMNPGPFSTKEHVLITVFANSGSGAVYASH  139

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             +++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP+NLVQVSLFRA
Sbjct  140   ILSAVKLYYKRRLDFIPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQVSLFRA  199

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LHEKE+R + G+TR QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P+S+L  QLGS
Sbjct  200   LHEKEKRSEWGVTRNQFFVITLIASFSYYLLPGYLFTLLTTISWLCWISPKSILVNQLGS  259

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             G  GLGIG+ GLDWS+I+SYLGSPLASP+FATANIAVG+F+++YV TP+ Y+ D F+AKT
Sbjct  260   GSAGLGIGSFGLDWSTIASYLGSPLASPFFATANIAVGYFIVMYVITPLCYYLDFFDAKT  319

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPI+S +LF ++GQ YN+++II+  F LD +AY + G +++STFFA+TYG+GFA LTA++
Sbjct  320   FPIYSGKLFVANGQEYNVTSIINDEFRLDHKAYAETGPVHMSTFFAVTYGLGFATLTASV  379

Query  1239  VHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACE  1412
             VHV LF+G+++W Q+K +  KD+KMDIHT++M + Y++VP WWF  I V NIA+ VF C 
Sbjct  380   VHVFLFYGKDLWNQTKGALRKDKKMDIHTKIMKRNYKEVPLWWFLSIFVVNIAVIVFICV  439

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             +Y++Q+QLPWWG  LAC+IA+ FT  +G+I A TNQ PGLNIITEYIIGY YP  PVAN+
Sbjct  440   FYEKQIQLPWWGAFLACLIALFFTPLVGVIMATTNQAPGLNIITEYIIGYAYPERPVANI  499

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  TAWWLM  IP
Sbjct  500   CFKTYGYISMSQSLTFLADLKLGSYMKIPPRTMFMAQVVGTLVAVFVYALTAWWLMAEIP  559

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NWFFL GAIAP L
Sbjct  560   NLCDTSLLPPESQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFLGGAIAPTL  619

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             V+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+ +F+Y+ + WQ
Sbjct  620   VYLATRVFPNKKWISSIHMPVLIGATAIMPPATAVNFTSWLVMAFVFGHFLFKYKTEWWQ  679

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG +DAG  FM VLL+L L   ++ L+WWGN  +GCP A CP+AKG++V GCPV
Sbjct  680   RYNYVLSGGMDAGTGFMSVLLFLALQRSDIMLDWWGNTGEGCPVAKCPTAKGVVVHGCPV  739



>emb|CDY47076.1| BnaA03g12220D [Brassica napus]
Length=739

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/731 (63%), Positives = 588/731 (80%), Gaps = 5/731 (1%)
 Frame = +3

Query  129   KSKVESLPEA-AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             +S +ES  +  A++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSF+NQFFW
Sbjct  8     RSGLESESDPYADDEISIVPQVELTVPKTDDPTAPTVTFRMWVLGIAACVLLSFVNQFFW  67

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YRT PLTI+++SAQIAVVP+G LMA  +  R FF+GT+W FT+NPGPF+ KEHVLIT+FA
Sbjct  68    YRTNPLTISSVSAQIAVVPIGHLMAKVLPTRRFFQGTRWSFTMNPGPFSTKEHVLITVFA  127

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSG+G VYA H+++AVK+FY + + FF +L+I++TTQVLGFGWAG++R++LVEP  MWWP
Sbjct  128   NSGSGAVYASHILSAVKLFYKRRLDFFPALLIMITTQVLGFGWAGLYRKHLVEPGEMWWP  187

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             +NLVQVSLFRALHEKE + K GITR QFFVIA + SF+YY+ PGYLF +LT++SW+CW  
Sbjct  188   SNLVQVSLFRALHEKEVKSKWGITRNQFFVIALVTSFSYYILPGYLFSLLTTVSWLCWIR  247

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
             P+S+L  QLGSG  GLGIGA GLDW++I+SYLGSPLASP+FATANIAVGFFL++YV TP+
Sbjct  248   PKSILVNQLGSGSVGLGIGAFGLDWATIASYLGSPLASPFFATANIAVGFFLLMYVITPL  307

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              Y+ D F+A+TFPI+S +LF S+GQ Y +  II+  F LD +AY + G +++STFFA++Y
Sbjct  308   SYYLDFFHARTFPIYSGKLFVSNGQEYKVRNIINDEFRLDHKAYAEAGPVHMSTFFAVSY  367

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILV  1379
             G+GFA LTA++VHV+LF+G+++W QSK   + ++KMDIHT++M + Y++VP WWF  I  
Sbjct  368   GLGFATLTASVVHVLLFNGKDLWNQSKGVLRGNKKMDIHTKIMKRNYKEVPLWWFLSIFA  427

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA+ +F C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIG
Sbjct  428   VNIAVVIFMCFYYKTQIQLPWWGAFLACLIAIFFTPLVGVIKATTNQAPGLNIITEYIIG  487

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A  VY 
Sbjct  488   YAYPERPVANICFKTYGYISMSQSLTFLADLKLGSYMKIPPRTMFMAQVVGTLVAVLVYA  547

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
              TAWWLM  IP +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NW
Sbjct  548   STAWWLMAEIPNLCDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYANINW  607

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFL GAIAP LV+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+
Sbjct  608   FFLGGAIAPALVYLATRIFPKKKWISNIHMPVLIGATAIMPPATAVNFTSWLVMAFVFGH  667

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
              VF+Y+ + WQR+NYVLSG +DAG  FM VLL+L L   ++ L WWGN  +GCP A CP+
Sbjct  668   FVFKYKREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSDIMLGWWGNSGEGCPVAKCPT  727

Query  2274  AKGIIVEGCPV  2306
             AKG+IV GCPV
Sbjct  728   AKGVIVHGCPV  738



>ref|XP_010482752.1| PREDICTED: oligopeptide transporter 9 [Camelina sativa]
Length=741

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/736 (63%), Positives = 586/736 (80%), Gaps = 13/736 (2%)
 Frame = +3

Query  138   VESLPEAAEEENSP-------IREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             VE  P   E E          + EV LTVP TDDP+LPVLTFRMW LG  +C++LSF+NQ
Sbjct  5     VEDSPRVMEIEGDVHDLDRCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFVNQ  64

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLIT  476
             FFWYR  PLTIT ISAQIAVVPLG LMA  +  R+FF G+KWEF++NPGPFNVKEHVLIT
Sbjct  65    FFWYRQMPLTITGISAQIAVVPLGHLMAKVLPTRMFFEGSKWEFSMNPGPFNVKEHVLIT  124

Query  477   IFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAM  656
             IFANSGAGTVYA H+++A+K++Y + + F  + ++++TTQ LGFGWAG+FR++LVEP  M
Sbjct  125   IFANSGAGTVYATHILSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEM  184

Query  657   WWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWIC  836
             WWP+NLVQVSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW+C
Sbjct  185   WWPSNLVQVSLFNALHEKEKKRKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVC  244

Query  837   WFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVF  1016
             W  P+SVL  QLGSG QGLGIGAIG+DW++ISSYLGSPLASP FAT N+A+GF  I+YV 
Sbjct  245   WLSPKSVLVHQLGSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVAIGFAGIMYVA  304

Query  1017  TPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFA  1196
             TPI YW +++ AKT+PIFS  LF  +G +Y++ +IID+ FHLD E Y + G +++STFFA
Sbjct  305   TPICYWLNIYKAKTYPIFSSGLFMGNGSSYDVLSIIDNKFHLDREIYAKTGPIHMSTFFA  364

Query  1197  LTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWC  1370
             +TYG+GFA L+AT+VHV+LF+GR++W+Q++ +F +++KMD+HTR+M K YR+VP WWF+ 
Sbjct  365   MTYGLGFATLSATIVHVLLFNGRDLWKQTRGAFQRNKKMDLHTRIMKKNYREVPMWWFYV  424

Query  1371  ILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEy  1550
             ILV NIAL +F   YY   +QLPWWGVLLACVIA+ FT  IG+I A TNQ PGLN+ITEY
Sbjct  425   ILVLNIALIMFISFYYNATVQLPWWGVLLACVIAVFFTPLIGVIVATTNQAPGLNVITEY  484

Query  1551  iigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGF  1730
             +IGYIYP  PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQVVGT++A  
Sbjct  485   VIGYIYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVAVI  544

Query  1731  VYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEA  1904
             VY GTAWWLM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y A
Sbjct  545   VYTGTAWWLMVDIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSA  604

Query  1905  VNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFL  2084
             +NWFFL GAI P  VWLATKAFP  +WI  I+ PV++ ATS MPPA AVN+T+W IV F+
Sbjct  605   INWFFLVGAICPFFVWLATKAFPAHKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFV  664

Query  2085  SGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPY  2258
              G+ +F+Y+ + W+++NYVLSG LDAG AFM +L++L LG + + L WWGN  D   C  
Sbjct  665   FGHFLFKYKREWWKKYNYVLSGGLDAGTAFMTILIFLSLGRKGIGLLWWGNADDSTNCSL  724

Query  2259  ASCPSAKGIIVEGCPV  2306
             ASCP+AKG+++ GCPV
Sbjct  725   ASCPTAKGVMMHGCPV  740



>ref|XP_006401694.1| hypothetical protein EUTSA_v10015543mg [Eutrema salsugineum]
 gb|ESQ43147.1| hypothetical protein EUTSA_v10015543mg [Eutrema salsugineum]
Length=737

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/720 (63%), Positives = 589/720 (82%), Gaps = 4/720 (1%)
 Frame = +3

Query  159   AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  338
             A++E S + +V LTVP TDDP  P +TFRMWVLG  +CVLLSFLNQFFWYRT PLTI+++
Sbjct  17    ADDEISIVPQVELTVPKTDDPDSPTVTFRMWVLGITACVLLSFLNQFFWYRTNPLTISSV  76

Query  339   SAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIH  518
             SAQIAVVP+G L+A  +  R FF+GT+W FT+NPGPF+ KEHVLIT+FANSG+G+VYA H
Sbjct  77    SAQIAVVPIGHLLARVLPTRRFFQGTRWSFTMNPGPFSTKEHVLITVFANSGSGSVYASH  136

Query  519   VVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  698
             +++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP+NLVQVSLFRA
Sbjct  137   ILSAVKLYYKRRLDFLPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQVSLFRA  196

Query  699   LHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgs  878
             LHEKE+  KGGI+R QFFVI  I SFAYY+ PGYLF +LT++SW+CW  P+S+L  QLGS
Sbjct  197   LHEKEKTSKGGISRNQFFVITLITSFAYYLLPGYLFSVLTTVSWLCWISPKSILVNQLGS  256

Query  879   glqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKT  1058
             G  GLGIGA+GLDWS+I+SYLGSP ASP+FATANIAVGFFL++YV TP+ Y+ D FNAKT
Sbjct  257   GSAGLGIGALGLDWSTIASYLGSPFASPFFATANIAVGFFLVMYVITPLCYYLDFFNAKT  316

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPI+S +LF +SGQ YN+++II+++F LD +AY + G +++STFFA+TYG+GFA LTA++
Sbjct  317   FPIYSGKLFVASGQEYNVTSIINADFRLDHKAYAETGPVHMSTFFAVTYGLGFATLTASV  376

Query  1239  VHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACE  1412
             VHV+LF+G+++W Q+K +F K+ KMDIHT+++ + Y++VP WWF  I V N+A+ VF C 
Sbjct  377   VHVLLFNGKDLWTQTKGAFGKNHKMDIHTKIIKRNYKEVPLWWFLSIFVVNLAVIVFICI  436

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY  Q+QLPWWG  LAC+IA+ FT  +G+I A TNQ PGLNIITEYIIGY YP  PVAN+
Sbjct  437   YYNTQIQLPWWGAFLACLIAVFFTPLVGVIMATTNQAPGLNIITEYIIGYAYPERPVANI  496

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  TAWWLM  IP
Sbjct  497   CFKTYGYISMSQSLTFLADLKLGTYMKIPPRTMFMAQVVGTLVAVFVYALTAWWLMAEIP  556

Query  1773  EICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NWFFL GAIAPVL
Sbjct  557   NLCDTSLLPPGSHWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFLGGAIAPVL  616

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             V+LAT+ FP ++WI  I++PVLI AT+ MPPA+AVN+T+W+++ F+ G+ VF+Y+ + WQ
Sbjct  617   VYLATRIFPNKKWISSIHIPVLIGATAIMPPASAVNFTSWLVMAFVFGHFVFKYKREWWQ  676

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLSG +DAG  FM VLL++ L   ++ L+WWGN  + CP A CP+AKG+I+ GCPV
Sbjct  677   RYNYVLSGGMDAGTGFMSVLLFIALQRSDIVLDWWGNAGESCPVAKCPTAKGVIIHGCPV  736



>ref|XP_010448085.1| PREDICTED: oligopeptide transporter 6 [Camelina sativa]
Length=735

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/732 (64%), Positives = 594/732 (81%), Gaps = 10/732 (1%)
 Frame = +3

Query  141   ESLPEAA----EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             E  PE A    +++   + EV LTVP TDD SLPVLTFRMWVLG  +C++LSF+NQFFWY
Sbjct  3     EIAPEFAAVMEDDDRCVVPEVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWY  62

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFAN  488
             RT PL+IT ISAQIAVVPLG LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFAN
Sbjct  63    RTMPLSITGISAQIAVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFAN  122

Query  489   SGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
             SGAG+VYA H+++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+
Sbjct  123   SGAGSVYATHILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPS  182

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
             NLVQVSLF ALHEKE++ +G ++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CWF P
Sbjct  183   NLVQVSLFGALHEKEKKSRGAMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNP  242

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             +S+L  QLGSG  GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI 
Sbjct  243   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPIC  302

Query  1029  YWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             YW ++++AKTFPIFS +LF ++G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG
Sbjct  303   YWFNIYDAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRVVYSRTGSINMSTFFAVTYG  362

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVA  1382
             +GFA L+AT+VHV++F+G ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ 
Sbjct  363   LGFATLSATIVHVLVFNGSDLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILLL  422

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             NIAL +F   +Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGY
Sbjct  423   NIALIMFISVHYNATVQLPWWGVLLACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGY  482

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
             IYP  PVANMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY G
Sbjct  483   IYPERPVANMCFKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTG  542

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLME IP +C T    +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWF
Sbjct  543   TAWWLMEEIPHLCDTALLPSDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWF  602

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             FL GAIAP+LVWLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ 
Sbjct  603   FLVGAIAPLLVWLATKMFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHF  662

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCP  2270
             +F+YR + W ++NYVLSG LDAG AFM +LL+L LG + + +NWWGN  D D CP ASCP
Sbjct  663   IFKYRREWWTKYNYVLSGGLDAGSAFMTILLFLALGRKGIEVNWWGNSGDRDTCPLASCP  722

Query  2271  SAKGIIVEGCPV  2306
             +AKG++++GCPV
Sbjct  723   TAKGVVIKGCPV  734



>ref|XP_006285678.1| hypothetical protein CARUB_v10007142mg [Capsella rubella]
 gb|EOA18576.1| hypothetical protein CARUB_v10007142mg [Capsella rubella]
Length=736

 Score =   937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/721 (64%), Positives = 591/721 (82%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDD +LPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  15    DDDRCVVPEVELTVPKTDDSTLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGIS  74

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  R F  G++++FTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  75    AQIAVVPLGHLMARVLPTRSFLEGSRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHI  134

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  135   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  194

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEKE++ +GG++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CWF P+S+L  QLGSG
Sbjct  195   HEKEKKARGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNPKSILVNQLGSG  254

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TP+ YW ++++AKTF
Sbjct  255   EHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVCYWLNIYDAKTF  314

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF ++G  Y++ +IID+ FHLD   Y + G + +STFFA+TYG+GFA L+AT+V
Sbjct  315   PIFSSQLFMANGSRYDVLSIIDNKFHLDRLVYSRTGSINMSTFFAVTYGLGFATLSATIV  374

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +
Sbjct  375   HVLVFNGSDLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILILNIALIMFISVH  434

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  435   YNATVQLPWWGVLLACAIAITFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  494

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP 
Sbjct  495   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTGTAWWLMEEIPH  554

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C T    +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LV
Sbjct  555   LCDTALLPSDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWFFLVGAIAPLLV  614

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLATK FP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W +
Sbjct  615   WLATKMFPSQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRREWWTK  674

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + +NWWGN  D D CP ASCP+AKG++++GCP
Sbjct  675   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVNWWGNSGDRDTCPLASCPTAKGVVIKGCP  734

Query  2304  V  2306
             V
Sbjct  735   V  735



>ref|XP_010433323.1| PREDICTED: oligopeptide transporter 6-like [Camelina sativa]
Length=735

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/713 (65%), Positives = 586/713 (82%), Gaps = 6/713 (1%)
 Frame = +3

Query  186   EVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPL  365
             EV LTVP TDD SLPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT ISAQIAVVPL
Sbjct  22    EVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQIAVVPL  81

Query  366   GQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFY  545
             G LMA  +  R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+++A+K++Y
Sbjct  82    GHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHILSAIKLYY  141

Query  546   GKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPK  725
              + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF ALHEKE++ +
Sbjct  142   KRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGALHEKEKKSR  201

Query  726   GGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgiga  905
             G ++RTQFF+I  + SFAYY+FPGYLF MLTS+SW+CWF P+S+L  QLGSG  GLGIG+
Sbjct  202   GNMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNPKSILVNQLGSGEHGLGIGS  261

Query  906   iglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELF  1085
             IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW ++++AKTFPIFS +LF
Sbjct  262   IGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPICYWFNIYDAKTFPIFSSQLF  321

Query  1086  TSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGR  1265
              ++G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA L+AT+VHV++F+G 
Sbjct  322   MANGSRYDVLSIIDSKFHLDRAVYSRTGSINMSTFFAVTYGLGFATLSATIVHVLVFNGS  381

Query  1266  EIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLP  1439
             ++W+Q++ +F K++KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +Y   +QLP
Sbjct  382   DLWKQTRGAFQKNKKMDIHTRIMKKNYREVPLWWFLVILLLNIALIMFISVHYNATVQLP  441

Query  1440  WWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYIS  1619
             WWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMCFKVYGYIS
Sbjct  442   WWGVLLACAIAITFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMCFKVYGYIS  501

Query  1620  MTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--A  1793
             MTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP +C T    
Sbjct  502   MTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTGTAWWLMEEIPHLCDTALLP  561

Query  1794  TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFP  1973
             +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LVWLATK FP
Sbjct  562   SDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWFFLVGAIAPLLVWLATKMFP  621

Query  1974  GQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGA  2153
              Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W ++NYVLSG 
Sbjct  622   AQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRREWWTKYNYVLSGG  681

Query  2154  LDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCPV  2306
             LDAG AFM +LL+L LG + + +NWWGN  D D CP ASCP+AKG++++GCPV
Sbjct  682   LDAGSAFMTILLFLALGRKGIEVNWWGNSGDRDTCPLASCPTAKGVVIKGCPV  734



>gb|KFK29294.1| hypothetical protein AALP_AA7G114600 [Arabis alpina]
Length=735

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/721 (64%), Positives = 588/721 (82%), Gaps = 6/721 (1%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT IS
Sbjct  14    DDDRCVVPEVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGIS  73

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHV  521
             AQIAVVPLG LMA  +  R F +GT+ EFTLNPG FNVKEHVLITIFANSGAG+VYA H+
Sbjct  74    AQIAVVPLGHLMARVLPTRRFCQGTRLEFTLNPGDFNVKEHVLITIFANSGAGSVYATHI  133

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             ++A+K++Y + + F  + ++++TTQ+LGFGWAG+FR++LVEP  MWWP+NLVQVSLF AL
Sbjct  134   LSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGAL  193

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HE+E++ KG ++RTQFF+I  + SFAYY+ PGYLF MLTS+SW+CW  P+S+L  QLGSG
Sbjct  194   HEREKKSKGDMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWLNPKSILVNQLGSG  253

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTF  1061
               GLGIG+IG DW +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW +++ AKTF
Sbjct  254   EHGLGIGSIGFDWVTISAYLGSPLASPLFASINVAIGFVLVMYIVTPICYWLNIYEAKTF  313

Query  1062  PIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLV  1241
             PIFS +LF ++G  Y++ +IIDS FHLD   Y + G + +STFFA+TYG+GFA L+AT+V
Sbjct  314   PIFSSQLFMANGSRYDVLSIIDSKFHLDRVVYSRTGSINMSTFFAVTYGLGFATLSATIV  373

Query  1242  HVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEY  1415
             HV++F+G ++W+Q++ +F K++KMD+HTR+M K YR VP WWF  IL+ NIAL +F   +
Sbjct  374   HVLVFNGSDLWKQTRGAFQKNKKMDVHTRIMKKNYRGVPMWWFLVILLLNIALIMFISVH  433

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMC
Sbjct  434   YNATVQLPWWGVLLACAIAITFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMC  493

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP 
Sbjct  494   FKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTGTAWWLMEEIPH  553

Query  1776  ICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLV  1949
             +C TT   +++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LV
Sbjct  554   LCDTTLLPSDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSSVNWFFLVGAIAPLLV  613

Query  1950  WLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQR  2129
             WLATKAFP Q WI  I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W++
Sbjct  614   WLATKAFPAQTWISKIHIPVLVGATAMMPPATAVNFTSWLIVAFIFGHFIFKYRREWWKK  673

Query  2130  HNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCP  2303
             +NYVLSG LDAG AFM +LL+L LG + + + WWGN  D D CP+ASCP+AKG+ V GCP
Sbjct  674   YNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCPFASCPTAKGVSVAGCP  733

Query  2304  V  2306
             V
Sbjct  734   V  734



>emb|CDY38751.1| BnaC03g14980D [Brassica napus]
Length=739

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/731 (62%), Positives = 585/731 (80%), Gaps = 5/731 (1%)
 Frame = +3

Query  129   KSKVESLPE-AAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             +S++ES  +  A++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSF+NQFFW
Sbjct  8     RSELESESDLIADDEISIVPQVELTVPKTDDPTAPTVTFRMWVLGIAACVLLSFVNQFFW  67

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YRT PLTI+++SAQIAVVP+G LMA  +  R FF+G +W FTLNPGPF+ KEHVLIT+FA
Sbjct  68    YRTNPLTISSVSAQIAVVPIGHLMAKVLPTRRFFQGKRWSFTLNPGPFSTKEHVLITVFA  127

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSG+G VYA H+++AVK+FY + + F  +L+I++T QVLGFGWAG++R++LVEP  MWWP
Sbjct  128   NSGSGAVYASHILSAVKLFYKRRLDFLPALLIMITNQVLGFGWAGLYRKHLVEPGEMWWP  187

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             +NLVQVSLFRALHEKE + K GITR QFFVIA + SF+YY+ PGYLF +LT++SW+CW  
Sbjct  188   SNLVQVSLFRALHEKEVKSKWGITRNQFFVIALVTSFSYYILPGYLFSLLTTVSWLCWIR  247

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
             P+S+L  QLGSG  GLGIGA GLDW++I+SYLGSPLASP+FATANIAVGFFL++YV TP+
Sbjct  248   PKSILVNQLGSGSVGLGIGAFGLDWATIASYLGSPLASPFFATANIAVGFFLLMYVITPL  307

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              Y+ D F+A+TFPI+S +LF S+GQ Y +  II+  F LD +AY + G +++STFFA++Y
Sbjct  308   SYYLDFFHARTFPIYSGKLFVSNGQEYKVRNIINDEFRLDHKAYAEAGPVHMSTFFAVSY  367

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILV  1379
             G+GFA LTA++VHV+LF G+++W QSK   + ++KMDIHT++M + Y++VP WWF  I  
Sbjct  368   GLGFATLTASVVHVLLFDGKDLWNQSKGVLRGNKKMDIHTKIMKRNYKEVPLWWFLSIFA  427

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA+ +F C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIG
Sbjct  428   VNIAVVIFMCFYYKTQIQLPWWGAFLACLIAIFFTPLVGVIKATTNQAPGLNIITEYIIG  487

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A  VY 
Sbjct  488   YAYPERPVANICFKTYGYISMSQSLTFLADLKLGAYMKIPPRTMFMAQVVGTLVAVLVYA  547

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
              TAWWLM  IP +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NW
Sbjct  548   STAWWLMAEIPNLCDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYANINW  607

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFL GAIAP LV+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+
Sbjct  608   FFLGGAIAPALVYLATRIFPKKKWISNIHMPVLIGATAIMPPATAVNFTSWLVMSFVFGH  667

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
              VF+Y+ + WQR+NYVLSG +DAG  FM VLL+L L   +++L WWGN  +GCP A CP+
Sbjct  668   FVFKYKREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSDITLGWWGNSGEGCPVAKCPT  727

Query  2274  AKGIIVEGCPV  2306
             AKG+IV  CPV
Sbjct  728   AKGVIVHACPV  738



>ref|NP_200164.1| oligopeptide transporter 8 [Arabidopsis thaliana]
 sp|Q9FJD1.1|OPT8_ARATH RecName: Full=Oligopeptide transporter 8; Short=AtOPT8 [Arabidopsis 
thaliana]
 dbj|BAB09728.1| isp4 protein [Arabidopsis thaliana]
 gb|ABE66245.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
 gb|AED96372.1| oligopeptide transporter 8 [Arabidopsis thaliana]
Length=733

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/731 (61%), Positives = 589/731 (81%), Gaps = 5/731 (1%)
 Frame = +3

Query  129   KSKVESLPEA-AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             K   +++ E+  ++E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQFFW
Sbjct  2     KDFTDTISESECDDEISIVPQVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFW  61

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YRT PLTI+++SAQIAVVP+G LMA  +  R FF GT+W FT+NPGPF+ KEHVLIT+FA
Sbjct  62    YRTNPLTISSVSAQIAVVPIGHLMAKVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITVFA  121

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSG+G VYA H+++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP
Sbjct  122   NSGSGAVYATHILSAVKLYYKRRLDFLPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWP  181

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             +NLVQVSLFRALHEKE + K GI+R QFFVI  I SF+YY+ PGYLF +LT++SW+CW  
Sbjct  182   SNLVQVSLFRALHEKENKSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWIS  241

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
             P+S+L  QLGSG  GLGIG+ GLDWS+I+SYLGSPLASP+FA+ANIA GFFL++YV TP+
Sbjct  242   PKSILVNQLGSGSAGLGIGSFGLDWSTIASYLGSPLASPFFASANIAAGFFLVMYVITPL  301

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              Y+ D++NAKTFPI+S +LF +SG+ Y +++IID+NF LD +AY + G +++STFFA+TY
Sbjct  302   CYYLDLYNAKTFPIYSGKLFVASGKEYKVTSIIDANFRLDRQAYAETGPVHMSTFFAVTY  361

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILV  1379
             G+GFA L+A++ HV++F+G+++W Q++ +F K++KMDIHT++M + Y++VP WWF  I  
Sbjct  362   GLGFATLSASIFHVLIFNGKDLWTQTRGAFGKNKKMDIHTKIMKRNYKEVPLWWFLSIFA  421

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              N+A+ VF C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIG
Sbjct  422   VNLAVIVFICIYYKTQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIG  481

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A   Y 
Sbjct  482   YAYPERPVANICFKTYGYISMSQSLTFLSDLKLGTYMKIPPRTMFMAQVVGTLVAVIAYA  541

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
             GTAWWLM  IP +C T      + WTCPSD VF+DASVIWGL+GPRR+FGDLG Y  +NW
Sbjct  542   GTAWWLMAEIPNLCDTNLLPPGSQWTCPSDRVFFDASVIWGLVGPRRMFGDLGEYSNINW  601

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FF+ GAIAP LV+LA++ FP ++WI  I++PVLI AT+ MPPA+AVN+T+W+++ F+ G+
Sbjct  602   FFVGGAIAPALVYLASRLFPNKKWISDIHIPVLIGATAIMPPASAVNFTSWLVMAFVFGH  661

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
              VF+YR + WQR+NYVLSG +DAG  FM VLL+L L    ++++WWGN  +GCP A CP+
Sbjct  662   FVFKYRREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSEIAIDWWGNSGEGCPVAKCPT  721

Query  2274  AKGIIVEGCPV  2306
             AKG++V GCPV
Sbjct  722   AKGVVVHGCPV  732



>emb|CDY55351.1| BnaAnng13860D, partial [Brassica napus]
Length=709

 Score =   932 bits (2410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/708 (65%), Positives = 577/708 (81%), Gaps = 11/708 (2%)
 Frame = +3

Query  216   DPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITD  395
             DPSLPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT ISAQIAVVPLG LMA  +  
Sbjct  1     DPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQIAVVPLGHLMARVLPT  60

Query  396   RVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSL  575
             R F  GT+++FTLNPG FNVKEHVLITIFANSGAG+VYA H+++A+K++Y + + F  + 
Sbjct  61    RRFLEGTRFQFTLNPGAFNVKEHVLITIFANSGAGSVYATHILSAIKLYYKRSLPFLPAF  120

Query  576   IIVLTTQ-----VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITR  740
             ++++TTQ     +LGFGWAG+FR++LVEP  MWWP+NLVQVSLF ALHEKE++ KG ++R
Sbjct  121   LVMITTQAFTSSILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGALHEKEKKSKGHMSR  180

Query  741   TQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDW  920
             TQFF+I  + SFAYY+ PGYLF MLTS+SW+CWF P+S+L  QLGSG  GLG+G+IG DW
Sbjct  181   TQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNPKSILVNQLGSGEHGLGVGSIGFDW  240

Query  921   SSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQ  1100
              +IS+YLGSPLASP FA+ N+A+GF L++Y+ TPI YW +++ AKTFPIFS +LF ++G 
Sbjct  241   VTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPICYWLNIYEAKTFPIFSSQLFMANGS  300

Query  1101  TYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQ  1280
              Y++ +IIDS FHLD   Y   G + +STFFA+TYG+GFA LTAT+VHV++F+G ++W+Q
Sbjct  301   RYDVLSIIDSKFHLDRAVYSNTGSINMSTFFAVTYGLGFATLTATIVHVLVFNGSDLWKQ  360

Query  1281  SKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
             ++ +F KD+KMDIHTR+M K YR+VP WWF  IL+ NIAL +F   +Y   +QLPWWGVL
Sbjct  361   TRGAFQKDKKMDIHTRIMKKNYREVPLWWFLVILLLNIALIMFISMHYNATVQLPWWGVL  420

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC IAI FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVANMCFKVYGYISMTQA+
Sbjct  421   LACAIAISFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVANMCFKVYGYISMTQAL  480

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVW  1808
              F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY GTAWWLME IP +C T+   +++ W
Sbjct  481   TFISDFKLGHYMKIPPRSMFMAQVVGTLVAVMVYTGTAWWLMEEIPHLCDTSLLPSDSQW  540

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP D VF+DASVIWGL+GPRR+FGDLG Y +VNWFFL GAIAP+LVWLA KAFP Q WI
Sbjct  541   TCPMDRVFFDASVIWGLVGPRRVFGDLGEYSSVNWFFLVGAIAPLLVWLAAKAFPSQTWI  600

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
               I++PVL+ AT+ MPPATAVN+T+W+IV F+ G+ +F+YR + W+++NYVLSG LDAG 
Sbjct  601   SKIHIPVLVGATAMMPPATAVNFTSWLIVAFVFGHFIFKYRREWWKKYNYVLSGGLDAGS  660

Query  2169  AFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVEGCPV  2306
             AFM +LL+L LG + + + WWGN  D D CP ASCP+AKG++V+GCPV
Sbjct  661   AFMTILLFLALGRKGIEVQWWGNSGDRDTCPLASCPTAKGVVVKGCPV  708



>ref|XP_002864248.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40507.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/733 (62%), Positives = 593/733 (81%), Gaps = 5/733 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             + S+S+ +S+    + E S + +V LTVP TDDP+ P +TFRMWVLG  +CVLLSFLNQF
Sbjct  7     TRSESEWDSV-SYGDNEISIVPQVELTVPKTDDPTSPTVTFRMWVLGISACVLLSFLNQF  65

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYRT PL+I+++SAQIAVVP+G LMA  +  R FF GT+W FT+NPGPF+ KEHVLIT+
Sbjct  66    FWYRTNPLSISSVSAQIAVVPIGHLMARVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITV  125

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSG+G+VYA H+++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LV+P  MW
Sbjct  126   FANSGSGSVYASHILSAVKLYYKRRLDFLPALLVMITTQVLGFGWAGLYRKHLVDPGEMW  185

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP+NLVQVSLFRALHEKE + K GI+R QFFVI  I SF+YY+ PGYLF +LT++SW+CW
Sbjct  186   WPSNLVQVSLFRALHEKENKSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCW  245

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
               P+S+L  QLGSG  GLGIG+ GLDWS+I+SYLGSPLASP+FA+ANIAVGFFL++YV T
Sbjct  246   ISPKSILVNQLGSGSAGLGIGSFGLDWSTIASYLGSPLASPFFASANIAVGFFLVMYVIT  305

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             P+ Y+ D +NAKTFPI+S +LF +SG+ YN+++IID+NF LD +AY + G +++STFFA+
Sbjct  306   PLCYYLDFYNAKTFPIYSGKLFVASGKEYNVTSIIDANFRLDRKAYAETGPVHMSTFFAV  365

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCI  1373
             TYG+GFA L+A++VHV+LF+G+++W Q+K +F K++KMDIHT++M + Y++VP WWF  I
Sbjct  366   TYGLGFATLSASIVHVLLFNGKDLWTQTKGAFRKNKKMDIHTKIMKRNYKEVPLWWFLSI  425

Query  1374  LVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyi  1553
                N+A+ VF C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYI
Sbjct  426   FAVNLAVIVFICIYYKTQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYI  485

Query  1554  igyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFV  1733
             IGY YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A  V
Sbjct  486   IGYAYPERPVANICFKTYGYISMSQSLTFLSDLKLGTYMKIPPRTMFMAQVVGTLVAVIV  545

Query  1734  YLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAV  1907
             Y  TAWWLM  IP +C T+     + WTCPSD VF+DASVIWGL+GPRR+FGDLG Y  +
Sbjct  546   YAITAWWLMAEIPNLCDTSLLPPGSQWTCPSDRVFFDASVIWGLVGPRRMFGDLGEYSNI  605

Query  1908  NWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLS  2087
             NWFF+ GAIAP LV+LAT+ FP ++WI  I++PVL+ AT+ MPPA+AVN+T+W+++ F+ 
Sbjct  606   NWFFVGGAIAPALVYLATRLFPNKKWISNIHIPVLVGATAIMPPASAVNFTSWLVMAFVF  665

Query  2088  GYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASC  2267
             G+ VF+YR + WQR+NYVLSG +DAG  FM VLL+L L    ++++WWGN  +GC  A C
Sbjct  666   GHFVFKYRREWWQRYNYVLSGGMDAGTGFMSVLLFLTLQRSEIAIDWWGNSGEGCAVAKC  725

Query  2268  PSAKGIIVEGCPV  2306
             P+AKG++V GCPV
Sbjct  726   PTAKGVVVHGCPV  738



>ref|XP_009132467.1| PREDICTED: oligopeptide transporter 8-like [Brassica rapa]
 ref|XP_009132468.1| PREDICTED: oligopeptide transporter 8-like [Brassica rapa]
Length=739

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/731 (63%), Positives = 585/731 (80%), Gaps = 5/731 (1%)
 Frame = +3

Query  129   KSKVESLPEA-AEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             +S +ES  +  A++E S + +V LTVP TDDP+ P +TFRM VLG  +CVLLSFLNQFFW
Sbjct  8     RSGLESESDPYADDEISIVPQVELTVPKTDDPTAPTVTFRMGVLGITACVLLSFLNQFFW  67

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YRT PLTI+++SAQIAVVP+G LMA  +  R+FF GT+W FT+NPGPF+ KEHVLIT+FA
Sbjct  68    YRTNPLTISSVSAQIAVVPIGHLMARVLPTRIFFEGTRWSFTMNPGPFSTKEHVLITVFA  127

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             N G+G VYA H+++AVK+FY + + FF +L+I++TTQVLGFGWAG++R++LVEP  MWWP
Sbjct  128   NPGSGAVYASHILSAVKLFYKRRLDFFPALLIMITTQVLGFGWAGLYRKHLVEPGEMWWP  187

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             +NLVQVSLFRALHEKE + K GITR QFFVIA + SF+YY+ PGYLF +LT++SW+C   
Sbjct  188   SNLVQVSLFRALHEKEVKSKWGITRNQFFVIALVTSFSYYILPGYLFSLLTTVSWLCRIR  247

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
             P+S+L  QLGSG  GLGIGA GLDW++I+SYLGSPLASP+FATANIAVGFFL++YV TP+
Sbjct  248   PKSILVNQLGSGSVGLGIGAFGLDWATIASYLGSPLASPFFATANIAVGFFLLMYVITPL  307

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              Y+ D F+A+TFPI+S +LF S+GQ Y +  II+  F LD +AY + G +++STFFA++Y
Sbjct  308   SYYLDFFHARTFPIYSGKLFVSNGQEYKVRNIINDEFRLDHKAYAEAGPVHMSTFFAVSY  367

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILV  1379
             G+GFA LTA++VHV+LF+G+++W QSK   + ++KMDIHT++M + Y++VP WWF  I  
Sbjct  368   GLGFATLTASVVHVLLFNGKDLWNQSKGVLRGNKKMDIHTKIMKRNYKEVPLWWFLSIFA  427

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA+ +F C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIG
Sbjct  428   VNIAVVIFMCFYYKTQIQLPWWGAFLACLIAIFFTPLVGVIKATTNQAPGLNIITEYIIG  487

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             Y YP  PVAN+CFK YGYISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A  VY 
Sbjct  488   YAYPERPVANICFKTYGYISMSQSLTFLADLKLGSYMKIPPRTMFMAQVVGTLVAVLVYA  547

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
              TAWWLM  IP +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NW
Sbjct  548   STAWWLMAEIPNLCDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYANINW  607

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFL GAIAP LV+LAT+ FP ++WI  I+MPVLI AT+ MPPATAVN+T+W+++ F+ G+
Sbjct  608   FFLGGAIAPALVYLATRIFPKKKWISNIHMPVLIGATAIMPPATAVNFTSWLVMAFVFGH  667

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPS  2273
              VF+Y+ + WQR+NYVLSG +DAG  FM VLL+L L   ++ L WWGN  +GCP A CP+
Sbjct  668   FVFKYKREWWQRYNYVLSGGMDAGTGFMSVLLFLALQRSDIMLGWWGNSGEGCPVAKCPT  727

Query  2274  AKGIIVEGCPV  2306
             AKG+IV GCPV
Sbjct  728   AKGVIVHGCPV  738



>ref|XP_006281558.1| hypothetical protein CARUB_v10027665mg [Capsella rubella]
 gb|EOA14456.1| hypothetical protein CARUB_v10027665mg [Capsella rubella]
Length=737

 Score =   931 bits (2407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/730 (62%), Positives = 588/730 (81%), Gaps = 5/730 (1%)
 Frame = +3

Query  129   KSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             +S+ ES     ++E S + +V LTVP  DDP+ P +TFRMWVLG  +CVLLSFLNQFFWY
Sbjct  8     RSEYES-DSYVDDEISVVPQVELTVPKADDPTSPTVTFRMWVLGITACVLLSFLNQFFWY  66

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFAN  488
             RT PLTI+++SAQIAVVP+G LMA  +  R FF GT+W FT+NPGPF  KEHVLIT+FAN
Sbjct  67    RTNPLTISSVSAQIAVVPIGHLMARVLPTRRFFEGTRWSFTMNPGPFGTKEHVLITVFAN  126

Query  489   SGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
             SG+GTVYA H+++AVK++Y + + F  +L++++TTQVLGFGWAG++R++LVEP  MWWP+
Sbjct  127   SGSGTVYASHILSAVKLYYKRRLDFLPALLVMVTTQVLGFGWAGLYRKHLVEPGEMWWPS  186

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
             NLVQVSLFRALHEKE+R K GI+R QFFVI  I SF+YY+ PGYLF +LT++SW+CW  P
Sbjct  187   NLVQVSLFRALHEKEKRSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWISP  246

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             +S+   QLGSG  GLGIG+ GLDW++I+SYLGSPLASP+FA+ANIAVGFFL++YV T + 
Sbjct  247   KSIFVNQLGSGAAGLGIGSFGLDWTTIASYLGSPLASPFFASANIAVGFFLVMYVITLLC  306

Query  1029  YWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             Y+ D +NAKTFPI+S +LF +SG+ YN+++IID+NF LD +AY + G +++STFFA+TYG
Sbjct  307   YYLDFYNAKTFPIYSGKLFVASGKEYNVTSIIDANFRLDRKAYAETGPVHMSTFFAVTYG  366

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVA  1382
             +GFA LTA++VHV+LF+G+++W Q++ +F K++KMDIHTR+M + Y++VP WWF  I   
Sbjct  367   LGFATLTASIVHVLLFNGKDLWTQTRGAFRKNKKMDIHTRIMKRNYKEVPLWWFLSIFAV  426

Query  1383  NIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigy  1562
             N+A+ VF C YYK Q+QLPWWG  LAC+IAI FT  +G+I A TNQ PGLNIITEYIIGY
Sbjct  427   NLAVIVFICIYYKTQIQLPWWGAFLACLIAIFFTPLVGVIMATTNQAPGLNIITEYIIGY  486

Query  1563  iypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLG  1742
              YP  PVAN+CFK YG+ISM+Q++ FL D KLG YMKIPPRTMFMAQVVGT++A FVY  
Sbjct  487   AYPERPVANICFKTYGFISMSQSLTFLADLKLGTYMKIPPRTMFMAQVVGTLVAVFVYAL  546

Query  1743  TAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWF  1916
             TAWWLM  IP +C T+     + WTCP+D VF+DASVIWGL+GPRR+FGDLG Y  +NWF
Sbjct  547   TAWWLMAEIPNLCDTSLLPPGSQWTCPTDRVFFDASVIWGLVGPRRMFGDLGEYSNINWF  606

Query  1917  FLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYV  2096
             F+ GAIAP LV+LAT+ FP ++WI  I++PVLI AT+ MPPA+AVN+T+W+++ F+ G+ 
Sbjct  607   FVGGAIAPALVYLATRLFPNKKWISNIHIPVLIGATAIMPPASAVNFTSWLVMAFVFGHF  666

Query  2097  VFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSA  2276
             VF+YR + WQR+NYVLSG LDAG  FM VLL+L L    + ++WWGN  +GC  A CP+A
Sbjct  667   VFKYRREWWQRYNYVLSGGLDAGTGFMSVLLFLALQRSEIGIDWWGNFGEGCSVAKCPTA  726

Query  2277  KGIIVEGCPV  2306
             KG+IV GCPV
Sbjct  727   KGVIVHGCPV  736



>ref|XP_010537060.1| PREDICTED: oligopeptide transporter 6-like [Tarenaya hassleriana]
Length=742

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/726 (64%), Positives = 589/726 (81%), Gaps = 7/726 (1%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             +  +E+   + +V LTVP TDDP++PVLTFRMWVLG  +C++LSF+NQFFWYRT PL+I+
Sbjct  17    DGEDEDRCVVEQVELTVPKTDDPTIPVLTFRMWVLGLGACIVLSFVNQFFWYRTMPLSIS  76

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
              ISAQIAVVPLG LMA  +    +  GT+WEF+LNPGPFNVKEHVLITIFANSGAG+VYA
Sbjct  77    GISAQIAVVPLGHLMARILPTSKYLEGTRWEFSLNPGPFNVKEHVLITIFANSGAGSVYA  136

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++A+K++Y + + F  + ++++TTQVLGFGWAG+FR++LVEP  MWWP+NLVQVSLF
Sbjct  137   THILSAIKLYYKRALPFLPAFLVMITTQVLGFGWAGLFRKHLVEPGEMWWPSNLVQVSLF  196

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
              ALHEKE+R +GG TRTQFF++  + SFAYYV PGYLF MLTS+SW+CW  PRS+L  QL
Sbjct  197   SALHEKEKRTRGGTTRTQFFLVVLVASFAYYVLPGYLFTMLTSISWVCWLGPRSILVNQL  256

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL GLGIGA+G+DW++ISSYLGSPLASP FAT N+A+GF LI+YV +PI+YW D++ A
Sbjct  257   GSGLHGLGIGAVGIDWATISSYLGSPLASPLFATVNVAIGFVLIMYVASPIWYWLDIYKA  316

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFPIFS +LF S+G  YN+ +IID  F LD + Y + G +++STFFA+TYG+GFA L+A
Sbjct  317   KTFPIFSSKLFMSNGLDYNVLSIIDKKFELDHDVYAKTGPIHMSTFFAMTYGLGFATLSA  376

Query  1233  TLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFA  1406
             T+VHV+LF+G ++W+Q++ +FK ++KMDIHT++M K YR+VP  WF  ILV NI L +F 
Sbjct  377   TIVHVLLFNGSDLWKQTRGAFKRNKKMDIHTKIMKKNYREVPMLWFLVILVLNIGLIMFI  436

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
               +Y   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVA
Sbjct  437   SVHYNATVQLPWWGVLLACAIAVFFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVA  496

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             NMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPR+MFMAQVVGT++A  VY  TAWWLM  
Sbjct  497   NMCFKVYGYISMTQALTFISDFKLGHYMKIPPRSMFMAQVVGTLVAVVVYTATAWWLMAD  556

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             IP +C T+    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  VNWFFL GA+AP
Sbjct  557   IPHLCDTSLLPPDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSKVNWFFLGGAVAP  616

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
             ++VW ATKAFP Q WI  I++PVL+ AT+ MPPATAVN+T+WI+V  + G+ V++YR + 
Sbjct  617   LMVWSATKAFPSQTWIPKIHIPVLVGATAMMPPATAVNFTSWIVVAVVFGHFVYKYRREW  676

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLG-LENVSLNWWGN--DLDGCPYASCPSAKGIIV  2291
             W+++NYVLSG LDAG AFM +LL+L L   +++ LNW GN  D D CP+ASCP+AKG++V
Sbjct  677   WKKYNYVLSGGLDAGTAFMTILLFLALQRRDDIGLNWLGNGSDHDTCPFASCPTAKGVVV  736

Query  2292  EGCPVI  2309
             +GCPV+
Sbjct  737   DGCPVL  742



>ref|XP_007156164.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
 gb|ESW28158.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
Length=653

 Score =   923 bits (2386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/652 (71%), Positives = 547/652 (84%), Gaps = 8/652 (1%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MAA +T RVF +GTKWEFTLNPG FNVKEHVLITIFA+SGA +VYAI+ V+AVK+FY K 
Sbjct  1     MAAAVTRRVFMKGTKWEFTLNPGKFNVKEHVLITIFASSGAASVYAIYFVSAVKLFYRKD  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANL-----VQVSLFRALHEKEER  719
             +T   +L++V+T+QVLGFGWAGIFR+YLVEPAAMWWP N      +Q+  FRALHEKEER
Sbjct  61    LTILTALLVVITSQVLGFGWAGIFRKYLVEPAAMWWPQNFFSGLALQLCYFRALHEKEER  120

Query  720   PKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgi  899
              KGG+TR QFF+IAF+CSFAYYVFPGYLF  LTS+SWICW FP SV+A QLGSGL GLG+
Sbjct  121   RKGGLTRNQFFLIAFLCSFAYYVFPGYLFPSLTSISWICWMFPTSVIAHQLGSGLHGLGV  180

Query  900   gaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDE  1079
             GAIG DWSSI SYLGSPLASPWFATAN+A GF + +Y   PI Y  +++NA+ FPIFSDE
Sbjct  181   GAIGFDWSSICSYLGSPLASPWFATANVAAGFAIFIYAIVPIAYSTNLYNARRFPIFSDE  240

Query  1080  LFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFH  1259
             LF S+GQ YNISAIIDSNFHLD+EAY++EG LYLST FA++YG+GFA ++ATLVHV LFH
Sbjct  241   LFMSNGQKYNISAIIDSNFHLDMEAYEREGPLYLSTMFAMSYGIGFACISATLVHVSLFH  300

Query  1260  GREIWEQSKSSFKDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQL  1436
             G EI   SKS+F++ K+DIHT++M K Y+QVPEWWF CIL+ NI  T+F CEY+  +LQL
Sbjct  301   GSEILRLSKSAFQENKIDIHTKIMRKNYKQVPEWWFLCILLFNIVATIFICEYFNNELQL  360

Query  1437  PWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYI  1616
             PWWGV+LACV+A+ FTLPIG+I A TNQ P LNIITEYIIGY+YPGYPVANM FKVYG +
Sbjct  361   PWWGVVLACVVAMSFTLPIGVIRATTNQAPALNIITEYIIGYVYPGYPVANMLFKVYGDV  420

Query  1617  SMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--  1790
             SM QA+ FLQDFKLGHYMKIPPR MF+AQVVGT+++G V+L T+WWLM T+P IC+    
Sbjct  421   SMQQAVFFLQDFKLGHYMKIPPREMFLAQVVGTLMSGVVHLLTSWWLMNTVPNICERALL  480

Query  1791  ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAF  1970
                + WTCP DHVFYDASVIWGLIGPRR FGDLG Y A+NWFFLAGAIAP LVWLA KA 
Sbjct  481   PAGSPWTCPGDHVFYDASVIWGLIGPRRTFGDLGHYSAINWFFLAGAIAPFLVWLAHKAL  540

Query  1971  PGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSG  2150
             P ++WIRLI +PVL+ A S+MPPATAVNYT+W+IVGF+SG+VV+RY    W RHNYVLSG
Sbjct  541   PQKQWIRLITVPVLLGALSDMPPATAVNYTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSG  600

Query  2151  ALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ALDAGLAFMGVLLYLCLG+E++SLNWWG D DGCP ASCP+A G+   GCP+
Sbjct  601   ALDAGLAFMGVLLYLCLGMEHISLNWWGTDSDGCPLASCPTAPGVESVGCPL  652



>gb|KFK26970.1| hypothetical protein AALP_AA8G317000 [Arabis alpina]
Length=742

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/735 (64%), Positives = 589/735 (80%), Gaps = 8/735 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             S+    +E + E  E +   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQF
Sbjct  9     STGAMNIEGVVE--ELDQCVVEEVELTVPKTDDPTLPVLTFRMWVLGLGACIILSFVNQF  66

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYR  PLTIT ISAQIAVVPLG LMA  +  R F  G++WEF LNPGPFN+KEHV+ITI
Sbjct  67    FWYRQMPLTITGISAQIAVVPLGHLMARLLPTRKFLEGSRWEFCLNPGPFNIKEHVMITI  126

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAGTVYA H+++A+K++Y + + F  + +I++TTQ LGFGWAG+FR++LVEP  MW
Sbjct  127   FANSGAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMW  186

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP+NLVQVSLF ALHEKE++ KGGITR QFF+I  + SFAYY+ PGYLF M+TS+SW+CW
Sbjct  187   WPSNLVQVSLFSALHEKEKKKKGGITRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCW  246

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
               P+SVLA QLGSG QGLGIGAIG+DW++I SYLGSPLASP FAT N+ +GF +++YV T
Sbjct  247   LSPKSVLANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPLFATINVTIGFVVVMYVAT  306

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             PI YW +++NAKT+PIFS  LF  +G +YN+  IID+ FHLD + Y + G +++STFFA+
Sbjct  307   PICYWLNLYNAKTYPIFSSGLFMGNGSSYNVLGIIDNKFHLDRDIYAKTGPIHMSTFFAI  366

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCI  1373
             TYG+GFA L+AT+VHV+LF+GR++W+Q++ +FK ++KMD+HTR+M K Y +VP WWF  I
Sbjct  367   TYGLGFATLSATIVHVLLFNGRDLWKQTRGAFKRNKKMDVHTRIMKKNYTEVPMWWFLVI  426

Query  1374  LVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyi  1553
             LV NIAL +F   YY + +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLN+ITEY+
Sbjct  427   LVLNIALIMFISLYYNQTVQLPWWGVLLACAIAVFFTPLIGVIAATTNQEPGLNVITEYV  486

Query  1554  igyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFV  1733
             IGYIYP  PVANM FKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQVVGT++A  V
Sbjct  487   IGYIYPERPVANMYFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVAVIV  546

Query  1734  YLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAV  1907
             Y GTAWWLM  IP +C  +     + WTCP D VF+DASVIWGL+GPRR+FGDLG Y A+
Sbjct  547   YTGTAWWLMVDIPHLCDKSLLPPGSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSAI  606

Query  1908  NWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLS  2087
             NWFFL GAIAP+LVWLATKAFPGQ+WI  I+ PV++ ATS MPPA AVN+T+W IV F+ 
Sbjct  607   NWFFLVGAIAPLLVWLATKAFPGQKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFIF  666

Query  2088  GYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYA  2261
             G+ +F+Y+ + W+++NYVLSG LDAG AFM +L++L LG + V L WWGN  D   C  A
Sbjct  667   GHFLFKYKREWWKKYNYVLSGGLDAGTAFMTILIFLTLGRKGVGLLWWGNADDSTNCSLA  726

Query  2262  SCPSAKGIIVEGCPV  2306
             SCP+AKG+I++GCPV
Sbjct  727   SCPTAKGVIMDGCPV  741



>ref|NP_001167707.1| uncharacterized protein LOC100381394 [Zea mays]
 gb|ACL52789.1| unknown [Zea mays]
 gb|AFW86096.1| hypothetical protein ZEAMMB73_576147 [Zea mays]
 gb|AFW86097.1| hypothetical protein ZEAMMB73_576147 [Zea mays]
Length=655

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/580 (79%), Positives = 520/580 (90%), Gaps = 3/580 (1%)
 Frame = +3

Query  576   IIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFV  755
             + V+ TQVLGFGWAGIFRRYLVEPAAMWWP+NLVQVSLFRALHEKE R KGG+TR QFF+
Sbjct  74    VRVVCTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRVKGGMTRNQFFL  133

Query  756   IAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISS  935
             +AF+CSFAYYVFPGYLFQMLTSLSW+CW FPRSV+AQQLGSGL GLG+GA+GLDWS+ISS
Sbjct  134   VAFVCSFAYYVFPGYLFQMLTSLSWLCWAFPRSVVAQQLGSGLSGLGVGAVGLDWSTISS  193

Query  936   YLGSPLASPWFATANIAVGFFLILYVFTPI-FYWCDVFNAKTFPIFSDELFTSSGQTYNI  1112
             YLGSPLASPWFATAN+A GF LI+YV TP  +YW  ++ A++FPIFSD LFT++GQTYNI
Sbjct  194   YLGSPLASPWFATANVAAGFVLIMYVITPAAYYWLGLYGARSFPIFSDGLFTAAGQTYNI  253

Query  1113  SAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSS  1292
             S+I+DSNF  D EAY++ G LYLSTFFA+TYGVGFA+LTAT+VHV LFHG EIW+ S+S+
Sbjct  254   SSIVDSNFRFDTEAYERNGPLYLSTFFAVTYGVGFASLTATVVHVFLFHGSEIWQLSRSA  313

Query  1293  FKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIA  1472
             F+++K+D+HTRLM +YRQVPEWWF CILVAN+A+T+FACEYY EQLQLPWWGVLLAC IA
Sbjct  314   FQEKKVDVHTRLMRRYRQVPEWWFICILVANVAVTIFACEYYIEQLQLPWWGVLLACAIA  373

Query  1473  IIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDF  1652
               FTLPIGIITA TNQTPGLNIITEYI+GY+YPG PVANMCFKVYGYISMTQA+AFLQDF
Sbjct  374   FFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMTQALAFLQDF  433

Query  1653  KLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDH  1826
             KLGHYMKIPPRTMFMAQVVGT+IA  VY+GTAWWLM+++P IC T     ++ WTCP DH
Sbjct  434   KLGHYMKIPPRTMFMAQVVGTLIAALVYIGTAWWLMDSVPNICSTELLPADSPWTCPMDH  493

Query  1827  VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMP  2006
             VFYDASVIWGLIGPRRIFGDLGTY AVNWFFL GA+AP+LVWLA + FP Q WI L+NMP
Sbjct  494   VFYDASVIWGLIGPRRIFGDLGTYSAVNWFFLGGAVAPLLVWLAHRVFPSQSWILLVNMP  553

Query  2007  VLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVL  2186
             VLI +T  MPPATAVNYTTWII GFLSGYVV+RYR   W+RHNY+LSGALDAGLAFM VL
Sbjct  554   VLIGSTGMMPPATAVNYTTWIIAGFLSGYVVYRYRRHWWERHNYLLSGALDAGLAFMAVL  613

Query  2187  LYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +YLCLGLENV LNWWGNDLDGCP ASCP+AKGI+VEGCPV
Sbjct  614   IYLCLGLENVGLNWWGNDLDGCPLASCPTAKGIVVEGCPV  653



>ref|XP_009119900.1| PREDICTED: oligopeptide transporter 9 [Brassica rapa]
Length=741

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/728 (63%), Positives = 581/728 (80%), Gaps = 7/728 (1%)
 Frame = +3

Query  144   SLPEAAEE-ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
              + EA +E +   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFWYR  P
Sbjct  13    EIEEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMP  72

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             LTIT ISAQIAVVPLG LMA  + ++ +  G++WEF +NPGPFN+KEHV+ITIFANSGAG
Sbjct  73    LTITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANSGAG  132

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             TVYA H+++A+K++Y + + F  + +I++TTQ LGFGWAG+FR++LVEP  MWWP+NLVQ
Sbjct  133   TVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQ  192

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW+CW  P+SVL
Sbjct  193   VSLFSALHEKEKKKKGGMTRIQFFIIVLVTSFAYYILPGYLFTMITSISWVCWLSPKSVL  252

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
             A QLGSG QGLGIGAIG+DW++I SYLGSPLASP FAT N+ +GF +I+YV TPI YW +
Sbjct  253   ANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPIFATVNVTIGFVIIMYVATPICYWLN  312

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
             ++ AKT+PIFS  LF  +G +Y++ +IID  FHLD   Y + G +++STFFA+TYG+GFA
Sbjct  313   LYRAKTYPIFSSGLFMGNGSSYDVLSIIDDKFHLDRAVYAKTGPIHMSTFFAVTYGLGFA  372

Query  1221  ALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILVANIAL  1394
              L+AT+VHV+LF+GR++W+Q++ +FK ++KMDIHTR+M K YR+VP WWF  ILV NIAL
Sbjct  373   TLSATIVHVLLFNGRDLWKQTRGAFKRNKKMDIHTRIMKKNYREVPMWWFLVILVLNIAL  432

Query  1395  TVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypg  1574
              VF   YY   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLN+ITEY+IGYIYP 
Sbjct  433   IVFISVYYNATVQLPWWGVLLACAIAVFFTPLIGVILATTNQAPGLNVITEYVIGYIYPE  492

Query  1575  ypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWW  1754
              PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+M++AQVVGT++A  VY GTAWW
Sbjct  493   RPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMYLAQVVGTLVAVLVYTGTAWW  552

Query  1755  LMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             LM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y A+NWFFL G
Sbjct  553   LMVDIPHLCDKSLLPDDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSAINWFFLVG  612

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             AI P  VWLATKAFP Q+WI  I+ PV++ ATS MPPA AVN+T+W IV F+ G+ VF+Y
Sbjct  613   AITPFFVWLATKAFPAQKWISQIHFPVILGATSMMPPAMAVNFTSWCIVAFIFGHFVFKY  672

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKG  2282
             + + W ++NYVLSG LDAG AFM +L++L LG   + L WWGN  D   C  ASCP+AKG
Sbjct  673   KREWWTKYNYVLSGGLDAGTAFMTILIFLALGRRGIGLAWWGNADDSTNCGLASCPTAKG  732

Query  2283  IIVEGCPV  2306
             ++ +GCPV
Sbjct  733   VVTQGCPV  740



>ref|XP_006401695.1| hypothetical protein EUTSA_v10016096mg [Eutrema salsugineum]
 gb|ESQ43148.1| hypothetical protein EUTSA_v10016096mg [Eutrema salsugineum]
Length=740

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/738 (62%), Positives = 585/738 (79%), Gaps = 8/738 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEE--NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFL  290
             A  S S+   + E  ++E     + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+
Sbjct  2     AEHSTSRAMEIEEVVDDELDRCAVDEVELTVPKTDDPTLPVLTFRMWVLGLSACIILSFV  61

Query  291   NQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVL  470
             NQFFWYR  PL IT ISAQIAV+PLG LMA  + +R +  G++WEF +NPGPFNVKEHV+
Sbjct  62    NQFFWYRQMPLMITGISAQIAVLPLGHLMARVLPNRKYLEGSRWEFNMNPGPFNVKEHVM  121

Query  471   ITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             ITIFANSGAGTVYA H+++A+K++Y + + F  + ++++TTQ LGFGWAG+FR++LV+P 
Sbjct  122   ITIFANSGAGTVYATHILSAIKLYYKRTLPFLPAFLLMITTQFLGFGWAGLFRKHLVDPG  181

Query  651   AMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSW  830
              MWWP NLVQVSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW
Sbjct  182   EMWWPGNLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISW  241

Query  831   ICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILY  1010
             +CW  P+SVL  QLGSG +GLGIGAIG+DW++I SYLGSPLASP FAT N+A+GF  ++Y
Sbjct  242   VCWLSPKSVLVNQLGSGERGLGIGAIGIDWATIGSYLGSPLASPIFATINVAIGFVGVMY  301

Query  1011  VFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTF  1190
             V  P+ YW +++NAKTFPIFS  LF  +G +Y++ +IID+ FHLD E Y + G +++STF
Sbjct  302   VAIPVCYWLNLYNAKTFPIFSSSLFRGNGSSYDVLSIIDNKFHLDREVYAKTGPIHMSTF  361

Query  1191  FALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWF  1364
             FALTYG+GFA L+AT+VHV+LF+G ++W+Q+K +F +++KMDIHTR+M K YR+VP WWF
Sbjct  362   FALTYGLGFATLSATMVHVLLFNGSDLWKQTKGAFNRNKKMDIHTRIMKKNYREVPMWWF  421

Query  1365  WCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIIT  1544
               ILV NIAL +F   YY   +QLPWWGVLLAC IAI FT  IG+I A TNQ PGLN+IT
Sbjct  422   LVILVLNIALIMFISVYYNATVQLPWWGVLLACAIAIAFTPLIGVIVATTNQAPGLNVIT  481

Query  1545  EyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIA  1724
             EY+IGYIYP  PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQV+GT++A
Sbjct  482   EYVIGYIYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVLGTLVA  541

Query  1725  GFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
               VY GTAWWLM  IP +C T+    N+ WTCP D VF+DASVIWGL+GPRR+FGDLG Y
Sbjct  542   VIVYTGTAWWLMVDIPHLCDTSLLPPNSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEY  601

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
              A+NWFFL GAIAP L+WLATKAFP ++WI  I+ PV++ AT+ MPPA AVN+T+WIIV 
Sbjct  602   SAINWFFLVGAIAPFLIWLATKAFPAKKWISKIHFPVILGATAMMPPAMAVNFTSWIIVA  661

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDG--C  2252
             F+ G+ +F+Y+ + W+++NYVLSG LDAG AFM +L++L +G   + L W GN  D   C
Sbjct  662   FIFGHFLFKYKREWWKKYNYVLSGGLDAGTAFMTILIFLAIGRNGIGLTWLGNAGDSGVC  721

Query  2253  PYASCPSAKGIIVEGCPV  2306
               ASCP+AKG++  GCPV
Sbjct  722   ALASCPTAKGVVKHGCPV  739



>ref|XP_010520948.1| PREDICTED: oligopeptide transporter 6 [Tarenaya hassleriana]
Length=739

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/725 (64%), Positives = 592/725 (82%), Gaps = 7/725 (1%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E  +E+   + +V LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFWYRT PL+IT
Sbjct  14    EGDDEDRCVVEQVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFVNQFFWYRTMPLSIT  73

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
              ISAQIAVVPLG LMA  +  R +F GT+WEF++NPGPFNVKEHVLITIFANSGAG+VYA
Sbjct  74    GISAQIAVVPLGHLMARILPTRKYFEGTRWEFSMNPGPFNVKEHVLITIFANSGAGSVYA  133

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++A+K++Y + + F  + ++++TTQVLGFGWAG+FR++LVEP  MWWP+NLVQVSLF
Sbjct  134   THILSAIKLYYKRALPFLPAFLVMITTQVLGFGWAGLFRKHLVEPGEMWWPSNLVQVSLF  193

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
              ALHEKE++ KGG TRTQFF+I  + SFAYYV PGYLF MLTS+SW+C F  +S+L  QL
Sbjct  194   SALHEKEKKKKGGTTRTQFFLIVLVASFAYYVVPGYLFTMLTSISWVCLFGSKSILVNQL  253

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG  GLGIGAIG+DW++I+SYLGSPLASP FAT NIA+GF LI+YV +PI+YW +++ A
Sbjct  254   GSGEHGLGIGAIGIDWATIASYLGSPLASPLFATVNIAIGFVLIMYVASPIWYWLNIYRA  313

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFPIFS +LF ++G +Y++ +IID  F LD E Y + G +++STFFA+TYG+GFA L+A
Sbjct  314   KTFPIFSSKLFMANGLSYDVLSIIDKKFELDREVYAKTGPIHMSTFFAMTYGLGFATLSA  373

Query  1233  TLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFA  1406
             T+VHV LF+GR++W+Q++ +F +++KMDIHT++M K Y++VP WWF  ILV NIAL +F 
Sbjct  374   TIVHVFLFNGRDLWKQTRGAFQRNKKMDIHTKIMKKNYKEVPMWWFLVILVLNIALIIFI  433

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
               +Y   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLNIITEY+IGYIYP  PVA
Sbjct  434   SIHYNATVQLPWWGVLLACAIAVFFTPLIGVIAATTNQAPGLNIITEYVIGYIYPERPVA  493

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             NMCFKVYGYISMTQA+ F+ DFKLGHYMKIPPRTMFMAQVVGT++A  VY  TAWWLM  
Sbjct  494   NMCFKVYGYISMTQALTFISDFKLGHYMKIPPRTMFMAQVVGTIVAVVVYSATAWWLMAD  553

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             IP +C T     ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  VNWFFL GA+AP
Sbjct  554   IPHLCDTNLLPPDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSNVNWFFLGGAVAP  613

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
              +VWLA KAFP Q WI  I++PVL+ AT+ MPPATAVN+T+WI+V F+ G+ V++YR + 
Sbjct  614   FMVWLAAKAFPNQTWISKIHIPVLMGATAMMPPATAVNFTSWIVVAFIFGHFVYKYRREW  673

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLG-LENVSLNWWGN--DLDGCPYASCPSAKGIIV  2291
             W+++NYVLSG LDAG AFM +LL+L L   ++++LNWWGN  + D CP+ASCP+AKG+IV
Sbjct  674   WKKYNYVLSGGLDAGTAFMTILLFLALQRRDDIALNWWGNAGERDMCPFASCPTAKGVIV  733

Query  2292  EGCPV  2306
             +GCPV
Sbjct  734   KGCPV  738



>emb|CDY35662.1| BnaC09g29840D [Brassica napus]
Length=741

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/728 (63%), Positives = 580/728 (80%), Gaps = 7/728 (1%)
 Frame = +3

Query  144   SLPEAAEE-ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
              + EA +E +   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFWYR  P
Sbjct  13    EIEEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMP  72

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             LTIT ISAQIAVVPLG LMA  + ++ +  G++WEF +NPGPFN+KEHV+ITIFANSGAG
Sbjct  73    LTITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANSGAG  132

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             TVYA H+++A+K++Y + + F  + +I++TTQ LGFGWAG+FR++LVEP  MWWP++LVQ
Sbjct  133   TVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSSLVQ  192

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW+CW  P+SVL
Sbjct  193   VSLFSALHEKEKKKKGGMTRIQFFIIVLVTSFAYYILPGYLFTMITSISWVCWLSPKSVL  252

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
             A QLGSG QGLGIGAIG+DW++I SYLGSPLASP FAT N+ +GF +I+YV TPI YW +
Sbjct  253   ANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPIFATVNVTIGFVIIMYVATPICYWLN  312

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
             ++ AKT+PIFS  LF  +G +Y++ +IID  FHLD   Y + G +++STFFA+TYG+GFA
Sbjct  313   LYRAKTYPIFSSGLFMGNGSSYDVLSIIDDKFHLDRAVYAKTGPIHMSTFFAVTYGLGFA  372

Query  1221  ALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILVANIAL  1394
              L+AT+VHV+LF+GR++W+Q++ +FK ++KMDIHTR+M K YR+VP WWF  ILV NIAL
Sbjct  373   TLSATIVHVLLFNGRDLWKQTRGAFKRNKKMDIHTRIMKKNYREVPMWWFLVILVLNIAL  432

Query  1395  TVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypg  1574
              VF   YY   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLN+ITEY+IGYIYP 
Sbjct  433   IVFISVYYNATVQLPWWGVLLACAIAVFFTPLIGVILATTNQAPGLNVITEYVIGYIYPE  492

Query  1575  ypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWW  1754
              PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+M++AQVVGT++A  VY GTAWW
Sbjct  493   RPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMYLAQVVGTLVAVLVYTGTAWW  552

Query  1755  LMETIPEICQT--TATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             LM  IP +C       ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y A+NWFFL G
Sbjct  553   LMVDIPHLCDKYLLPDDSQWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSAINWFFLVG  612

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             AI P  VWLATKAFP Q+WI  I+ PV++ ATS MPPA AVN+T+W IV F+ G+ VF+Y
Sbjct  613   AITPFFVWLATKAFPAQKWISQIHFPVILGATSMMPPAMAVNFTSWCIVAFIFGHFVFKY  672

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKG  2282
             + + W ++NYVLSG LDAG AFM +L++L LG   + L WWGN  D   C  ASCP+AKG
Sbjct  673   KREWWTKYNYVLSGGLDAGTAFMTILIFLALGRRGIGLAWWGNADDSKNCGLASCPTAKG  732

Query  2283  IIVEGCPV  2306
             ++ +GCPV
Sbjct  733   VVTQGCPV  740



>ref|XP_002864247.1| ATOPT9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40506.1| ATOPT9 [Arabidopsis lyrata subsp. lyrata]
Length=741

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/736 (63%), Positives = 583/736 (79%), Gaps = 6/736 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
               S   +E   E  + +   + EV LTVP TDDP+LPVLTFRMW LG  +C++LSF+NQF
Sbjct  6     EDSSRVMEIGGEVDDLDRCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFINQF  65

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYR  PLTI+ ISAQIAVVPLG LMA  +  R+F  G+KWEF +NPGPFNVKEHVLITI
Sbjct  66    FWYRQMPLTISGISAQIAVVPLGHLMARVLPTRMFLEGSKWEFCMNPGPFNVKEHVLITI  125

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAGTVYA HV++A+K++Y + + F  + ++++TTQ LGFGWAG+FR++LVEP  MW
Sbjct  126   FANSGAGTVYATHVLSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMW  185

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP+NLVQVSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW+CW
Sbjct  186   WPSNLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCW  245

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
               P+SVLA QLGSG QGLGIGAIG+DW++ISSYLGSPLASP FAT N+ +GF +I+YV T
Sbjct  246   LSPKSVLAHQLGSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVTIGFVVIMYVAT  305

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             PI YW +++ AKT+PIFS  LF  +G +Y++ +IID  FHLD E Y + G +++STFFA+
Sbjct  306   PICYWLNIYKAKTYPIFSSGLFMGNGSSYDVLSIIDKKFHLDREIYAKTGPIHMSTFFAV  365

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCI  1373
             TYG+GFA L+AT+VHV+LF+GR++W+Q++ +F +++KMD+H R+M K YR+VP WWF+ I
Sbjct  366   TYGLGFATLSATIVHVLLFNGRDLWKQTRGAFQRNKKMDLHARIMKKNYREVPMWWFYVI  425

Query  1374  LVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyi  1553
             LV NIAL +F   YY   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLN+ITEY+
Sbjct  426   LVLNIALIMFISFYYNATVQLPWWGVLLACAIAVFFTPLIGVIAATTNQEPGLNVITEYV  485

Query  1554  igyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFV  1733
             IGY+YP  PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQVVGT+++  V
Sbjct  486   IGYLYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVSVIV  545

Query  1734  YLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAV  1907
             Y GTAWWLM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y A+
Sbjct  546   YTGTAWWLMVDIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYAAI  605

Query  1908  NWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLS  2087
             NWFFL GAIAP  VWLATKAFP  +WI  I+ PV++ ATS MPPA AVN+T+W IV F+ 
Sbjct  606   NWFFLVGAIAPFFVWLATKAFPAHKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFVF  665

Query  2088  GYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYA  2261
             G+ +F+Y+   W ++NYVLSG LDAG AFM +L++L LG + + L WWGN  D   C  A
Sbjct  666   GHFLFKYKRQWWTKYNYVLSGGLDAGTAFMTILIFLSLGRKGIGLLWWGNADDSTNCSLA  725

Query  2262  SCPSAKGIIVEGCPVI  2309
             SCP+AKG+I+ GCPV+
Sbjct  726   SCPTAKGVIMHGCPVL  741



>ref|XP_006281882.1| hypothetical protein CARUB_v10028080mg [Capsella rubella]
 gb|EOA14780.1| hypothetical protein CARUB_v10028080mg [Capsella rubella]
Length=742

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/724 (64%), Positives = 584/724 (81%), Gaps = 6/724 (1%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             +  E E S + EV LTVP TDDP+LPVLTFRMW LG  +C++LSF+NQFFWYR  PLTIT
Sbjct  18    QVDELERSVVDEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFVNQFFWYRQMPLTIT  77

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
              ISAQIAVVPLG LMA  +  R+FF G+KWEF++NPGPFNVKEHVLITIFANSGAGTVYA
Sbjct  78    GISAQIAVVPLGHLMARVLPTRMFFEGSKWEFSMNPGPFNVKEHVLITIFANSGAGTVYA  137

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
              H+++A+K++Y + + F  + ++++TTQ LGFGWAG+FR++LVEP  MWWP+NLVQVSLF
Sbjct  138   THILSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQVSLF  197

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
              ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SW+CWF P+SVL  QL
Sbjct  198   SALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCWFSPKSVLVHQL  257

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG QGLGIGAIG+DW++ISSYLGSPLASP FAT N+ +GF  I+YV TPI YW +++ A
Sbjct  258   GSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVTIGFAAIMYVATPICYWLNLYKA  317

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KT+PIFS  LF  +G +Y++ +IID+ FHLD E Y + G + +STFFA+TYG+GFA L+A
Sbjct  318   KTYPIFSSGLFMGNGSSYDVLSIIDNKFHLDREVYAKTGPINMSTFFAVTYGLGFATLSA  377

Query  1233  TLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFA  1406
             T+VHV+LF+GR++W Q++ +F +++KMD+HTR+M K YR+VP WWF+ ILV NIAL +F 
Sbjct  378   TVVHVLLFNGRDLWRQTRGAFQRNKKMDLHTRIMKKNYREVPMWWFYVILVLNIALIMFV  437

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
               YY   +QLPWWGVLLAC IA++FT  IG+I A TNQ PGLN+ITEY+IGYIYP  PVA
Sbjct  438   SFYYNATVQLPWWGVLLACAIAVVFTPLIGVIAATTNQEPGLNVITEYVIGYIYPERPVA  497

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             NMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQVVGT++A  VY GTAWWLM  
Sbjct  498   NMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVAVVVYTGTAWWLMVD  557

Query  1767  IPEICQTTAT--NTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y A+NWFFL GAIAP
Sbjct  558   IPHLCDKSMLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGAYSAINWFFLVGAIAP  617

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
              LVWLATKAFP  +WI  I+ PV++ ATS MPPA AVN+T+W IV F+ G+ +F+Y+ + 
Sbjct  618   FLVWLATKAFPAHKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFVFGHFLFKYKREW  677

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKGIIVE  2294
             W ++NYVLSG LDAG AFM +L++L LG + + L WWGN  D   C  ASCP+AKG+++ 
Sbjct  678   WTKYNYVLSGGLDAGTAFMTILIFLSLGRKGIGLLWWGNADDSTNCSLASCPTAKGVMMH  737

Query  2295  GCPV  2306
             GCPV
Sbjct  738   GCPV  741



>gb|KCW45497.1| hypothetical protein EUGRSUZ_L00776 [Eucalyptus grandis]
Length=621

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/646 (72%), Positives = 532/646 (82%), Gaps = 28/646 (4%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MA  IT RVFF G +W+FTLNPGPFNVKEHVLITIFANSGA +VYAIH+++ VK+FY K 
Sbjct  1     MAGVITRRVFFEGRRWQFTLNPGPFNVKEHVLITIFANSGASSVYAIHIISVVKIFYRKE  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             ++F V+L+IVLTTQVLGFGWAG+FRRYLVEPAAMWWP NLVQVSLF              
Sbjct  61    MSFAVALVIVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLF--------------  106

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
                         SF+YYVFPGYLF MLTSLSWICW FP SVLAQQLGSGL GLGIGA+GL
Sbjct  107   ------------SFSYYVFPGYLFPMLTSLSWICWLFPASVLAQQLGSGLHGLGIGAVGL  154

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSIS+YLGSPLASPWFATANIAVGF L++YV TPI YW +++ AKTF +FSD LFTSS
Sbjct  155   DWSSISAYLGSPLASPWFATANIAVGFALVMYVITPIAYWLNIYRAKTFSLFSDSLFTSS  214

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAII+ +F LD EAY++EG LYL T F++ YG+ FA LTAT+VH  LFHG+EIW
Sbjct  215   GQEYNISAIINEHFQLDAEAYEREGPLYLCTVFSVYYGISFACLTATVVHGFLFHGKEIW  274

Query  1275  EQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVL  1454
               SKS+F ++KMDIHT+LM +Y+QVPEWWF CIL+ NI  T+F CEY+K+QLQLPWWGVL
Sbjct  275   LLSKSAFSEKKMDIHTKLMRRYKQVPEWWFTCILLVNIVATIFICEYFKDQLQLPWWGVL  334

Query  1455  LACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAI  1634
             LAC +AI FTLP+G+ITA TNQTP LN+ITE+IIGYIYPGYPVAN+ FKVYGYISM Q I
Sbjct  335   LACALAIFFTLPVGVITATTNQTPALNVITEFIIGYIYPGYPVANILFKVYGYISMKQGI  394

Query  1635  AFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVW  1808
              FLQDFKLGHYMKIPPR MFMAQVVGT++A  V+L TAWWLM+T+P+IC        + W
Sbjct  395   TFLQDFKLGHYMKIPPREMFMAQVVGTIVAALVHLRTAWWLMDTVPDICNRALLPAGSPW  454

Query  1809  TCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWI  1988
             TCP D VF+D SVIWGLIGPRRIFGDLG Y A+NWFFL GAIAP +VWLA KAFP +EWI
Sbjct  455   TCPGDTVFFDGSVIWGLIGPRRIFGDLGYYSAINWFFLVGAIAPFIVWLAHKAFPDKEWI  514

Query  1989  RLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGL  2168
             RLI MPVL+ AT +MPPATAVNYT+WII GFLSG+V +RY    W RHNY LSGALDAGL
Sbjct  515   RLITMPVLLGATVSMPPATAVNYTSWIIAGFLSGFVAYRYYRGWWSRHNYALSGALDAGL  574

Query  2169  AFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             AFM VLLYLCLG+++VSL+WWG D DGCP A+CP+AKG++VEGCPV
Sbjct  575   AFMAVLLYLCLGMKHVSLSWWGEDPDGCPLAACPTAKGVVVEGCPV  620



>ref|XP_002971950.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
 gb|EFJ26867.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
Length=740

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/720 (62%), Positives = 555/720 (77%), Gaps = 13/720 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             + +EEE SPI EVALTVPTTDD SLPV TFRMW LG LSC LL+F+NQFF YRTEPLT+ 
Sbjct  29    KLSEEEQSPIEEVALTVPTTDDASLPVYTFRMWTLGLLSCALLAFINQFFSYRTEPLTVG  88

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYA  512
              ISAQIA +PLG+LMAA +      R     F+LNPGPFNVKEHVLITIFAN+GAG  YA
Sbjct  89    VISAQIAALPLGRLMAAALPSAQL-RLLGRSFSLNPGPFNVKEHVLITIFANAGAGGAYA  147

Query  513   IHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLF  692
             I +V  VK FYG+ ++F ++          G+GWAGIFRRYLV+PA MWWP+NLVQVS+F
Sbjct  148   IGIVNIVKAFYGRELSFVIT----------GYGWAGIFRRYLVDPAEMWWPSNLVQVSIF  197

Query  693   RALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
               LHEK+ R KG +TR QFF+I   CSF YY  PGYLF+ LTS+SW+CW +P+SVLA QL
Sbjct  198   NTLHEKDSRRKGDVTRLQFFLITLACSFLYYSLPGYLFKTLTSISWVCWAWPKSVLAHQL  257

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSG+ G+GIGA+G DWS+++SYL SPLA+PWFA AN+ VGF +++YV TP  Y+ +V++A
Sbjct  258   GSGMSGMGIGAVGFDWSTVASYLSSPLATPWFAIANVMVGFLIVMYVITPAAYFSNVYSA  317

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             KTFPIFS +LF   G  YNIS +++  F LD++AY+   KL LSTFF  TYGVGFAALTA
Sbjct  318   KTFPIFSSQLFADDGSRYNISRVVNERFELDVQAYNSYSKLNLSTFFVFTYGVGFAALTA  377

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             T+ HVVLFHG+E+W ++ ++F   K+D+HTRLM KY+  P+WWF  +L  +I  ++  C 
Sbjct  378   TVSHVVLFHGKEMWSRAVAAFHAEKLDVHTRLMRKYKPCPQWWFLALLALSIFGSIITCV  437

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
              +K+Q+QLPWWGVLLAC +A +FTLPIG+ITA TNQTPGLN+ITE+IIGY+YPG PVAN+
Sbjct  438   VFKDQVQLPWWGVLLACGLAFVFTLPIGVITATTNQTPGLNVITEFIIGYMYPGRPVANV  497

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFK YGYISM QAI FL DFKLGHYMKIPPR+MF  Q++GT +A  V LGTAWWL+ ++ 
Sbjct  498   CFKTYGYISMLQAITFLADFKLGHYMKIPPRSMFTVQIIGTAVAALVNLGTAWWLLTSVD  557

Query  1773  EICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              IC T      + WTCPSD VF+ ASVIWGLIGP RIFG LG Y+A+NWFFL GA+AP+L
Sbjct  558   NICHTDKLPQGSPWTCPSDRVFFSASVIWGLIGPNRIFGSLGHYQAINWFFLVGAVAPLL  617

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VWLA KAFP Q WIR +NMP+LI AT NMPPAT+VNYT+W +VGF+  Y++F++R   W 
Sbjct  618   VWLAAKAFPRQRWIRYVNMPILIGATGNMPPATSVNYTSWFVVGFIFNYLIFKHRKKWWT  677

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             R+NYVLS A+DAGLAFMG+ LY     + + L WWG D+D CP ASCP+AKG     CP+
Sbjct  678   RYNYVLSAAMDAGLAFMGIFLYFATREDRMELAWWGQDVDNCPLASCPAAKGARSSDCPL  737



>ref|XP_009132469.1| PREDICTED: oligopeptide transporter 9-like [Brassica rapa]
Length=746

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/733 (62%), Positives = 583/733 (80%), Gaps = 6/733 (1%)
 Frame = +3

Query  126   SKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFW  305
             S + +E      E +   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFW
Sbjct  13    STAAMEIEEGVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLGACIILSFINQFFW  72

Query  306   YRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFA  485
             YR  PL+IT ISAQIAVVPLG LMA  + ++ +  G++WEF +NPGPFNVKEHV+ITIFA
Sbjct  73    YRRMPLSITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNVKEHVMITIFA  132

Query  486   NSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWP  665
             NSGAGTVYA H+++A+K++Y + + F  + +I++TTQ LGFGWAG+FR++LVEP  MWWP
Sbjct  133   NSGAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWP  192

Query  666   ANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFF  845
             +NLVQVSLF ALHEKE++ KGG+TR QFF+   + SFAYY+ PGYLF M+TS+SW+CW  
Sbjct  193   SNLVQVSLFSALHEKEKKKKGGMTRIQFFLTVLVTSFAYYILPGYLFTMITSISWVCWLS  252

Query  846   PRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI  1025
             P+SVL  QLGSG QGLGIGA+G+DW++ISSYLGSPLASP  AT N+ VGF +++YV TPI
Sbjct  253   PKSVLVNQLGSGEQGLGIGAVGIDWATISSYLGSPLASPIVATINVTVGFVVVVYVVTPI  312

Query  1026  FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
              YW +++NAKT+PIFS  LF  +G +Y++ +IID+ FHLD + Y + G + +STFFA+TY
Sbjct  313   CYWLNLYNAKTYPIFSSGLFMGNGSSYDVLSIIDNKFHLDRDIYAKTGPIQMSTFFAVTY  372

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILV  1379
             G+GFA L+AT+VHV+LFHG ++W+Q++ +FK ++KMDIHTR+M K Y++VP WWF  ILV
Sbjct  373   GLGFATLSATMVHVLLFHGSDLWKQTRGAFKRNKKMDIHTRIMKKNYKEVPMWWFLVILV  432

Query  1380  ANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiig  1559
              NIA+ VF   YY   +QLPWWGVLLAC IA++FT  IG+I A TNQ PGLN+ITEY+IG
Sbjct  433   INIAVIVFISVYYNATVQLPWWGVLLACAIAVVFTPLIGVIVATTNQAPGLNVITEYVIG  492

Query  1560  yiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYL  1739
             YIYP  PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+M+MAQV+GT++A  VY 
Sbjct  493   YIYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMYMAQVLGTLVAVIVYT  552

Query  1740  GTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNW  1913
             GTAWWLM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  +NW
Sbjct  553   GTAWWLMAEIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSNINW  612

Query  1914  FFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGY  2093
             FFL GAIAP LVWLATKAFP Q+WI  I+ PV++ AT+ MPPA  VN+T+W IV F+ G+
Sbjct  613   FFLLGAIAPFLVWLATKAFPAQKWISNIHFPVILGATAMMPPAMVVNFTSWCIVAFIFGH  672

Query  2094  VVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASC  2267
              VF+Y+ + W+++NYVLSG LDAG AFM +L++L LG + + L WWGN  D   C  ASC
Sbjct  673   FVFKYKREWWKKYNYVLSGGLDAGTAFMTILIFLALGRKGIGLVWWGNADDSTNCSLASC  732

Query  2268  PSAKGIIVEGCPV  2306
             P+AKG+I+ GCPV
Sbjct  733   PTAKGVIMNGCPV  745



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/741 (60%), Positives = 570/741 (77%), Gaps = 10/741 (1%)
 Frame = +3

Query  111   GFASSSKSKVESLP--EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLS  284
             G A SS+S+    P  EA  ++ SP+ EVALTV T DDP+LPV TFRMW LG LSC+LLS
Sbjct  3     GGAGSSESEPLVAPQVEAEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLS  62

Query  285   FLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF-FRGTKWEFTLNPGPFNVKE  461
             FLNQFF YRTEP  I  IS QI  +P G+ MA  + +R F    T   F+LNPGPFNVKE
Sbjct  63    FLNQFFSYRTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKE  122

Query  462   HVLITIFANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFR  629
             HVLITIFAN+G+G      YA+ +V   + FY + + F   L++V+TTQVLG+GWAG+ +
Sbjct  123   HVLITIFANAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMK  182

Query  630   RYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQ  809
             ++LVEPA MWWP NLVQVSLFR LHE++++ K G +R+QFF I    SF YYV PGY+F 
Sbjct  183   KHLVEPAHMWWPGNLVQVSLFRTLHEEDQQQKKGFSRSQFFAIVMTLSFCYYVLPGYMFM  242

Query  810   MLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAV  989
             MLTS+SW+CW FP+SVLAQQLGSGL+GLG+G+  LDW++IS+YLGSPL +PWFA  N+  
Sbjct  243   MLTSMSWVCWIFPKSVLAQQLGSGLKGLGLGSFSLDWATISAYLGSPLVTPWFAICNVIF  302

Query  990   GFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEG  1169
             G+ +++Y+ TP  YW ++++AK +P+FS  LFT  GQ Y++++++D NF LDLEAY ++G
Sbjct  303   GYLVVMYIVTPACYWSNIYDAKIYPLFSSYLFTKDGQVYDVTSVVDKNFDLDLEAYARKG  362

Query  1170  KLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQV  1349
              +++STFFA +YG+GFAA+ +TL HV  FHG+ IWE+S+++  + K DIHTRLM KY  V
Sbjct  363   PVHMSTFFAFSYGLGFAAVASTLTHVACFHGKYIWERSRAALTE-KPDIHTRLMRKYPDV  421

Query  1350  PEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPG  1529
             P+WWF  ++V +IA ++  C YYK +LQLPWWGVLLACV+A  FTLPIG+ITA TN TPG
Sbjct  422   PQWWFHTLMVISIAASIATCAYYKAELQLPWWGVLLACVVASSFTLPIGVITATTNITPG  481

Query  1530  LNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVV  1709
             LNIITEY++GY+ PG P+AN+CFK YGYISMTQAI+FLQDFKLGHYMK+P R+MF  Q +
Sbjct  482   LNIITEYLMGYLLPGQPMANVCFKTYGYISMTQAISFLQDFKLGHYMKVPHRSMFHVQFI  541

Query  1710  GTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFG  1883
             GT++A  V +  AWWL+ +I  IC  +    N+ WTCPSD VF+DASVIWGLIGP+R+FG
Sbjct  542   GTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLIGPKRMFG  601

Query  1884  DLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTT  2063
               G Y+ + WFFL GA+ PVLVWLA++ FP  +WI LIN+PV++ AT+ MPPAT+VNY +
Sbjct  602   SHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPATSVNYIS  661

Query  2064  WIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDL  2243
             W IVG +  Y +FRY    WQR+NYV S A+DAG+AFMGVLLYLCLG+EN SL+WWGN++
Sbjct  662   WSIVGIIFNYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSLSWWGNNV  721

Query  2244  DGCPYASCPSAKGIIVEGCPV  2306
             D CP A CP+AKGI++ GCPV
Sbjct  722   DNCPLADCPTAKGIVIAGCPV  742



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/741 (60%), Positives = 569/741 (77%), Gaps = 10/741 (1%)
 Frame = +3

Query  111   GFASSSKSK--VESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLS  284
             G A SS+S+  V    E   ++ SP+ EVALTV T DDP+LPV TFRMW LG LSC+LLS
Sbjct  3     GGAGSSESEPLVTREVEPEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLS  62

Query  285   FLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF-FRGTKWEFTLNPGPFNVKE  461
             FLNQFF YRTEP  I  IS QI  +P G+ MA  + +R F    T   F+LNPGPFNVKE
Sbjct  63    FLNQFFSYRTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKE  122

Query  462   HVLITIFANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFR  629
             HVLITIFAN+G+G      YA+ +V   + FY + + F   L++V+TTQVLG+GWAG+ +
Sbjct  123   HVLITIFANAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMK  182

Query  630   RYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQ  809
             ++LVEPA MWWP NLVQVSLFR LHE++++ K G +R+QFF I    SF YYV PGY+F 
Sbjct  183   KHLVEPAHMWWPGNLVQVSLFRTLHEEDQQQKKGFSRSQFFAIVMTLSFCYYVLPGYMFM  242

Query  810   MLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAV  989
             MLTS+SW+CW FP+SVLAQQLGSGL+GLG+G+  LDW++IS+YLGSPL +PWFA  N+  
Sbjct  243   MLTSMSWVCWIFPKSVLAQQLGSGLKGLGLGSFSLDWATISAYLGSPLVTPWFAICNVIF  302

Query  990   GFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEG  1169
             G+ +++Y+ TP  YW +++NAK +P+FS  LFT  GQ Y++++++D NF LDLEAY ++G
Sbjct  303   GYLVVMYIVTPACYWSNIYNAKIYPLFSSYLFTKDGQVYDVTSVVDKNFDLDLEAYARKG  362

Query  1170  KLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQV  1349
              +++STFFA +YG+GFAA+ +TL HV  FHG+ IWE+S+++  + K DIHTRLM KY  V
Sbjct  363   PVHMSTFFAFSYGLGFAAVASTLTHVACFHGKYIWERSRAALNE-KPDIHTRLMRKYPDV  421

Query  1350  PEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPG  1529
             P+WWF  ++V +IA ++  C YYK +LQLPWWGVLLACV+A  FTLPIG+ITA TN TPG
Sbjct  422   PQWWFHTLMVISIAASIATCAYYKAELQLPWWGVLLACVVASSFTLPIGVITATTNITPG  481

Query  1530  LNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVV  1709
             LNIITEY++GY+ PG P+AN+CFK YGYISMTQAI+FLQDFKLGHYMK+P R+MF  Q +
Sbjct  482   LNIITEYLMGYLLPGQPMANVCFKTYGYISMTQAISFLQDFKLGHYMKVPHRSMFHVQFI  541

Query  1710  GTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFG  1883
             GT++A  V +  AWWL+ +I  IC  +    N+ WTCPSD VF+DASVIWGLIGP+R+FG
Sbjct  542   GTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLIGPKRMFG  601

Query  1884  DLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTT  2063
               G Y+ + WFFL GA+ PVLVWLA++ FP  +WI LIN+PV++ AT+ MPPAT+VNY +
Sbjct  602   SHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPATSVNYIS  661

Query  2064  WIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDL  2243
             W IVG +  Y +FRY    WQR+NYV S A+DAG+AFMGVLLYLCLG+EN SL+WWGN++
Sbjct  662   WSIVGIIFSYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSLSWWGNNV  721

Query  2244  DGCPYASCPSAKGIIVEGCPV  2306
             D CP A CP+AKGI++ GCPV
Sbjct  722   DNCPLADCPTAKGIVIAGCPV  742



>ref|NP_200163.1| oligopeptide transporter 9 [Arabidopsis thaliana]
 sp|Q9FJD2.1|OPT9_ARATH RecName: Full=Oligopeptide transporter 9; Short=AtOPT9 [Arabidopsis 
thaliana]
 dbj|BAB09727.1| isp4 protein [Arabidopsis thaliana]
 gb|AED96371.1| oligopeptide transporter 9 [Arabidopsis thaliana]
Length=741

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/736 (62%), Positives = 583/736 (79%), Gaps = 6/736 (1%)
 Frame = +3

Query  120   SSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
               S   +E   +  + +   + EV LTVP TDDP+LPVLTFRMW LG  +C++LSF+NQF
Sbjct  6     EDSSRVMEIEGQNDDLDRCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFINQF  65

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             FWYR  PLTI+ ISAQIAVVPLG LMA  +  R+F  G+KWEF++NPGPFNVKEHVLITI
Sbjct  66    FWYRQMPLTISGISAQIAVVPLGHLMAKVLPTRMFLEGSKWEFSMNPGPFNVKEHVLITI  125

Query  480   FANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             FANSGAGTVYA H+++A+K++Y + + F  + ++++TTQ LGFGWAG+FR++LVEP  MW
Sbjct  126   FANSGAGTVYATHILSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMW  185

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP+NLVQVSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+TS+SWICW
Sbjct  186   WPSNLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWICW  245

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
               P+SVL  QLGSG QGLGIGAIG+DW++ISSYLGSPLASP FAT N+ +GF +I+YV T
Sbjct  246   LGPKSVLVHQLGSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVTIGFVVIMYVAT  305

Query  1020  PIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFAL  1199
             PI YW +++ AKT+PIFS  LF  +G +Y++ +IID  FHLD + Y + G + +STFFA+
Sbjct  306   PICYWLNIYKAKTYPIFSSGLFMGNGSSYDVLSIIDKKFHLDRDIYAKTGPINMSTFFAV  365

Query  1200  TYGVGFAALTATLVHVVLFHGREIWEQSKSSF-KDRKMDIHTRLMSK-YRQVPEWWFWCI  1373
             TYG+GFA L+AT+VHV+LF+GR++W+Q++ +F +++KMD HTR+M K YR+VP WWF+ I
Sbjct  366   TYGLGFATLSATIVHVLLFNGRDLWKQTRGAFQRNKKMDFHTRIMKKNYREVPMWWFYVI  425

Query  1374  LVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyi  1553
             LV NIAL +F   YY   +QLPWWGVLLAC IA+ FT  IG+I A TNQ PGLN+ITEY+
Sbjct  426   LVLNIALIMFISFYYNATVQLPWWGVLLACAIAVFFTPLIGVIAATTNQEPGLNVITEYV  485

Query  1554  igyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFV  1733
             IGY+YP  PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+MFMAQVVGT+++  V
Sbjct  486   IGYLYPERPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMFMAQVVGTLVSVVV  545

Query  1734  YLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAV  1907
             Y GTAWWLM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FG+LG Y A+
Sbjct  546   YTGTAWWLMVDIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGNLGEYAAI  605

Query  1908  NWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLS  2087
             NWFFL GAIAP  VWLATKAFP  +WI  I+ PV++ ATS MPPA AVN+T+W IV F+ 
Sbjct  606   NWFFLVGAIAPFFVWLATKAFPAHKWISKIHFPVILGATSMMPPAMAVNFTSWCIVAFVF  665

Query  2088  GYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYA  2261
             G+ +++Y+   W+++NYVLSG LDAG AFM +L++L +G + + L WWGN  D   C  A
Sbjct  666   GHFLYKYKRQWWKKYNYVLSGGLDAGTAFMTILIFLSVGRKGIGLLWWGNADDSTNCSLA  725

Query  2262  SCPSAKGIIVEGCPVI  2309
             SCP+AKG+I+ GCPV+
Sbjct  726   SCPTAKGVIMHGCPVL  741



>gb|KEH19466.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=648

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/647 (70%), Positives = 543/647 (84%), Gaps = 3/647 (0%)
 Frame = +3

Query  375   MAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKH  554
             MA+ IT RVF +G KWEFTLNPG FNVKEHVLITIFA+SGA +VYAIH V+ VKVFY K 
Sbjct  1     MASTITKRVFMKGKKWEFTLNPGKFNVKEHVLITIFASSGAASVYAIHFVSTVKVFYRKE  60

Query  555   ITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGI  734
             IT  V+L++VLTTQVLGFGWAG+FRRYLVEPA MWWP NLVQVSLFRALHEKEER KGG+
Sbjct  61    ITVLVALLVVLTTQVLGFGWAGVFRRYLVEPAGMWWPQNLVQVSLFRALHEKEERQKGGL  120

Query  735   TRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaigl  914
             TR QFF+I FICSFAYYV PGYLF MLTSLSWICW FP S++AQQLGSGL GLG+GAIG 
Sbjct  121   TRNQFFLITFICSFAYYVLPGYLFPMLTSLSWICWVFPNSIIAQQLGSGLHGLGVGAIGF  180

Query  915   DWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSS  1094
             DWSSI SYLGSPLASPWFATANIA GF + +YV  PI Y  ++++ ++FPIFSD LF ++
Sbjct  181   DWSSICSYLGSPLASPWFATANIAAGFGIFMYVVVPIAYGLNLYHGRSFPIFSDGLFNTN  240

Query  1095  GQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIW  1274
             GQ YNISAIIDSNFHLDL+AY +EG LYLST FA++YG+ FA L+A LVHV+LFHG +I 
Sbjct  241   GQEYNISAIIDSNFHLDLDAYQREGPLYLSTMFAMSYGIDFACLSAILVHVLLFHGSDIL  300

Query  1275  EQSKSSFKDRKMDIHTRLMSK-YRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGV  1451
             + SKS+F+ +++DIHT++M K Y+QVPEWWF+CIL+ +I  + F CEYY +QLQLPWWGV
Sbjct  301   QLSKSAFQGKEIDIHTKIMRKHYKQVPEWWFFCILLFSITASTFVCEYYNDQLQLPWWGV  360

Query  1452  LLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQA  1631
             +LAC++A+ FTLP+G+I A TNQ P LN+ITEYIIGYIYPGYPVA M FKV G +SM QA
Sbjct  361   MLACILALSFTLPVGVIRATTNQAPALNVITEYIIGYIYPGYPVAVMLFKVIGNVSMKQA  420

Query  1632  IAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTV  1805
             I FLQDFKLGHYMKIPPR MF+AQV+GT+IA  V+L TAWWL+ET+P IC  +     + 
Sbjct  421   IFFLQDFKLGHYMKIPPRAMFLAQVLGTIIAAIVHLLTAWWLIETVPNICHRELLPAGSP  480

Query  1806  WTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEW  1985
             WTCP DHVFYD+SV+WGLIGPRRIFG+LG Y A+NWFFL GA+AP +VWLA KA P ++W
Sbjct  481   WTCPGDHVFYDSSVVWGLIGPRRIFGNLGHYSAINWFFLVGAVAPFIVWLAHKALPDKQW  540

Query  1986  IRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAG  2165
             I+LI MPV++ A + MPPAT VNYT+W++VGF SG+V +RY    W RHNYVLSGALDAG
Sbjct  541   IKLITMPVILGALTEMPPATPVNYTSWVLVGFASGFVAYRYYRGWWTRHNYVLSGALDAG  600

Query  2166  LAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             LAFMGVL+YLCLG++++SL+WWG+D D CP ASCP+A G+I  GCP+
Sbjct  601   LAFMGVLIYLCLGMQHISLDWWGSDPDRCPLASCPTAPGVISAGCPL  647



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/724 (60%), Positives = 571/724 (79%), Gaps = 12/724 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E  + + SP+ EV LTVP  DDPSLPV TFRMW LG  SCVLLSFLN FF YRT+PL I+
Sbjct  14    EEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPLMIS  73

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----  500
              IS Q+  +P+G++MA  + D+ F  G+ +EF+LNPGPFNVKEHVLI++FAN+GAG    
Sbjct  74    MISIQVVTLPIGKMMARVLPDKKFRVGS-FEFSLNPGPFNVKEHVLISMFANAGAGYGSG  132

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             T YA+ +V  +K FY ++I+F  S ++V+TTQVLG+GWAGI RR LVEPA MWWP++L+Q
Sbjct  133   TAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLVEPAQMWWPSSLLQ  192

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLFRALHEK+ +    ++R +FF+IAF+CSFA+Y+FPGYLF  L+++SW+CW FP+SV 
Sbjct  193   VSLFRALHEKDTQ---RMSRGKFFLIAFLCSFAWYIFPGYLFPTLSAISWVCWVFPKSVT  249

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-C  1037
             AQQ+GSG+ GLG+GA  LDWS I+SYLGSPL SP+FA  N+ VG+ L++Y+F PI YW  
Sbjct  250   AQQIGSGMSGLGLGAFALDWSVIASYLGSPLISPFFAIVNVIVGYVLVMYMFIPIAYWGV  309

Query  1038  DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGF  1217
             ++++AK FPIFS +LF S GQ YN SAI++  F LD+ +Y +EG++YLSTFF+LTYG+GF
Sbjct  310   NMYDAKKFPIFSSDLFDSKGQLYNTSAIVNDEFELDIPSYGREGRVYLSTFFSLTYGIGF  369

Query  1218  AALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALT  1397
             AA+ +TL HV LF+G+ I +Q ++S  D K+DIHTRLM KY+ +P WWF  +L+ ++AL+
Sbjct  370   AAIVSTLTHVALFNGKGILQQLRASASD-KVDIHTRLMRKYKDIPSWWFHSLLIGSLALS  428

Query  1398  VFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgy  1577
             +  C + K+Q+Q+PWWG+LLA V+AI FT+P+ IITA TNQTPGLNIITEY++G + PG 
Sbjct  429   LVLCIFMKDQVQMPWWGLLLASVMAITFTVPVSIITATTNQTPGLNIITEYLMGVLLPGR  488

Query  1578  pVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWL  1757
             P+AN+CFK YGYISM+QAI FL DFKLGHYMKIPPR+MF+ Q +GT+IAG V +  AW+L
Sbjct  489   PIANVCFKTYGYISMSQAITFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNVSVAWYL  548

Query  1758  METIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGA  1931
             + T+  ICQ      N+ WTCP D VF+DASVIWGL+GPRRIFG+LG Y  +NWFFL GA
Sbjct  549   LTTVENICQKELLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGNLGNYPELNWFFLFGA  608

Query  1932  IAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYR  2111
             + P++VW+  KAFP Q+WI  IN+PVL+ +T+ MPPAT+VN+  WII+G +  Y VF+YR
Sbjct  609   LGPLIVWILHKAFPNQKWISQINLPVLLGSTAAMPPATSVNFNCWIIIGVIFNYFVFKYR  668

Query  2112  PDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIV  2291
                WQR+NYVLS ALDAGLAFMGVLLY  L + ++S++WWG++ + CP ASCP+A+G+ V
Sbjct  669   KSWWQRYNYVLSAALDAGLAFMGVLLYFTLSMNDISISWWGSNGENCPLASCPTAEGVEV  728

Query  2292  EGCP  2303
             EGCP
Sbjct  729   EGCP  732



>gb|EMS65130.1| Oligopeptide transporter 7 [Triticum urartu]
Length=690

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/660 (72%), Positives = 522/660 (79%), Gaps = 76/660 (12%)
 Frame = +3

Query  423   EFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVL  602
             EFTL PGPFNVKEHVLITIFAN+GAGTVYAIHVVTA +V     +TFFVSL++VLTTQVL
Sbjct  73    EFTLTPGPFNVKEHVLITIFANAGAGTVYAIHVVTAARV----DLTFFVSLLVVLTTQVL  128

Query  603   GFGWAGIFRRYLVEPAAMWWPANLVQVSLFR-----------------------------  695
             GFGWAGIFRRYLVEPA+MWWP+NLVQVSLFR                             
Sbjct  129   GFGWAGIFRRYLVEPASMWWPSNLVQVSLFRGNTLESICSLKPEVSLEQFRTCCMKISFM  188

Query  696   -ALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqql  872
              ALHEKE R KGG TR QFF++AF+CSFAYYVFPGYLFQMLTSLSWICW FP SVLAQQL
Sbjct  189   WALHEKEGRRKGGFTRNQFFLVAFVCSFAYYVFPGYLFQMLTSLSWICWVFPHSVLAQQL  248

Query  873   gsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNA  1052
             GSGL GLGIGAIGLDW+S+SSYLGSPL SPWFAT N+A GFF+I+YV TPI YW + + A
Sbjct  249   GSGLHGLGIGAIGLDWASVSSYLGSPLVSPWFATVNVAAGFFIIMYVITPIGYWFNFYKA  308

Query  1053  KTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTA  1232
             +TFPIFS +LFT +GQ YNISAI+D +FH D EAY++ G LYLST  A+TYGV FA+L+A
Sbjct  309   QTFPIFSADLFTLTGQKYNISAIVDDHFHFDKEAYERNGPLYLSTLLAITYGVSFASLSA  368

Query  1233  TLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACE  1412
             T+VHV+LFHG                                        +IA TVFACE
Sbjct  369   TIVHVLLFHG----------------------------------------SIAATVFACE  388

Query  1413  YYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANM  1592
             YY EQLQLPWWGVLLAC IA  FTLPIGIITA TNQTPGLNI+TEYIIGY+YPG PV NM
Sbjct  389   YYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIVTEYIIGYLYPGRPVVNM  448

Query  1593  CFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIP  1772
             CFKVYGYISM QA+ FLQDFKLGHYMKIPPR MFMAQVVGT IA FVYLGTAWWLM+TIP
Sbjct  449   CFKVYGYISMHQALMFLQDFKLGHYMKIPPRAMFMAQVVGTSIAAFVYLGTAWWLMDTIP  508

Query  1773  EIC--QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVL  1946
              IC  +  + ++ WTCP+DHVFYDASVIWGLIGPRRIFG LGTY AVNWFFL GAIAP+L
Sbjct  509   NICNIELLSADSPWTCPADHVFYDASVIWGLIGPRRIFGALGTYSAVNWFFLGGAIAPLL  568

Query  1947  VWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQ  2126
             VW A KAFPGQ WI LINMPV+I  T  MPPATAVNYTTWI+VGFLSGYVV+RYR D W+
Sbjct  569   VWFAHKAFPGQNWILLINMPVMIGCTVKMPPATAVNYTTWILVGFLSGYVVYRYRRDWWE  628

Query  2127  RHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             RHNY+LSGALDAGLAFM VL+YLCLGLEN+SLNWWGNDLDGCP ASCP+AKGI+V+GCPV
Sbjct  629   RHNYLLSGALDAGLAFMAVLIYLCLGLENISLNWWGNDLDGCPLASCPTAKGIVVKGCPV  688



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/736 (61%), Positives = 572/736 (78%), Gaps = 22/736 (3%)
 Frame = +3

Query  144   SLPEAA-----EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
              LPE+      E+E SPI +V LTV  TDDP+LPV TFRMW LG +SC LLSFLNQFF Y
Sbjct  7     ELPESPKEIVDEDELSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFAY  66

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEHVLIT  476
             RTEPL IT I+ Q+A +P+G+ MA+ +  R  FR    G+  EF+LNPGPFN+KEHVLI+
Sbjct  67    RTEPLIITQITVQVATLPIGRFMAS-VLPRTKFRLPGFGST-EFSLNPGPFNMKEHVLIS  124

Query  477   IFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVE  644
             IFAN+G+    G  YA+ +V  +K FY K+I+F    I+V+TTQVLG+GWAG+ R+Y+VE
Sbjct  125   IFANAGSAFGSGYAYAVGIVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLLRKYVVE  184

Query  645   PAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSL  824
             PA MWWP+ LVQVSLFRALHEK+E     ++R +FF+IA ICSF++Y  PGYLF  LTS+
Sbjct  185   PAHMWWPSTLVQVSLFRALHEKDEE---RMSRGKFFLIALICSFSWYAIPGYLFPTLTSI  241

Query  825   SWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLI  1004
             SW+CW F +SV AQQLGSG++GLG+GA+ LDWS+++S+L SPL SP+FA AN+ VG+ ++
Sbjct  242   SWVCWAFSKSVTAQQLGSGMKGLGLGALTLDWSAVASFLFSPLISPFFAIANVFVGYVMV  301

Query  1005  LYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             +YV  PI YW  D++ AKTFPIFS  LFT  G  YNI+AI++  F LD+  Y+++G++YL
Sbjct  302   MYVAIPIAYWGLDLYKAKTFPIFSSHLFTVQGGKYNITAIVNDKFELDIPNYEEQGRIYL  361

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFALTYG GFA + +TL HV  F+GREI+E+ ++S+K  K+DIHTRLMSKY+ +PEWW
Sbjct  362   STFFALTYGFGFATIASTLTHVGFFYGREIYERFRASYKG-KVDIHTRLMSKYKNIPEWW  420

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F  +LV  +A++   C + K+Q+Q+PWWG+L A  +A IFTLPI +ITA TNQTPGLNII
Sbjct  421   FHLLLVVTVAVSFVLCIFLKDQVQMPWWGLLFAAALAFIFTLPISVITATTNQTPGLNII  480

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEY++G IYPG P+AN+CFK YGY+SM QA++FL DFKLGHYMKIPPR+MF+ Q++GT+I
Sbjct  481   TEYVMGIIYPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPRSMFIVQLIGTII  540

Query  1722  AGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             AG + LG AWWL+++I  ICQ      N+ WTCP D VF+DASVIWGL+GP+RIFG LG 
Sbjct  541   AGTINLGVAWWLLDSIENICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGN  600

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL GA+ PVLVWL  KAFP Q WI LIN+PVL+ AT+ MPPATA+NY  WIIV
Sbjct  601   YGALNWFFLGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATAMMPPATALNYNAWIIV  660

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCP  2255
             G +  + VFRYR   WQR+NY+LS ALDAG+AFMGVL+Y  L +EN  LNWWG D + CP
Sbjct  661   GTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMGVLIYFSLTMENRDLNWWGTDGEHCP  720

Query  2256  YASCPSAKGIIVEGCP  2303
              A+CP+AKG++VEGCP
Sbjct  721   LATCPTAKGVVVEGCP  736



>gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Erythranthe 
guttata]
Length=548

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/553 (83%), Positives = 509/553 (92%), Gaps = 7/553 (1%)
 Frame = +3

Query  45    EVSADEIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPS  224
             E S+D+I  PL+ K E+  G    +SSS +++         ENSPI +VALTV T DDPS
Sbjct  3     EESSDQITAPLISKEEDRSGESSSSSSSSNEING-------ENSPIEQVALTVSTADDPS  55

Query  225   LPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF  404
             LPVLTFRMW LGTLSCVLLSFLNQFFWYRTEPL+ITAISAQIAVVPLGQLMAARITDR F
Sbjct  56    LPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAARITDRSF  115

Query  405   FRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIV  584
             FRG+++EFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVK+FY +HI+FFVSLI+V
Sbjct  116   FRGSRFEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKIFYKQHISFFVSLIVV  175

Query  585   LTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAF  764
             +TTQVLGFGWAGI+RRYLVEPAAMWWPANLVQVSLFRALHEK+ER KGG+TRTQFF+IAF
Sbjct  176   ITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSLFRALHEKDERAKGGVTRTQFFIIAF  235

Query  765   ICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLG  944
             I SFAYY+FPGYLF+MLTSLSWICW FP+SVLAQQLGSGL GLGIGAIGLDWS+ISSYLG
Sbjct  236   ITSFAYYIFPGYLFEMLTSLSWICWVFPKSVLAQQLGSGLSGLGIGAIGLDWSTISSYLG  295

Query  945   SPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII  1124
             SPLASPWFATAN+AVGFF ++YV TP+ YW ++++AKTFPIFSD+LFTSSGQ Y+IS+I+
Sbjct  296   SPLASPWFATANVAVGFFFVMYVVTPLSYWFNIYDAKTFPIFSDDLFTSSGQIYDISSIV  355

Query  1125  DSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDR  1304
             DSNFHLD  AY++EG L+LSTFFA+TYGVGFAAL+AT++HV+LFHGREIWEQSKSSF ++
Sbjct  356   DSNFHLDNAAYEREGPLHLSTFFAMTYGVGFAALSATIMHVLLFHGREIWEQSKSSFSEK  415

Query  1305  KMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFT  1484
             KMDIHT+LMSKYRQVPEWWFW ILV NIALT+FACEYYKEQLQLPWWGV+LACVIAI FT
Sbjct  416   KMDIHTKLMSKYRQVPEWWFWAILVVNIALTIFACEYYKEQLQLPWWGVVLACVIAIFFT  475

Query  1485  LPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGH  1664
             LPIGIITAITNQ+PGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAI FLQDFKLGH
Sbjct  476   LPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGH  535

Query  1665  YMKIPPRTMFMAQ  1703
             YMKIPPRTMFMAQ
Sbjct  536   YMKIPPRTMFMAQ  548



>ref|XP_010104574.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC01175.1| Oligopeptide transporter 4 [Morus notabilis]
Length=754

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/740 (60%), Positives = 564/740 (76%), Gaps = 17/740 (2%)
 Frame = +3

Query  129   KSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             K +    P   E+E SP+ EV LTVP TDD SLPV TFRMW LG LSC LLSFLNQFF Y
Sbjct  17    KKETSDEPIVDEDELSPVEEVRLTVPNTDDKSLPVWTFRMWFLGLLSCALLSFLNQFFSY  76

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVF-FRGTK-WEFTLNPGPFNVKEHVLITIF  482
             R EPL +T I+  +A +P+G+ MAA + +  F   G K  EF+LNPGPFNVKEHVLI+IF
Sbjct  77    RKEPLVVTQITVLVATLPVGRFMAAVLPETKFRVPGLKSREFSLNPGPFNVKEHVLISIF  136

Query  483   ANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPA  650
             AN+G+    G+ YA+ +V  +K FYG+ I+F    I+++TTQVLG+GWAG+ R+Y+VEPA
Sbjct  137   ANAGSAFGNGSAYAVMIVDIIKAFYGRKISFLSGWILIITTQVLGYGWAGLLRKYVVEPA  196

Query  651   AMWWPANLVQVSLFRALHEKEERPKGG---ITRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
              MWWP+ LVQ+SLFR LHEKEE  K     I+R +FFVIA ICSF +YVFPGYLFQ L S
Sbjct  197   HMWWPSTLVQISLFRTLHEKEEEDKDNKRRISRAKFFVIALICSFCWYVFPGYLFQTLQS  256

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             +SWICW FP SV A Q+GSGL GLG+GA+ LDWS+++S+L SPL  P+FA AN+ VG+ L
Sbjct  257   ISWICWAFPDSVTAHQIGSGLNGLGLGALTLDWSTVASFLFSPLVCPFFAIANVFVGYVL  316

Query  1002  ILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLY  1178
             I+Y+  PI YW  +VF+AKTFPIFS +LFT SGQ YN+S I++  F LDLE Y Q+G+++
Sbjct  317   IIYLVIPISYWGLNVFDAKTFPIFSSDLFTGSGQLYNVSLIVNKKFELDLEQYKQQGRVH  376

Query  1179  LSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEW  1358
             LSTFFALTYG GFA + ATL HV LFHGREI+E+ K+SF+ ++ DIHTRLM KY+ +P W
Sbjct  377   LSTFFALTYGFGFATIAATLTHVALFHGREIYERYKASFRGKE-DIHTRLMKKYKDIPSW  435

Query  1359  WFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNI  1538
             WF  +L   I +++  C + K+++Q+PWWG+L A  +A IFTLP+ IITA TNQTPGLNI
Sbjct  436   WFHLLLAVTITVSLALCIFLKKEIQMPWWGLLFAAALAFIFTLPVSIITATTNQTPGLNI  495

Query  1539  ITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTV  1718
             ITEYI+G I PG P+AN+CFK YGY+SM+QAI+FL DFKLGHYMKIPPR+MF+ Q +GT+
Sbjct  496   ITEYIMGVILPGRPIANVCFKTYGYMSMSQAISFLADFKLGHYMKIPPRSMFLVQFIGTM  555

Query  1719  IAGFVYLGTAWWLMETIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
             +AG + +  AWWL+ T+  IC     N  W+CPSD+VF+DASVIWGL+GPRRIFG  G Y
Sbjct  556   LAGTINISVAWWLLHTVDNICHDG--NNTWSCPSDNVFFDASVIWGLVGPRRIFGSRGEY  613

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
              ++NWFFL G + P+LVWL  + FP Q+WI L+N+PVL+ AT+NMPPAT +NYT+WI VG
Sbjct  614   PSLNWFFLGGVLGPLLVWLLHRLFPNQQWIPLVNLPVLLGATANMPPATPLNYTSWIAVG  673

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN----DLD  2246
              +  + VFRYR   WQR+NYVLS ALD G+AFM VLLY  LG+EN SL+WWG+    D +
Sbjct  674   TVFNFFVFRYRKRWWQRYNYVLSAALDGGVAFMAVLLYFSLGVENKSLHWWGSYPDRDTE  733

Query  2247  GCPYASCPSAKGIIVEGCPV  2306
              C  A+CP+AKGI V+GCP+
Sbjct  734   HCALATCPTAKGISVDGCPI  753



>ref|XP_001767301.1| predicted protein [Physcomitrella patens]
 gb|EDQ67982.1| predicted protein [Physcomitrella patens]
Length=690

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/690 (64%), Positives = 545/690 (79%), Gaps = 4/690 (1%)
 Frame = +3

Query  246   MWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARI-TDRVFFRGTKW  422
             MW LG LSC +L+FLNQFF YR EPL I+A SAQIA +PLG+ MAA + T +     T  
Sbjct  1     MWTLGILSCAILAFLNQFFAYRAEPLIISATSAQIAALPLGRFMAATLPTTKFKVPFTNL  60

Query  423   EFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVL  602
             E+T+NPGPFNVKEHVLITIFANSGAG  YAI +VT VK +Y K ITFFV L+I +TTQ++
Sbjct  61    EWTMNPGPFNVKEHVLITIFANSGAGGAYAISIVTIVKAYYKKKITFFVGLLITITTQMI  120

Query  603   GFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAY  782
             G+GWAGIFR YLV+PA MWWP NLVQVSLFR LHEK+ RPKGG+TR QFF+IA  CSF Y
Sbjct  121   GYGWAGIFRDYLVKPAQMWWPQNLVQVSLFRTLHEKDPRPKGGVTRIQFFLIALTCSFGY  180

Query  783   YVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASP  962
             Y  PGY+F ML+SLSW+CW +P SV A Q+GSGL+GLG+GAI  DW+++SSYL SPL++P
Sbjct  181   YALPGYMFAMLSSLSWVCWAWPHSVRAHQIGSGLKGLGVGAIAFDWATVSSYLLSPLSTP  240

Query  963   WFATANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHL  1142
             +FA AN+  GF  ++YV TPI Y+ ++++AK FPIFS   F S GQ Y+I+ +ID NF L
Sbjct  241   FFAIANVFAGFLFVMYVITPIAYYNNLYSAKKFPIFSGMFFRSDGQRYDINKVIDENFAL  300

Query  1143  DLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHT  1322
             +   YD+ G+L+LSTFFA TYGVGFAALTATL HV+LFHG +IW++SKSS K+ K D+HT
Sbjct  301   NEAVYDEYGQLHLSTFFAFTYGVGFAALTATLSHVILFHGWDIWQRSKSSLKE-KPDVHT  359

Query  1323  RLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGII  1502
             RLM  Y++VP+ WF  IL   I +++ ACE Y EQLQL WWGVLLAC +A  FTLPIG+I
Sbjct  360   RLMKNYKEVPQAWFLGILGVMILVSIVACEVYNEQLQLRWWGVLLACGLAFFFTLPIGVI  419

Query  1503  TAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPP  1682
             TA+TNQTPGLNIITEY+IGYIYPG PVAN+CFK YGYISMT A++FL DFKLGHYMKIPP
Sbjct  420   TAVTNQTPGLNIITEYMIGYIYPGRPVANVCFKTYGYISMTHAVSFLADFKLGHYMKIPP  479

Query  1683  RTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWG  1856
             R MF AQ++GTVIA  + LGTAWWL+ ++P+ICQ      N+ WTCP D +FYDASVIWG
Sbjct  480   RAMFHAQLLGTVIAAVLNLGTAWWLLTSVPDICQQDLLPANSPWTCPGDTIFYDASVIWG  539

Query  1857  LIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMP  2036
             LIGP+R+FG LG Y AVNWFFL GA+APV  W+  K FP ++WI  I  PVLI AT  MP
Sbjct  540   LIGPKRMFGSLGLYNAVNWFFLFGALAPVPFWVLHKIFPDKKWITYIYTPVLIGATGMMP  599

Query  2037  PATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENV  2216
             PATAVNYT+W ++G++  ++VF+YR   WQR+NY+LS ALDAGLAFMGVLLY  L LE+ 
Sbjct  600   PATAVNYTSWFLIGYIFNHLVFKYRKGWWQRYNYILSAALDAGLAFMGVLLYFVLQLEDK  659

Query  2217  SLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             +++WWG +LD CP A+CP+A G+   GCPV
Sbjct  660   NMSWWGENLDNCPLAACPTAPGVTRNGCPV  689



>emb|CDY14374.1| BnaA10g06810D [Brassica napus]
Length=709

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/728 (61%), Positives = 559/728 (77%), Gaps = 39/728 (5%)
 Frame = +3

Query  144   SLPEAAEE-ENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
              + EA +E +   + EV LTVP TDDP+LPVLTFRMWVLG  +C++LSF+NQFFWYR  P
Sbjct  13    EIEEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMP  72

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG  500
             LTIT ISAQIAVVPLG LMA  + ++ +  G++WEF +NPGPFN+KEHV+ITIFANSGAG
Sbjct  73    LTITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANSGAG  132

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             TVYA H+++A+K++Y + + F  + +I++TTQ LGFGWAG+FR++LVEP  MWWP+NLVQ
Sbjct  133   TVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQ  192

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLF ALHEKE++ KGG+TR QFF+I  + SFAYY+ PGYLF M+ S+SW+CW  P+SVL
Sbjct  193   VSLFSALHEKEKKTKGGMTRIQFFIIVLVTSFAYYILPGYLFTMIPSISWVCWLSPKSVL  252

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCD  1040
             A QLGSG QGLGIGAIG+DW++I SYLGSPLASP FAT N+ +GF +I+YV TPI YW +
Sbjct  253   ANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPIFATVNVTIGFVIIMYVATPICYWLN  312

Query  1041  VFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFA  1220
             ++ AKT+PIFS  LF  +G +Y++ +IID  FHLD   Y + G +++STFFA+TYG+GFA
Sbjct  313   LYRAKTYPIFSSGLFMGNGSSYDVLSIIDDKFHLDRAVYAKTGPIHMSTFFAVTYGLGFA  372

Query  1221  ALTATLVHVVLFHGREIWEQSKSSFK-DRKMDIHTRLMSK-YRQVPEWWFWCILVANIAL  1394
              L+AT+VHV+LF+GR++W+Q++ +FK ++KMDIHTR+M K YR+VP WWF  ILV NIA+
Sbjct  373   TLSATIVHVLLFNGRDLWKQTRGAFKRNKKMDIHTRIMKKNYREVPMWWFLVILVINIAV  432

Query  1395  TVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypg  1574
              VF   YY   +QLPWWGVLLAC IA++FT  IG+I A TNQ PGLN+ITEY+IGYIYP 
Sbjct  433   IVFISVYYNATVQLPWWGVLLACAIAVVFTPLIGVIVATTNQAPGLNVITEYVIGYIYPE  492

Query  1575  ypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWW  1754
              PVANMCFKVYGYISMTQA+ F+QDFKLG YMKIPPR+M+MAQV+GT++A  VY GTAWW
Sbjct  493   RPVANMCFKVYGYISMTQALTFIQDFKLGLYMKIPPRSMYMAQVLGTLVAVIVYTGTAWW  552

Query  1755  LMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             LM  IP +C  +    ++ WTCP D VF+DASVIWGL+GPRR+FGDLG Y  +NWFFL G
Sbjct  553   LMAEIPHLCDKSLLPPDSEWTCPMDRVFFDASVIWGLVGPRRMFGDLGEYSNINWFFLLG  612

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             AIAP LVWLATKA                                W IV F+ G+ VF+Y
Sbjct  613   AIAPFLVWLATKA--------------------------------WCIVAFIFGHFVFKY  640

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN--DLDGCPYASCPSAKG  2282
             + + W+++NYVLSG LDAG AFM +L++L LG + + L WWGN  D   C  ASCP+AKG
Sbjct  641   KREWWKKYNYVLSGGLDAGTAFMTILIFLALGRKGIGLVWWGNADDSTNCSLASCPTAKG  700

Query  2283  IIVEGCPV  2306
             +I+ GCPV
Sbjct  701   VIMNGCPV  708



>ref|XP_006856596.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/729 (60%), Positives = 560/729 (77%), Gaps = 12/729 (2%)
 Frame = +3

Query  144   SLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL  323
             +L    E+E SPI +V LTV TTDDPSLPV TFRMW LG LSC  +SFLNQFF YRTEPL
Sbjct  9     TLEREEEDEISPIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFFAYRTEPL  68

Query  324   TITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSG---  494
              IT IS Q+A +P G  +AA +  + F  G   E++LNPGPFN+KEHVLITIFAN+G   
Sbjct  69    VITQISVQVASLPAGHFLAAVLPKKKFRLGGS-EYSLNPGPFNMKEHVLITIFANAGYAF  127

Query  495   -AGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
              +GT YA+ +V  +K FY + I+F  S +I++TTQVLG+GWAG+ R+Y+VEPA MWWP+ 
Sbjct  128   GSGTPYAVGIVNIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVEPAHMWWPST  187

Query  672   LVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPR  851
             LVQVS+FRALHEK++R    ++R +FFVIA +CSF+YYV PGYLF  LT++SW+CW  P+
Sbjct  188   LVQVSVFRALHEKDDR---RLSRAKFFVIALVCSFSYYVLPGYLFSTLTTISWVCWAHPK  244

Query  852   SVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFY  1031
             S+ AQQLGSGL GLG+GA  LDW++I++++ SPL  P+FA  NI VG+ +I+Y+  PI Y
Sbjct  245   SITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVGYVVIVYLAIPIAY  304

Query  1032  WC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             W  D++ AK FPIFS +LFT+ GQ YNI+AI++  F LD  AY Q+G ++LS FFALTYG
Sbjct  305   WGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQFELDETAYAQQGPIHLSMFFALTYG  364

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANI  1388
              GFA + +T+ HV LF+GREIW++S++S +  K D+HTRLM  Y  +P+WWF+ ++ A +
Sbjct  365   FGFATIASTITHVALFYGREIWQRSRASIRS-KPDMHTRLMKNYADIPQWWFYALMAATV  423

Query  1389  ALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiy  1568
             A+++F C   K ++QLPWWG+ LAC +A +FTLPI IITA TNQTPGLNIITEYI+GYI 
Sbjct  424   AISLFLCIVLKHEVQLPWWGIFLACALAFLFTLPISIITATTNQTPGLNIITEYIMGYIL  483

Query  1569  pgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTA  1748
             PG P+AN+CFKVYGY+SM+QA++FL DFKLGHYMKIPPR+MF+ Q +GTVIAG + LG A
Sbjct  484   PGKPIANVCFKVYGYMSMSQAVSFLADFKLGHYMKIPPRSMFLVQFIGTVIAGTINLGVA  543

Query  1749  WWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFL  1922
             WWL+++I  IC   A    + WTCP D VF+DASVIWGL+GP+RIFG LG Y A+NWFFL
Sbjct  544   WWLLDSIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPKRIFGPLGAYPALNWFFL  603

Query  1923  AGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVF  2102
              GA+ PVLVWL  KAFP Q WI LIN+PVL+ AT+ MP ATA+NY  W+ VG +  + VF
Sbjct  604   GGALGPVLVWLLHKAFPSQTWIPLINLPVLLGATAYMPAATALNYNAWVAVGTVFNFFVF  663

Query  2103  RYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKG  2282
             RYR   WQR+NYVLS  LDAG+AFMGVLLY  L +EN S NWWG D + C +A CP+AKG
Sbjct  664   RYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLSMENNSFNWWGTDGEHCDFAVCPTAKG  723

Query  2283  IIVEGCPVI  2309
             +I +GCPV+
Sbjct  724   VIAKGCPVL  732



>ref|XP_002967597.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
 gb|EFJ30944.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
Length=771

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/749 (59%), Positives = 558/749 (74%), Gaps = 14/749 (2%)
 Frame = +3

Query  99    EGRHGFASSSKSKVESLPEAAEEE--------NSPIREVALTVPTTDDPSLPVLTFRMWV  254
             +  H      K K ESL +   E+         SPI EVALTV T+DDPSLPV TFRMW 
Sbjct  23    DQDHQVGEEPKLKDESLDQGGSEKEEVGEKEEQSPIEEVALTVDTSDDPSLPVYTFRMWT  82

Query  255   LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTL  434
             LG +SCVLL+F NQFF YRTEPL ITAISAQI  +PLG+LMAA +  R F    + EF+L
Sbjct  83    LGVVSCVLLAFFNQFFAYRTEPLIITAISAQIVTLPLGKLMAATLPTRKFSIFGR-EFSL  141

Query  435   NPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGW  614
             NPG FN KEHVLITIFAN+GAG+ YA+ +VT VK FY + + F V L+I +TTQ++G+GW
Sbjct  142   NPGAFNKKEHVLITIFANTGAGSAYAVGIVTIVKAFYKRRMEFGVGLLITITTQIIGYGW  201

Query  615   AGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFP  794
             AGIFR+YLV+PA MWWP+NLVQVS+FR LHEK+ R KGG+TR QFF+IA   SF YY FP
Sbjct  202   AGIFRKYLVDPAEMWWPSNLVQVSIFRTLHEKDVRRKGGLTRLQFFLIALTFSFCYYTFP  261

Query  795   GYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFAT  974
              Y F  L+SLSW+C+ +P+SV AQQ+GSG  GLG+G+I  DW++++SYLGSPLASPWFAT
Sbjct  262   DYWFISLSSLSWVCYAWPKSVTAQQIGSGFYGLGLGSIAFDWAAVASYLGSPLASPWFAT  321

Query  975   ANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII-DSNFHLDLE  1151
             AN+ VGF L +YV TP+ YW +++ AK FPIFS  L+   G  YN + +I D +  LD +
Sbjct  322   ANVMVGFSLFMYVVTPLTYWSNLYGAKRFPIFSSGLYADDGSEYNFTRVIKDHSLQLDYD  381

Query  1152  AYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLM  1331
             AY+   KL+LS FF  TYG  FAALTATL HV +FHG+EI+  + S+   RK+D+HTRLM
Sbjct  382   AYNSYSKLHLSNFFVFTYGASFAALTATLAHVAIFHGKEIYSMTTSALTSRKVDVHTRLM  441

Query  1332  SKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAI  1511
              +Y+ VP++WF  ++ A++AL +F CEY+   +QL WWG+L A  IA IFT+PI II A 
Sbjct  442   MRYKTVPQFWFLGMMFASMALAIFTCEYFNSTVQLRWWGLLFAFGIAFIFTMPIAIIAAT  501

Query  1512  TNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTM  1691
             TNQ PGLN+ITEY+IGY+YP  PVAN+ FK YGYISMTQA++FL DFKLGHYMKIPPR+M
Sbjct  502   TNQVPGLNVITEYLIGYVYPNRPVANVLFKTYGYISMTQAVSFLSDFKLGHYMKIPPRSM  561

Query  1692  FMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIG  1865
             F  QV+GTVIA  V L TAWWL+ +I  IC  +    N+ WTCP+D VF+DASVIWGLIG
Sbjct  562   FTVQVLGTVIAATVNLSTAWWLLSSIKGICHPSELPRNSPWTCPNDTVFFDASVIWGLIG  621

Query  1866  PRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPAT  2045
             P R++G LG Y  +NWFFL GA+APV VW+A K FP Q W+RL+NMP+L+ AT  +PPAT
Sbjct  622   PMRMWGSLGQYNQMNWFFLVGAVAPVFVWIAIKLFPKQRWLRLVNMPILLGATGAIPPAT  681

Query  2046  AVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN  2225
             AVNY +W ++GF+  Y++FRYR   WQRHNYVLS ALDAG+AFM +L+Y    + + S+N
Sbjct  682   AVNYWSWFLMGFVFNYLIFRYRKAWWQRHNYVLSAALDAGVAFMAILVYFATRMGDYSVN  741

Query  2226  WWGNDLDGCPYASCPSAKGII--VEGCPV  2306
             WWG  +D CP A+CP+  GI+  +E CPV
Sbjct  742   WWGATIDNCPLAACPTQPGIVPFLESCPV  770



>ref|XP_002981747.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
 gb|EFJ17229.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
Length=771

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/749 (59%), Positives = 558/749 (74%), Gaps = 14/749 (2%)
 Frame = +3

Query  99    EGRHGFASSSKSKVESLPEAAEEE--------NSPIREVALTVPTTDDPSLPVLTFRMWV  254
             +  H      K K ESL +   E+         SPI EVALTV T+DDPSLPV TFRMW 
Sbjct  23    DQDHQVGEEPKLKDESLDQGGSEKEEVGEKEEQSPIEEVALTVDTSDDPSLPVYTFRMWT  82

Query  255   LGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTL  434
             LG +SCVLL+F NQFF YRTEPL ITAISAQI  +PLG+LMAA +  R F    + EF+L
Sbjct  83    LGVVSCVLLAFFNQFFAYRTEPLIITAISAQIVTLPLGKLMAATLPTRKFSIFGR-EFSL  141

Query  435   NPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGW  614
             NPG FN KEHVLITIFAN+GAG+ YA+ +VT VK FY + + F V L+I +TTQ++G+GW
Sbjct  142   NPGAFNKKEHVLITIFANTGAGSAYAVGIVTIVKAFYKRRMDFGVGLLITITTQIIGYGW  201

Query  615   AGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFP  794
             AGIFR+YLV+PA MWWP+NLVQVS+FR LHEK+ R KGG+TR QFF+IA   SF YY FP
Sbjct  202   AGIFRKYLVDPAEMWWPSNLVQVSIFRTLHEKDVRRKGGLTRLQFFLIALTFSFCYYTFP  261

Query  795   GYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFAT  974
              Y F  L+SLSW+C+ +P+SV AQQ+GSG  GLG+G+I  DW++I+SYLGSPLASPWFAT
Sbjct  262   DYWFISLSSLSWVCYAWPKSVTAQQIGSGFYGLGLGSIAFDWAAIASYLGSPLASPWFAT  321

Query  975   ANIAVGFFLILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAII-DSNFHLDLE  1151
             AN+ VGF L +YV TP+ YW +++ AK FPIFS  L+   G  YN + +I D +  LD +
Sbjct  322   ANVMVGFSLFMYVVTPLTYWSNLYGAKRFPIFSSGLYADDGSEYNFTRVIKDHSLQLDYD  381

Query  1152  AYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLM  1331
             AY+   KL+LS FF  TYG  FAALTATL HV +FHG+EI+  + S+   RK+D+HTRLM
Sbjct  382   AYNSYSKLHLSNFFVFTYGASFAALTATLAHVAIFHGKEIYSMTTSALTSRKVDVHTRLM  441

Query  1332  SKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAI  1511
              +Y+ VP++WF  ++ A++AL +F CEY+   +QL WWG+L A  IA IFT+PI II A 
Sbjct  442   MRYKTVPQFWFLGMMFASMALAIFTCEYFNSTVQLRWWGLLFAFGIAFIFTMPIAIIAAT  501

Query  1512  TNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTM  1691
             TNQ PGLN+ITEY+IGY+YP  PVAN+ FK YGYISMTQA++FL DFKLGHYMKIPPR+M
Sbjct  502   TNQVPGLNVITEYLIGYVYPNRPVANVLFKTYGYISMTQAVSFLSDFKLGHYMKIPPRSM  561

Query  1692  FMAQVVGTVIAGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIG  1865
             F  QV+GTVIA  V L TAWWL+ +I  IC  +    N+ WTCP+D VF+DASVIWGLIG
Sbjct  562   FTVQVLGTVIAATVNLSTAWWLLSSIKGICHPSELPRNSPWTCPNDTVFFDASVIWGLIG  621

Query  1866  PRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPAT  2045
             P R++G LG Y  +NWFFL GA+APV VW+A K FP Q W+RL+NMP+L+ AT  +PPAT
Sbjct  622   PMRMWGSLGQYNQMNWFFLVGAVAPVFVWIAIKLFPKQRWLRLVNMPILLGATGAIPPAT  681

Query  2046  AVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN  2225
             AVNY +W ++GF+  Y++FRY+   WQRHNYVLS ALDAG+AFM +L+Y    + + S+N
Sbjct  682   AVNYWSWFLMGFVFNYLIFRYKKAWWQRHNYVLSAALDAGVAFMAILVYFATRMGDYSVN  741

Query  2226  WWGNDLDGCPYASCPSAKGII--VEGCPV  2306
             WWG  +D CP A+CP+  GI+  V+ CPV
Sbjct  742   WWGATIDNCPLAACPTQPGIVPFVKSCPV  770



>ref|XP_008374152.1| PREDICTED: oligopeptide transporter 7-like [Malus domestica]
Length=599

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/541 (81%), Positives = 492/541 (91%), Gaps = 2/541 (0%)
 Frame = +3

Query  684   SLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVla  863
              +  ALHEKE RPKGG+TRTQFF+IAF+CSFAYYVFPGYLFQMLTSLSWICW FP +VLA
Sbjct  59    KMVMALHEKEVRPKGGLTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIFPTNVLA  118

Query  864   qqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDV  1043
             QQLGSGL GLGIGA+GLDWS+IS+YLGSPLASPWFATAN+A GFF ++Y+ TP+ YW ++
Sbjct  119   QQLGSGLYGLGIGAVGLDWSTISAYLGSPLASPWFATANVAAGFFFVMYILTPLSYWXNI  178

Query  1044  FNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAA  1223
             + AKTFPIFS+ +FTS GQ YNI+AIIDSNFHLD +AYD+EG LY+S  F +TYGVGFAA
Sbjct  179   YKAKTFPIFSNSMFTSDGQEYNITAIIDSNFHLDYDAYDREGPLYISIIFTITYGVGFAA  238

Query  1224  LTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVF  1403
             LTAT+VHV LFHGREIWEQSK+SFK++KMDIHTRLM +Y QVPEWWF  +L+ANIALT+F
Sbjct  239   LTATIVHVALFHGREIWEQSKASFKEKKMDIHTRLMQRYNQVPEWWFVVLLLANIALTIF  298

Query  1404  ACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypV  1583
              CEYY +QLQLPWWGVLLAC IAI FTLPIGIITAITNQ PGLN+ITEYIIGYIYPGYPV
Sbjct  299   TCEYYNDQLQLPWWGVLLACGIAIFFTLPIGIITAITNQAPGLNVITEYIIGYIYPGYPV  358

Query  1584  ANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLME  1763
             ANMCFKVYGYISM+QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYL TAWWLME
Sbjct  359   ANMCFKVYGYISMSQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLME  418

Query  1764  TIPEICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPV  1943
             TIP+IC+   T +VWTCPSD VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFL GA+AP+
Sbjct  419   TIPDICED--TTSVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLVGAVAPI  476

Query  1944  LVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLW  2123
              VWLATKAFP QEWIRLINMPV + ATS+MPPATAVNYT+WII+GFLSG+VV+RYRPD W
Sbjct  477   FVWLATKAFPRQEWIRLINMPVFMGATSSMPPATAVNYTSWIILGFLSGFVVYRYRPDWW  536

Query  2124  QRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCP  2303
             +RHNYVLSGALDAGLAFMGVLLY  LGLE++SL+WWGNDLDGCP A+CP+AKG++VEGCP
Sbjct  537   KRHNYVLSGALDAGLAFMGVLLYFSLGLEDISLSWWGNDLDGCPLATCPTAKGVVVEGCP  596

Query  2304  V  2306
             +
Sbjct  597   I  597



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/738 (59%), Positives = 564/738 (76%), Gaps = 13/738 (2%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A+  +S+   +    +E+ SP+ EV LTV   DDPSLPV TFRMW LG LSCVLLSFLN 
Sbjct  2     AAIDESRRPEIIADDDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNT  61

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLIT  476
             FF YRT+PL IT IS Q+  +PLG+LMA R+     ++   WEF+LNPGPFNVKEHVLI+
Sbjct  62    FFGYRTQPLMITMISVQVVTLPLGKLMA-RVLPETKYKIGSWEFSLNPGPFNVKEHVLIS  120

Query  477   IFANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVE  644
             +FAN+GAG    T YA+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+
Sbjct  121   MFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVD  180

Query  645   PAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSL  824
             PA MWWP +++QVSLFRALHEK+   K  ++R +FFVIAF+CSFA+Y+FP YLF  L+S+
Sbjct  181   PAQMWWPTSVLQVSLFRALHEKD---KARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSI  237

Query  825   SWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLI  1004
             SW+CW FP+S+ AQQLGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ LI
Sbjct  238   SWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYILI  297

Query  1005  LYVFTPI-FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             +Y+  PI +Y  +++ A  FPIFS +LF   GQ YNIS I++  F LD+  Y QEG++YL
Sbjct  298   MYMVIPISYYGMNMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVYL  357

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFA++YG+GFAA+ +TL HV LF+G+ IW+Q ++S K  K+DIHTRLM KY+ +P WW
Sbjct  358   STFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKS-KVDIHTRLMKKYKDIPGWW  416

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F+ +L  +I L++  C + K+++Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNII
Sbjct  417   FYGLLAISIVLSLVLCIFMKDEIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNII  476

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEY++G + PG P+AN+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q++GTVI
Sbjct  477   TEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVI  536

Query  1722  AGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             AG V +  AW+L+ ++  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG 
Sbjct  537   AGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGN  596

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL G I PVLVWL  KAFP + WI LIN+PVL+ AT+ MPPAT+VN+  WIIV
Sbjct  597   YSALNWFFLGGLIGPVLVWLLQKAFPTKTWISLINLPVLLGATAAMPPATSVNFNCWIIV  656

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGC  2252
             G +  Y VF+Y    WQR+NYVLS ALDAGLAFMGVLLY  L +  +S++ WWG + + C
Sbjct  657   GVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGANGENC  716

Query  2253  PYASCPSAKGIIVEGCPV  2306
             P ASCP+A GI VEGCPV
Sbjct  717   PLASCPTAPGIQVEGCPV  734



>ref|XP_008346658.1| PREDICTED: oligopeptide transporter 7-like [Malus domestica]
Length=544

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/537 (81%), Positives = 491/537 (91%), Gaps = 2/537 (0%)
 Frame = +3

Query  696   ALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlg  875
             ALHEKE RPKGG+TRTQFF+IAF+CSFAYYVFPGYLFQMLTSLSWICW FP +VLAQQLG
Sbjct  8     ALHEKEVRPKGGLTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIFPTNVLAQQLG  67

Query  876   sglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAK  1055
             SGL GLGIGA+GLDWS+IS+YLGSPLASPWFATAN+A GFF ++Y+ TP+ YW +++ AK
Sbjct  68    SGLYGLGIGAVGLDWSTISAYLGSPLASPWFATANVAAGFFFVMYILTPLSYWXNIYKAK  127

Query  1056  TFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTAT  1235
             TFPIFS+ +FTS GQ YNI+AIIDSNFHLD +AYD+EG LY+S  F +TYGVGFAALTAT
Sbjct  128   TFPIFSNSMFTSDGQEYNITAIIDSNFHLDYDAYDREGPLYISIIFTITYGVGFAALTAT  187

Query  1236  LVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEY  1415
             +VHV LFHGREIWEQSK+SFK++KMDIHTRLM +Y QVPEWWF  +L+ANIALT+F CEY
Sbjct  188   IVHVALFHGREIWEQSKASFKEKKMDIHTRLMQRYNQVPEWWFVVLLLANIALTIFTCEY  247

Query  1416  YKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMC  1595
             Y +QLQLPWWGVLLAC IAI FTLPIGIITAITNQ PGLN+ITEYIIGYIYPGYPVANMC
Sbjct  248   YNDQLQLPWWGVLLACGIAIFFTLPIGIITAITNQAPGLNVITEYIIGYIYPGYPVANMC  307

Query  1596  FKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPE  1775
             FKVYGYISM+QA+ FLQDFKLGHYMKIPPRTMFMAQVVGT+IA  VYL TAWWLMETIP+
Sbjct  308   FKVYGYISMSQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLMETIPD  367

Query  1776  ICQTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWL  1955
             IC+   T +VWTCPSD VFYDASVIWGLIGPRRIFGDLGTYEAVNWFFL GA+AP+ VWL
Sbjct  368   ICED--TTSVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLVGAVAPIFVWL  425

Query  1956  ATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHN  2135
             ATKAFP QEWIRLINMPV + ATS+MPPATAVNYT+WII+GFLSG+VV+RYRPD W+RHN
Sbjct  426   ATKAFPRQEWIRLINMPVFMGATSSMPPATAVNYTSWIILGFLSGFVVYRYRPDWWKRHN  485

Query  2136  YVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             YVLSGALDAGLAFMGVLLY  LGLE++SL+WWGNDLDGCP A+CP+AKG++VEGCP+
Sbjct  486   YVLSGALDAGLAFMGVLLYFSLGLEDISLSWWGNDLDGCPLATCPTAKGVVVEGCPI  542



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/733 (59%), Positives = 565/733 (77%), Gaps = 14/733 (2%)
 Frame = +3

Query  141   ESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEP  320
             +S P+  E++ SPI EV LTV  TDDP+LPV TFRMW LG +SC +LSFLNQFF YRTEP
Sbjct  16    KSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCGMLSFLNQFFSYRTEP  75

Query  321   LTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEHVLITIFAN  488
             L IT I+ Q+A +PLG  +A RI     FR    G +  F+LNPGPFNVKEHVLITIFAN
Sbjct  76    LIITQITVQVATLPLGHFLA-RILPETKFRIPGFGPR-TFSLNPGPFNVKEHVLITIFAN  133

Query  489   SGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAM  656
             +G+    G+ YA+ +V  +K FY ++I+F  + I+++TTQVLG+GWAG+ R+Y+VEPA M
Sbjct  134   AGSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWAGLMRKYVVEPAHM  193

Query  657   WWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWIC  836
             WWP  LVQVSLFRALHEK+++ +   +R +FF+IA +CSF +Y  PGYLF  LTS+SW+C
Sbjct  194   WWPNTLVQVSLFRALHEKDDKEEKRTSRAKFFLIALMCSFLWYAVPGYLFSTLTSISWVC  253

Query  837   WFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVF  1016
             W F RSV AQQLGSG++GLG+GAI LDWS+++S+L SPL +P+FA AN+ VG+ LI+Y+F
Sbjct  254   WVFSRSVTAQQLGSGMRGLGLGAITLDWSAVASFLLSPLITPFFAIANVCVGYVLIIYIF  313

Query  1017  TPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFF  1193
              PI YW  D+++A+ FPIFS  LFT+ GQ YNISAI++  F LD+  Y+++G++++STFF
Sbjct  314   IPIAYWGLDLYSARKFPIFSSHLFTAQGQIYNISAIVNDKFELDIAQYEKQGQIHMSTFF  373

Query  1194  ALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCI  1373
             ALTYG GFA + +TL HV  F+GREI+E+ ++S+  +  DIHT+LM KY+ +P WWF+ +
Sbjct  374   ALTYGFGFATIASTLTHVGFFYGREIYERFRASYTSKD-DIHTKLMKKYKDIPAWWFYLL  432

Query  1374  LVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyi  1553
             L   I ++     + KE++Q+PWW +L AC +A +FTLPI IITA TNQTPGLNIITEYI
Sbjct  433   LGLTITISFLLSIFLKEEVQIPWWALLFACGMAFVFTLPISIITATTNQTPGLNIITEYI  492

Query  1554  igyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFV  1733
             +G I PG P+AN+CFKVYGY+SM+QA++FL DFKLGHYMKIPPR+MF+ Q +GT+ AG +
Sbjct  493   MGLILPGKPIANVCFKVYGYMSMSQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTIFAGTI  552

Query  1734  YLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAV  1907
              +  AWWL+ +I  IC+      ++ WTCP D VF+DASVIWGL+GP+RIFGDLGTY+A+
Sbjct  553   NIAVAWWLLNSIHNICEDNLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGDLGTYKAM  612

Query  1908  NWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLS  2087
             NWFF+ GAI P++VWL  KAFP + WI LIN+PVL+ AT+ MPPAT VNY  WIIVG + 
Sbjct  613   NWFFIGGAIGPIIVWLFHKAFPKKSWIPLINLPVLLGATAYMPPATTVNYNAWIIVGTIF  672

Query  2088  GYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASC  2267
                VFRYR   WQR+NY+LS ALDAG+AFMGVLLY  LG+E+ SL WWG + + C  ASC
Sbjct  673   NLFVFRYRKQWWQRYNYILSAALDAGVAFMGVLLYFSLGVEDKSLTWWGTNGEHCNLASC  732

Query  2268  PSAKGIIVEGCPV  2306
             P+AKGI V+GCP+
Sbjct  733   PTAKGIAVDGCPI  745



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/743 (59%), Positives = 572/743 (77%), Gaps = 22/743 (3%)
 Frame = +3

Query  135   KVESLP----EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  302
             +VE+ P    +  EEE SPI +V LTVP TDDPSLPV TFRMW LG LSC LLSFLNQFF
Sbjct  5     EVEAPPSKDLDIDEEELSPIEQVRLTVPNTDDPSLPVWTFRMWFLGILSCCLLSFLNQFF  64

Query  303   WYRTEPLTITAISAQIAVVPLGQLMAA---RITDRVFFRGTKWEFTLNPGPFNVKEHVLI  473
              YRTEPL IT I+ Q+A +P+G+ +A    +    +   G++ EF+ NPGPFN+KEHVLI
Sbjct  65    AYRTEPLIITQITVQVATLPIGRFLATVLPKTKFNILGFGSR-EFSFNPGPFNMKEHVLI  123

Query  474   TIFANSGA----GTVYAIHVVTAVK--VFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRY  635
             +IFAN+G+    G+ YA+ +V  +K   FYG++I+FF + ++++TTQVLG+GWAG+ R+Y
Sbjct  124   SIFANAGSAFGSGSAYAVGIVNIIKSKAFYGRNISFFSAWVLIITTQVLGYGWAGLLRKY  183

Query  636   LVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQML  815
             +VEPA MWWP+ LVQ+SLFR LHEKE++ +  I+R +FFVIA  CSF +Y+ PGYLFQ L
Sbjct  184   VVEPAHMWWPSTLVQISLFRTLHEKEDKNEHRISRVKFFVIAMTCSFLWYLLPGYLFQTL  243

Query  816   TSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGF  995
              S++WIC+ FP SV AQQ+GSG++GLGIGA+ LDWS+++SYL SPL +P+FA  N+ VG+
Sbjct  244   QSIAWICYAFPHSVTAQQIGSGMRGLGIGALTLDWSTVASYLYSPLLTPFFAIVNVFVGY  303

Query  996   FLILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGK  1172
              LI+YV  PI YW  +V++AKTFPIFS  LF + G +YNI+ +++  F LDL  YD+ G+
Sbjct  304   ALIMYVVIPISYWGLNVYDAKTFPIFSSHLFDARGASYNITEVVNDKFELDLAQYDKHGR  363

Query  1173  LYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVP  1352
             ++LSTFFALTYG GFA + ATL HV LF+GREI+++ ++S+K ++ DIHTRLM  Y+ +P
Sbjct  364   VHLSTFFALTYGFGFATIAATLSHVALFYGREIYDRYRASYKGKE-DIHTRLMKNYKDIP  422

Query  1353  EWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGL  1532
              WWF  +L   + + +F C + K+++Q+P+WG+L A  +A IF+LPI IITA TNQTPGL
Sbjct  423   SWWFHGLLAMTLLVALFLCIFLKKEVQMPFWGLLFAAALAFIFSLPISIITATTNQTPGL  482

Query  1533  NIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVG  1712
             NIITEY +G IYPG P+AN+CFK YGY+SM QAI+FL DFKLGHYMKIPPR+MF+ Q +G
Sbjct  483   NIITEYAMGIIYPGRPIANVCFKTYGYMSMAQAISFLSDFKLGHYMKIPPRSMFLVQFIG  542

Query  1713  TVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGD  1886
             T+IAG + LG AWWL+ ++  ICQ    A N+ WTCPSD VF+DASVIWGL+GPRRIFG 
Sbjct  543   TIIAGTINLGVAWWLLNSVEHICQDNLLAANSPWTCPSDRVFFDASVIWGLVGPRRIFGS  602

Query  1887  LGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTW  2066
             LG Y A+NWFFL G + P +VWL  KAFPGQ WI LIN+PVL+ AT++MPPATA+NY +W
Sbjct  603   LGEYAALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGATASMPPATAINYNSW  662

Query  2067  IIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLD  2246
             I+VG +  + +FRYR   WQR+NYVLS ALDAG+AFM VL+Y+ +GLEN +L WWG+D D
Sbjct  663   ILVGTIFNFFIFRYRKAWWQRYNYVLSAALDAGVAFMAVLIYVTVGLENKNLYWWGSDPD  722

Query  2247  ----GCPYASCPSAKGIIVEGCP  2303
                  C  A+CP+AKGI V+GCP
Sbjct  723   VFPEHCSLATCPTAKGISVDGCP  745



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/738 (59%), Positives = 562/738 (76%), Gaps = 13/738 (2%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A+  +S+   +    +E+ SP+ EV LTV   DDPSLPV TFRMW LG LSCVLLSFLN 
Sbjct  2     AAIDESRKPEIIADDDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNT  61

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLIT  476
             FF YRT+PL IT IS Q+  +PLG+LMA R+     ++   WEF+LNPGPFNVKEHVLI+
Sbjct  62    FFGYRTQPLMITMISVQVVTLPLGKLMA-RVLPETKYKIGSWEFSLNPGPFNVKEHVLIS  120

Query  477   IFANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVE  644
             +FAN+GAG    T YA+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+
Sbjct  121   MFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVD  180

Query  645   PAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSL  824
             PA MWWP +++QVSLFRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+
Sbjct  181   PAQMWWPTSVLQVSLFRALHEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSI  237

Query  825   SWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLI  1004
             SW+CW FP+S+ AQQLGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L+
Sbjct  238   SWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILV  297

Query  1005  LYVFTPI-FYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             +Y+  PI +Y  +++ A  FPIFS +LF   GQ YNIS I++  F LD+ +Y QEG++YL
Sbjct  298   MYMVIPISYYGMNMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGSYQQEGRVYL  357

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFA++YG+GFAA+ +TL HV LF+G+ IW+Q ++S K  K+DIHTRLM KY+ +P WW
Sbjct  358   STFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTKT-KVDIHTRLMKKYKDIPGWW  416

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F+ +L  +I L++  C + K+Q+Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNII
Sbjct  417   FYGLLAISIVLSLVLCIFMKDQIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNII  476

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEY++G + PG P+AN+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q++GTVI
Sbjct  477   TEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVI  536

Query  1722  AGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             AG V +  AW+L+ ++  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG 
Sbjct  537   AGTVNVSVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGN  596

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL G I PVLVWL  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIV
Sbjct  597   YPALNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIV  656

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGC  2252
             G +  Y VF+Y    WQR+NYVLS ALDAGLAFMGVLLY  L +  +S++ WWG   + C
Sbjct  657   GVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKGENC  716

Query  2253  PYASCPSAKGIIVEGCPV  2306
             P A+CP+A GI VEGCPV
Sbjct  717   PLAACPTAPGIQVEGCPV  734



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/726 (59%), Positives = 564/726 (78%), Gaps = 12/726 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             +A +++ SPI +V LTV  TDDP+LPV TFRMW LG LSC LLSFLNQFF YRTEPL IT
Sbjct  25    DAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLIIT  84

Query  333   AISAQIAVVPLGQLMAARI-TDRVFFRG-TKWEFTLNPGPFNVKEHVLITIFANSGA---  497
              I+ Q++ +P+G  MA  + T++    G     F+LNPGPFN+KEHVL+TIFAN+G+   
Sbjct  85    QITVQVSALPIGHFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLVTIFANAGSAFG  144

Query  498   -GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANL  674
              G+ YA+ +VT +KVFYG+ I+   S ++++TTQVLG+GWAG+ R+Y+VEPA MWWP  L
Sbjct  145   VGSAYAVGIVTIIKVFYGRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPNTL  204

Query  675   VQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRS  854
             VQVSLFRALHEK+E+    ++R +FF+IA +CSF +Y FPGYLF  LT++SW+CW F +S
Sbjct  205   VQVSLFRALHEKDEQ---RMSRAKFFLIALVCSFTWYAFPGYLFTTLTNISWVCWLFSKS  261

Query  855   VlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW  1034
             V AQQ+GSG++GLG+GA+ LDWS+++S+L SPL SP+F   N+  G+ LILY   PI YW
Sbjct  262   VTAQQIGSGMRGLGVGALTLDWSAVASFLFSPLISPFFVIVNVFAGYALILYFAIPIAYW  321

Query  1035  -CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGV  1211
               D++ A+ FPIFS  LFT+ GQ YNI+AI++  F LD+  Y+++G+++LSTFFALTYG 
Sbjct  322   GLDLYTAQRFPIFSSHLFTAQGQDYNITAIVNDKFELDIPKYEEQGRIHLSTFFALTYGF  381

Query  1212  GFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIA  1391
             GFA + +TL HV LF+GREI ++ ++S+K ++ DIHTRLM +Y+ +P WWF+ +L+  +A
Sbjct  382   GFATIASTLTHVALFYGREILDRYRASYKGKE-DIHTRLMRRYKDIPSWWFYMLLIITVA  440

Query  1392  LTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiyp  1571
             +++  C    +Q+Q+PWWG+L A  +A +FTLPI IITA TNQTPGLNIITEYI+G I P
Sbjct  441   VSLVLCTVLNDQVQMPWWGLLFAAAMAFVFTLPISIITATTNQTPGLNIITEYIMGIILP  500

Query  1572  gypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAW  1751
             G P+AN+CFK YGY+SM QA++FL DFKLGHYMKIPPR+MF+ Q +GT++AG V L  A+
Sbjct  501   GRPIANVCFKTYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTVNLAVAY  560

Query  1752  WLMETIPEIC-QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             WL+ +I  IC     +++ WTCPSD VF+DASVIWGL GP+RIFG LG Y A+NWFFL G
Sbjct  561   WLLNSITNICVDDPQSDSPWTCPSDRVFFDASVIWGLAGPKRIFGTLGIYGAMNWFFLGG  620

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             A+ PV+VW+  KA+P Q WIRLIN+PVL+ AT +MPPATA+NY +WIIVG +  + VFRY
Sbjct  621   AVGPVIVWVLHKAYPKQNWIRLINLPVLLGATGSMPPATALNYNSWIIVGTIFNFFVFRY  680

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGII  2288
             R   WQR+NYVLS ALDAGLAFM VLLYL +G+EN+S+ WWG + + C  A+CP+AKGI+
Sbjct  681   RKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMENISVAWWGTNGEHCDLATCPTAKGIV  740

Query  2289  VEGCPV  2306
             V+GCPV
Sbjct  741   VDGCPV  746



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/729 (59%), Positives = 562/729 (77%), Gaps = 15/729 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E   ++ SPI EV LTV   DDP+LPV TFRMW LG +SCVLLSFLN FF YRTEPLTI+
Sbjct  7     ETISDDVSPIEEVRLTVSNHDDPTLPVWTFRMWFLGIVSCVLLSFLNTFFAYRTEPLTIS  66

Query  333   AISAQIAVVPLGQLMAARITDRVFFR---GTKWEFTLNPGPFNVKEHVLITIFAN----S  491
              IS Q+A +P+G+ MA  +    F     G K +F+LNPGPFNVKEHVLI+IFAN    +
Sbjct  67    MISVQVATLPIGRFMAKTLPTTKFAIPGFGNK-KFSLNPGPFNVKEHVLISIFANVGSNA  125

Query  492   GAGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
             G+G  YAI ++  +  FY + I+F  S I+V+TTQVLG+GWAGI R+++V+PA MWWP +
Sbjct  126   GSGAAYAISIIDIIVAFYHRKISFLASWILVITTQVLGYGWAGIMRKFVVDPAHMWWPIS  185

Query  672   LVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPR  851
             LVQVSLFRA+HE++ +    ++R +FF+IA ICSF++Y+FPGYLFQ L ++SW+CW FP 
Sbjct  186   LVQVSLFRAMHERDNKR---MSRGKFFLIALICSFSWYLFPGYLFQTLGTISWVCWLFPN  242

Query  852   SVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFY  1031
             SV AQQ+GSG+QGLG+GA  +DWS I+SYLGSPL +P+FA  N+ VG+ +I+Y+  P+ Y
Sbjct  243   SVTAQQIGSGMQGLGLGAFAVDWSVIASYLGSPLITPFFAIVNVLVGYIIIVYILVPVAY  302

Query  1032  WC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYG  1208
             W  DV++AK FPI S  LF   GQ YN+SAI++  F +DL+ Y++EG LYLS+FFA+TYG
Sbjct  303   WGFDVYDAKKFPIISSHLFNRRGQLYNVSAIVNDKFEIDLQEYEKEGNLYLSSFFAITYG  362

Query  1209  VGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANI  1388
             VGFAA+ +TLVHV LF+G+EI +Q ++S+  ++ DIHTRLM KY+ +P WWF+  L+ ++
Sbjct  363   VGFAAIVSTLVHVGLFNGKEIVQQFRASYNGKE-DIHTRLMKKYKGIPNWWFYLTLMLSL  421

Query  1389  ALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiy  1568
              L++  C + KEQ+Q+PWWG+L A  +A+IFTLPI IITA TNQ+PGLNIITEY++G I 
Sbjct  422   ILSLVMCIFMKEQIQMPWWGLLFAVALALIFTLPISIITATTNQSPGLNIITEYLMGVIL  481

Query  1569  pgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTA  1748
             PG P+AN+CFK YGYISMTQA++FL DFKLGHYMKIPPR+MF+ Q +GT+I+G V  G A
Sbjct  482   PGRPIANVCFKTYGYISMTQAVSFLADFKLGHYMKIPPRSMFLVQCIGTLISGTVNTGVA  541

Query  1749  WWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFL  1922
             WWL+ ++  ICQ +    ++ WTCPSD VFYDASVIWGL+GPRRIFG LG Y A+NWFFL
Sbjct  542   WWLLTSVKNICQDSLLPPDSPWTCPSDRVFYDASVIWGLVGPRRIFGHLGNYSALNWFFL  601

Query  1923  AGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVF  2102
              GAI PV+VWL  KAFP Q+WI LIN+PVL+ AT+ +PPAT VN+  WI+VG    Y VF
Sbjct  602   GGAIGPVIVWLLHKAFPKQKWIPLINLPVLLGATAILPPATTVNFNCWILVGTTFNYFVF  661

Query  2103  RYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKG  2282
             +Y    WQR+NYVLS ALDAGLAFMGV+LY  L +E   ++WWGND + CP ASCP+A+G
Sbjct  662   KYHKKWWQRYNYVLSAALDAGLAFMGVILYFTLTMEGKFISWWGNDGEHCPLASCPTAEG  721

Query  2283  IIVEGCPVI  2309
             I V+GC V+
Sbjct  722   IAVDGCVVL  730



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/739 (58%), Positives = 569/739 (77%), Gaps = 17/739 (2%)
 Frame = +3

Query  123   SSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  302
                 + +S+ E  E E SPI EV LTVPTTDDPSLPV TFRMW LG +SCVLLSFLN FF
Sbjct  7     DGSRRSKSVEEIDEYELSPIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFF  66

Query  303   WYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEHVL  470
              YRTEPL IT IS Q+A +P+G+ MA ++  +  FR    G++ E++LNPGPFNVKEHVL
Sbjct  67    GYRTEPLVITMISVQVATLPVGRFMA-KVLPKTKFRVPGFGSR-EYSLNPGPFNVKEHVL  124

Query  471   ITIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYL  638
             I+IFAN+GA    GT YAI +V  +K FY + I+F    I+V+TTQVLG+GWAGI R+++
Sbjct  125   ISIFANAGAAFGSGTAYAISIVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFV  184

Query  639   VEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLT  818
             V+PA MWWP++L QVSLF ALHEK+++    +TR +FF+IA ICSF++YV PGYLF  L 
Sbjct  185   VDPAEMWWPSSLTQVSLFSALHEKDKKR---MTRAKFFLIALICSFSWYVVPGYLFPTLG  241

Query  819   SLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFF  998
             ++SW+CW FP S+ AQQ+GSG++GLGIGA+ LDWS I+S+LGSPL +P+FA  N+  G+ 
Sbjct  242   TISWVCWVFPNSITAQQIGSGMRGLGIGALTLDWSVIASFLGSPLITPFFAIINVLAGYV  301

Query  999   LILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKL  1175
             + +Y+ TP+ YW  +V+NAK FPIFS  LF + GQ YN+SAI+++ F +D+E Y ++G +
Sbjct  302   IFMYLITPVAYWGLNVYNAKNFPIFSSHLFNAQGQRYNVSAIVNNKFEIDMETYQKQGHI  361

Query  1176  YLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPE  1355
             +LS FF+++YG+GFAA+ +TL HV LF+GREI++Q ++++K ++ DIHT+LM  Y+ +P 
Sbjct  362   HLSIFFSISYGLGFAAVISTLTHVALFNGREIYKQFRATYKGKE-DIHTKLMKNYKDIPN  420

Query  1356  WWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLN  1535
              WF  +L  ++AL++  C + K+++Q+PWWG++ A  +A+ FTLPI IITA TNQTPGLN
Sbjct  421   TWFHLMLGLSLALSLILCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITATTNQTPGLN  480

Query  1536  IITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGT  1715
             I+TEY++G I PG P+AN+CFK YGYISM QA++FL DFKLGHYMKIPPR+MF+ Q +GT
Sbjct  481   IVTEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMFVVQFIGT  540

Query  1716  VIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDL  1889
             +IAG V +  AWWL+ +I  ICQ      N+ WTCP D VFYDASVIWGL+GPRRIFGDL
Sbjct  541   IIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDL  600

Query  1890  GTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWI  2069
             G Y A+NWFFL GA+ PVLVWL  KAFP Q+WI L+N+PVL+ AT  MPPAT +N+  WI
Sbjct  601   GDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWI  660

Query  2070  IVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDG  2249
              VG +  + +FRYR + WQR+NYVLS ALDAGLAFMGVLLY  L + N S++WWG + + 
Sbjct  661   FVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEGEH  720

Query  2250  CPYASCPSAKGIIVEGCPV  2306
             C  ASCP+AKGI+V+GCPV
Sbjct  721   CGLASCPTAKGIVVDGCPV  739



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/723 (59%), Positives = 556/723 (77%), Gaps = 13/723 (2%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++ SP+ +V LTV   DDPSLPV TFRMW LG LSC+LLSFLN FF YRT+PL IT IS
Sbjct  16    DDDESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMIS  75

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----TVY  509
              Q+  +PLG+LMA R+     ++   WEF+ NPGPFNVKEHVLI++FAN+GAG    T Y
Sbjct  76    VQVVTLPLGKLMA-RVLPETKYKIGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAY  134

Query  510   AIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSL  689
             A+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+PA MWWP +++QVSL
Sbjct  135   AVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSL  194

Query  690   FRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqq  869
             FRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+SW+CW FP+S+ AQQ
Sbjct  195   FRALHEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQ  251

Query  870   lgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-CDVF  1046
             LGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L++Y+  PI YW  +V+
Sbjct  252   LGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGMNVY  311

Query  1047  NAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAAL  1226
              A  FPIFS +LF   GQ YNIS I+++ F LD+E Y Q+G++YLSTFFA++YG+GFAA+
Sbjct  312   EANKFPIFSSDLFDKQGQLYNISTIVNNKFELDMENYQQQGRVYLSTFFAISYGIGFAAI  371

Query  1227  TATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFA  1406
              +TL HV LF+G+ IW+Q ++S K  KMDIHTRLM KY+ +P WWF+ +L  ++ L++  
Sbjct  372   VSTLTHVALFNGKGIWQQVRASTK-AKMDIHTRLMKKYKDIPGWWFYSLLAISLVLSLVL  430

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
             C + K+++Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNIITEY++G + PG P+A
Sbjct  431   CIFMKDEIQMPWWGLLLASFMALTFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIA  490

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             N+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q +GTVIAG V +  AW+L+ +
Sbjct  491   NVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVIAGTVNISVAWYLLTS  550

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             +  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG Y A+NWFFL G I P
Sbjct  551   VENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIGP  610

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
             VLVWL  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIVG +  Y VF+Y    
Sbjct  611   VLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKYCKKW  670

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGCPYASCPSAKGIIVEG  2297
             WQR+NYVLS ALDAGLAFMGVLLY  L +  +S+N WWG   + CP ASCP+A G++V+G
Sbjct  671   WQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINHWWGAKGENCPLASCPTAPGVLVDG  730

Query  2298  CPV  2306
             CPV
Sbjct  731   CPV  733



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/737 (59%), Positives = 567/737 (77%), Gaps = 22/737 (3%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             +  E+E S I EV LTVP TDDP+LPV TFRMW+LG LSC+LLSFLNQFF YR EPL IT
Sbjct  17    DVNEDELSSIEEVRLTVPNTDDPTLPVWTFRMWILGLLSCILLSFLNQFFSYRKEPLIIT  76

Query  333   AISAQIAVVPLGQLMAARITD---RVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGA--  497
              I+ Q+A +P+G+ MAA +     R+   G+K EF+LNPGPFN+KEHVLITIFAN+G+  
Sbjct  77    QITVQVATLPIGRFMAAVLPTTKFRILGFGSK-EFSLNPGPFNMKEHVLITIFANAGSAF  135

Query  498   --GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
               G+ YA+ +V  +K FYG+ I+F  S ++++TTQVLG+GWAG+ R+Y+VEPA MWWP+ 
Sbjct  136   GNGSAYAVGIVNIIKAFYGRSISFGASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  195

Query  672   LVQVSLFRALHEKEERPKGGI----------TRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             LVQ+SLFRALHEKE+     I          +R +FFVIA +CSF++Y+FPGY FQ L+S
Sbjct  196   LVQISLFRALHEKEDEDDNEIVNGKGNKRPMSRAKFFVIALVCSFSWYLFPGYFFQALSS  255

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             +SW+CW +P SV AQQ+GSGL GLG+GA  LDW++++S+L SPL  P+FA AN+ VG+ L
Sbjct  256   ISWVCWAYPNSVTAQQIGSGLNGLGVGAFTLDWATVASFLFSPLICPFFAIANVFVGYAL  315

Query  1002  ILYVFTPIFYWC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLY  1178
             I+YV  PI YW  +V+NAK FP++S +LFT+ GQ YNIS I++  F+LDL  Y+++G++ 
Sbjct  316   IMYVVIPISYWGFNVYNAKNFPLYSSDLFTAQGQEYNISLIVNKQFNLDLAEYEKQGRIN  375

Query  1179  LSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEW  1358
             LS FF LTYG GFA + +TL HV LF+GREI+++ ++S  + K+D+HTRLM +Y+ +P W
Sbjct  376   LSLFFTLTYGFGFATIASTLTHVALFYGREIYQRYQAS-SEGKVDVHTRLMRRYKDIPSW  434

Query  1359  WFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNI  1538
             WF+ +L   I +++  C + K Q+Q+P+WG+LLA V+A  FTLPI IITA TNQTPGLNI
Sbjct  435   WFYLLLFVTILVSLALCIFLKNQIQMPYWGLLLAAVLAFTFTLPISIITATTNQTPGLNI  494

Query  1539  ITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTV  1718
             ITEYI+G +YPG P+AN+CFK YG++SMTQAI+FL DFKLGHYMKIPPR+MF+ Q +GT+
Sbjct  495   ITEYIMGVLYPGSPIANVCFKTYGFMSMTQAISFLSDFKLGHYMKIPPRSMFLVQFLGTI  554

Query  1719  IAGFVYLGTAWWLMETIPEIC-QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             IAG V L  AWWL+++I  IC Q   +N+ WTCP DHVF+DASVIWGL+ P+RIFG LG 
Sbjct  555   IAGTVNLSVAWWLLDSIDNICHQDKFSNSPWTCPGDHVFFDASVIWGLVSPKRIFGHLGN  614

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL G I PV+VWL  K FP Q WI LIN+PVL+ AT+ MPPATA+NY +WI+V
Sbjct  615   YSALNWFFLGGMIGPVVVWLLHKLFPKQTWIPLINLPVLLGATAWMPPATALNYNSWILV  674

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWG-NDLDGC  2252
             G +  + VFRYR   WQR+NY+LS ALDAG+AFM VLLY  +G+EN S+NWWG ND + C
Sbjct  675   GTVFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFSVGMENRSINWWGNNDPEHC  734

Query  2253  PYASCPSAKGIIVEGCP  2303
               A CP+AKGI V+GCP
Sbjct  735   DLAYCPTAKGISVDGCP  751



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/741 (58%), Positives = 571/741 (77%), Gaps = 17/741 (2%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             + +   + +S+ E  E E SPI EV LTVPTTDDPSLPV TFRMW LG +SCVLLSFLN 
Sbjct  124   SGNGSRRSKSVEEIDEYELSPIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNT  183

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEH  464
             FF YRTEPL IT IS Q+A +P+G+ MA ++  +  FR    G++ E++LNPGPFNVKEH
Sbjct  184   FFGYRTEPLVITMISVQVATLPVGRFMA-KVLPKTKFRVPGFGSR-EYSLNPGPFNVKEH  241

Query  465   VLITIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRR  632
             VLI+IFAN+GA    GT YAI +V  +K FY + I+F    I+V+TTQVLG+GWAGI R+
Sbjct  242   VLISIFANAGAAFGSGTAYAISIVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRK  301

Query  633   YLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQM  812
             ++V+PA MWWP++L QVSLF ALHEK+++    +TR +FF+IA ICSF++YV PGYLF  
Sbjct  302   FVVDPAEMWWPSSLTQVSLFSALHEKDKKR---MTRAKFFLIALICSFSWYVVPGYLFPT  358

Query  813   LTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVG  992
             L ++SW+CW FP S+ AQQ+GSG++GLGIGA+ LDWS I+S+LGSPL +P+FA  N+  G
Sbjct  359   LGTISWVCWVFPNSITAQQIGSGMRGLGIGALTLDWSVIASFLGSPLITPFFAIINVLAG  418

Query  993   FFLILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEG  1169
             + + +Y+ TP+ YW  +V+NAK FPIFS  LF + GQ YN+SAI+++ F +D+E Y ++G
Sbjct  419   YVIFMYLITPVAYWGLNVYNAKNFPIFSSHLFNAQGQRYNVSAIVNNKFEIDMETYQKQG  478

Query  1170  KLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQV  1349
              ++LS FF+++YG+GFAA+ +TL HV LF+GREI++Q ++++K ++ DIHT+LM  Y+ +
Sbjct  479   HIHLSIFFSISYGLGFAAVISTLTHVALFNGREIYKQFRATYKGKE-DIHTKLMKNYKDI  537

Query  1350  PEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPG  1529
             P  WF  +L  ++AL++  C + K+++Q+PWWG++ A  +A+ FTLPI IITA TNQTPG
Sbjct  538   PNTWFHLMLGLSLALSLILCIFMKDEIQMPWWGLIFAAFLALTFTLPISIITATTNQTPG  597

Query  1530  LNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVV  1709
             LNI+TEY++G I PG P+AN+CFK YGYISM QA++FL DFKLGHYMKIPPR+MF+ Q +
Sbjct  598   LNIVTEYLMGVILPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMFVVQFI  657

Query  1710  GTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFG  1883
             GT+IAG V +  AWWL+ +I  ICQ      N+ WTCP D VFYDASVIWGL+GPRRIFG
Sbjct  658   GTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFG  717

Query  1884  DLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTT  2063
             DLG Y A+NWFFL GA+ PVLVWL  KAFP Q+WI L+N+PVL+ AT  MPPAT +N+  
Sbjct  718   DLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNA  777

Query  2064  WIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDL  2243
             WI VG +  + +FRYR + WQR+NYVLS ALDAGLAFMGVLLY  L + N S++WWG + 
Sbjct  778   WIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEG  837

Query  2244  DGCPYASCPSAKGIIVEGCPV  2306
             + C  ASCP+AKGI+V+GCPV
Sbjct  838   EHCGLASCPTAKGIVVDGCPV  858



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/753 (57%), Positives = 578/753 (77%), Gaps = 19/753 (3%)
 Frame = +3

Query  87    VEEYEGRHGFASSSKSKVESLPEAA--EEENSPIREVALTVPTTDDPSLPVLTFRMWVLG  260
             +++ EG    A+ +   VE++P A   +EENSPI +V LTV TTDDP+LPV TFRMW +G
Sbjct  1     MDKREGEREAATKASMDVEAIPGAGVEDEENSPIEQVRLTVLTTDDPTLPVWTFRMWFIG  60

Query  261   TLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEF  428
              LSC L++FLNQFF YRTEPL I  I+ Q+A +P+G+ +A R+     FR    G + +F
Sbjct  61    ILSCSLMAFLNQFFSYRTEPLIIGQITIQVASLPVGRFLA-RVLPATKFRLPGFGDR-KF  118

Query  429   TLNPGPFNVKEHVLITIFANSG----AGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQ  596
             +LNPGPFN+KEHVLI+IFAN+G    +G+ YA+ +V  ++ FY + I+F  S ++++TTQ
Sbjct  119   SLNPGPFNMKEHVLISIFANAGCAFGSGSAYAVGIVDIIRAFYKRSISFIASWLLIVTTQ  178

Query  597   VLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSF  776
             VLG+GWAG+ R+Y+VEPA MWWP  LVQVSLFRALHEKE+     ++R +FFVIA  CSF
Sbjct  179   VLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRALHEKEDSR---MSRAKFFVIALACSF  235

Query  777   AYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLA  956
              +Y  PG+LF  LTS+SW+CW F +SV AQQLGSG++GLGIGA  LDWS++SS+L SPL 
Sbjct  236   LWYAVPGFLFPTLTSISWLCWVFSKSVTAQQLGSGMRGLGIGAFTLDWSAVSSFLFSPLV  295

Query  957   SPWFATANIAVGFFLILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSN  1133
             SP+FA  N+  G+ LI+Y+ TP+ YW  D+++AKTFPIFS  LFTS+GQ Y++ AI+++ 
Sbjct  296   SPFFAIVNVFFGYVLIVYIVTPVAYWGLDLYHAKTFPIFSSHLFTSAGQNYDVHAIVNNK  355

Query  1134  FHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMD  1313
             F +D++AY+++GK+ LS FFAL+YG+GFA + AT+ HV  F+GREI+++ ++S+K +K D
Sbjct  356   FEIDVQAYEKQGKISLSIFFALSYGLGFATIAATVTHVAFFYGREIYDRFRASYK-KKAD  414

Query  1314  IHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPI  1493
             IHT+LM  Y ++P WWF+ +L+    +++  C   K+Q+QLPWWG+L AC +A +FTLP 
Sbjct  415   IHTKLMRNYEEIPGWWFYSLLIVTFVISLILCTVLKDQVQLPWWGLLFACAMAFLFTLPT  474

Query  1494  GIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMK  1673
              IITA TNQTPGLNIITEY++G I PG P++N+CFKVYGY+SM QAI+FL DFKLGHYMK
Sbjct  475   SIITATTNQTPGLNIITEYVMGLIQPGKPISNVCFKVYGYMSMAQAISFLADFKLGHYMK  534

Query  1674  IPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC--QTTATNTVWTCPSDHVFYDASV  1847
             IPP++MF+ Q VGT+IAG + L  AWWL+ ++  IC  Q    N+ WTCP D VF+DASV
Sbjct  535   IPPKSMFIVQFVGTIIAGTINLAVAWWLLGSVENICNDQLLPANSPWTCPGDRVFFDASV  594

Query  1848  IWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATS  2027
             IWGL+GPRRIFG LG Y A+NWFF+ GA+ P++VW+  K FPGQ WI LIN+PVL+ AT+
Sbjct  595   IWGLVGPRRIFGPLGNYGALNWFFVGGALGPIIVWIFHKIFPGQTWIPLINLPVLLGATA  654

Query  2028  NMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGL  2207
              MPPAT+VNY +WI+VG +  + V+RYR   W+R+NY+LS ALDAG+AFMGV+LY  L L
Sbjct  655   AMPPATSVNYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVVLYFALSL  714

Query  2208  ENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             ENVS++WWG   + CP A+CP+A+G+ V+GCPV
Sbjct  715   ENVSIDWWGTAGEHCPLATCPTARGVQVDGCPV  747



>ref|XP_002527347.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF35019.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/742 (59%), Positives = 566/742 (76%), Gaps = 21/742 (3%)
 Frame = +3

Query  135   KVESLP--EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  308
             ++E+ P  +  E+E SPI EV LTV  TDDPSLPV TFRMW LG +SC LLSFLNQFF Y
Sbjct  5     EIEAPPTKKLEEDEISPIEEVRLTVSNTDDPSLPVWTFRMWFLGLVSCCLLSFLNQFFSY  64

Query  309   RTEPLTITAISAQIAVVPLGQLMAARITDRVF----FRGTKWEFTLNPGPFNVKEHVLIT  476
             RTEPL IT I+ Q+A +P+G++MAA +    F    F G   EF+LNPGPFNVKEHVLI+
Sbjct  65    RTEPLVITQITVQVATLPIGRVMAAVLPQTKFRIPGFGGR--EFSLNPGPFNVKEHVLIS  122

Query  477   IFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVE  644
             IFAN+G+    G+ YAI +V  +K  YG+ I+F  S ++++TTQ LG+GWAG+ R+Y+VE
Sbjct  123   IFANAGSAFGNGSAYAIEIVNIIKAIYGRSISFLASWVLIITTQALGYGWAGLLRKYVVE  182

Query  645   PAAMWWPANLVQVSLFRALHEKEERPKGG-ITRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             PA MWWP  LVQ+SLFR LHEKEE   G  ++R +FFVIA  CSF +Y+ PGYLFQ + S
Sbjct  183   PAHMWWPGTLVQISLFRTLHEKEETENGNRMSRVKFFVIALTCSFLWYLVPGYLFQTVQS  242

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             ++WICW FP+SV AQQ+GSG+ GLG+GA  LDWS+I+S+L SPL +P+FA  N+ +G+ L
Sbjct  243   VAWICWAFPKSVTAQQIGSGMGGLGVGAFTLDWSTIASFLLSPLLTPFFAIVNVFIGYVL  302

Query  1002  ILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLY  1178
             ILYV TPI YW  +++NAKT+PI S  LF + G  YN SAII+  F LD+  Y + G+++
Sbjct  303   ILYVLTPITYWGLNLYNAKTYPIISSHLFDAQGARYNFSAIINDKFELDMAQYQKLGRVH  362

Query  1179  LSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEW  1358
             +STFFA++YG+GFA + ATL HV LF+GREI+++ K+S++ ++ D+HTRLM  YR +P W
Sbjct  363   MSTFFAVSYGLGFATIAATLTHVALFYGREIYDRYKASYEGKE-DVHTRLMKSYRDIPTW  421

Query  1359  WFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNI  1538
             WF+ +L      ++  C +  +Q+QLPWWG++LA  +A IFTLPI IITA TNQTPGLNI
Sbjct  422   WFYVLLAVTFVASLALCIFMNDQVQLPWWGLILAAALAFIFTLPISIITATTNQTPGLNI  481

Query  1539  ITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTV  1718
             ITEYI+G IYPG P+AN+CFK YGY+SM+QA++FL DFKLGHYMKIPPR+MF+ Q +GT+
Sbjct  482   ITEYIMGLIYPGRPIANVCFKTYGYMSMSQAVSFLSDFKLGHYMKIPPRSMFLVQFIGTI  541

Query  1719  IAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLG  1892
             IAG + LG AWWL+++I  ICQ     +N+ WTCP   VF+DASVIWGL+GP+RIFG LG
Sbjct  542   IAGTINLGVAWWLLDSIDYICQDQLLPSNSPWTCPGSRVFFDASVIWGLVGPKRIFGSLG  601

Query  1893  TYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWII  2072
              Y A+NWFFL G + PV+VWL  K FP Q WI LIN+PVL  AT+ MPPATAVN+ +WI+
Sbjct  602   EYSALNWFFLGGLLGPVVVWLFHKKFPNQTWIPLINLPVLFGATAIMPPATAVNFNSWIL  661

Query  2073  VGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN----D  2240
             VG +  + +FRYR + WQR+NYVLS ALDAG+AFM VL+Y  LGLENV+++WWG+    D
Sbjct  662   VGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMAVLIYFTLGLENVNMHWWGSDPNID  721

Query  2241  LDGCPYASCPSAKGIIVEGCPV  2306
              + CP ASCP+AKGII +GCP+
Sbjct  722   PEHCPLASCPTAKGIISDGCPI  743



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/723 (59%), Positives = 555/723 (77%), Gaps = 13/723 (2%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +++ SP+ +V LTV   DDPSLPV TFRMW LG LSC+LLSFLN FF YRT+PL IT IS
Sbjct  16    DDDESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMIS  75

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----TVY  509
              Q+  +PLG+LMA R+     ++   WEF+ NPGPFNVKEHVLI++FAN+GAG    T Y
Sbjct  76    VQVVTLPLGKLMA-RVLPETKYKIGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAY  134

Query  510   AIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSL  689
             A+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+PA MWWP +++QVSL
Sbjct  135   AVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSL  194

Query  690   FRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqq  869
             FRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+SW+CW FP+S+ AQQ
Sbjct  195   FRALHEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQ  251

Query  870   lgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-CDVF  1046
             LGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L++Y+  PI YW  +V+
Sbjct  252   LGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGMNVY  311

Query  1047  NAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAAL  1226
              A  FPIFS +LF   GQ YNIS I+++ F LD+E Y Q+G++YLSTFFA++YG+GFAA+
Sbjct  312   EANKFPIFSSDLFDKQGQLYNISTIVNNKFELDMENYQQQGRVYLSTFFAISYGIGFAAI  371

Query  1227  TATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFA  1406
              +TL HV LF+G+ IW+Q ++S K  KMDIHTRLM KY+ +P WWF+ +L  ++ L++  
Sbjct  372   VSTLTHVALFNGKGIWQQVRASTK-AKMDIHTRLMKKYKDIPGWWFYSLLAISLVLSLVL  430

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
             C + K+++Q+PWWG+LLA  +A+ F +P+ IITA TNQTPGLNIITEY++G + PG P+A
Sbjct  431   CIFMKDEIQMPWWGLLLASFMALTFIVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIA  490

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             N+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q +GTVIAG V +  AW+L+ +
Sbjct  491   NVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVIAGTVNISVAWYLLTS  550

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             +  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG Y A+NWFFL G I P
Sbjct  551   VENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIGP  610

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
             VLVWL  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIVG +  Y VF+Y    
Sbjct  611   VLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKYCKKW  670

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGCPYASCPSAKGIIVEG  2297
             WQR+NYVLS ALDAGLAFMGVLLY  L +  +S+N WWG   + CP ASCP+A G++V+G
Sbjct  671   WQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINHWWGAKGENCPLASCPTAPGVLVDG  730

Query  2298  CPV  2306
             CPV
Sbjct  731   CPV  733



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/726 (60%), Positives = 570/726 (79%), Gaps = 17/726 (2%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             EEE SP+ +V LTVP  DDP+LPV TFRMW LG  SC+LLSFLN FF YR+EPL IT IS
Sbjct  34    EEEVSPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFFSYRSEPLIITMIS  93

Query  342   AQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEHVLITIFANSGA----  497
              Q+A +P+G+ MA  +     FR    G++ EF+LNPGPFN+KEHVLI+IFAN+G+    
Sbjct  94    VQVATLPIGRFMA-NVLPTTKFRLPGFGSR-EFSLNPGPFNMKEHVLISIFANAGSAFGG  151

Query  498   GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLV  677
             G+ YA+ +V  +K FY ++I+F  S I+V+TTQVLG+GWAGI R+Y+VEPA MWWP++LV
Sbjct  152   GSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVVEPAEMWWPSSLV  211

Query  678   QVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSV  857
             QVSLFRALHE++    G  +R +FF+IA  CSF +Y+ PGYLF  L++LS +C  FP+SV
Sbjct  212   QVSLFRALHERDS---GKHSRARFFLIALACSFLWYIVPGYLFSTLSNLSLLCLIFPKSV  268

Query  858   laqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-  1034
              AQQ+GSG++GLGI ++  DWS ++S+LGSPL +P+FA  N+ VG+F ++YV  PI YW 
Sbjct  269   TAQQIGSGMRGLGIASLTFDWSVVASFLGSPLITPFFAIVNVFVGYFAVVYVMIPIAYWG  328

Query  1035  CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVG  1214
              DV++AKTFPIFS  LFT +GQ YN+SAI++  F +DL AY+Q+G++ LS FFAL+YG+ 
Sbjct  329   LDVYHAKTFPIFSSHLFTRNGQIYNVSAIVNDKFEIDLPAYEQQGRINLSIFFALSYGLN  388

Query  1215  FAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIAL  1394
             FAA+ ATL HV++F+GREI+++ ++S K  K DIHTRLM KYR +P WWF  +L+ ++ +
Sbjct  389   FAAVMATLTHVIMFNGREIYQRYRASHKG-KPDIHTRLMKKYRDIPSWWFHAMLLLSLVV  447

Query  1395  TVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypg  1574
             ++  C + K+Q+QLPWWG+L +  +A+IFTLPI IITA TNQTPGLN+ITEYIIG IYPG
Sbjct  448   SLGLCIFMKDQVQLPWWGLLFSAGLALIFTLPISIITATTNQTPGLNVITEYIIGIIYPG  507

Query  1575  ypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWW  1754
              P+AN+CFK YGYISM+QA++FL DFKLGHYMK+PPR+MF+ Q+VGT++AG + +G AW+
Sbjct  508   RPIANVCFKTYGYISMSQAVSFLNDFKLGHYMKVPPRSMFIVQLVGTIVAGTINIGIAWY  567

Query  1755  LMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAG  1928
             L+ T+  ICQ      N+ W CP+D VF+DASVIWGL+GP+RIFGDLG Y A+NW FL G
Sbjct  568   LLTTVNNICQDELLPPNSPWMCPNDRVFFDASVIWGLVGPKRIFGDLGNYSALNWCFLGG  627

Query  1929  AIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRY  2108
             A+APV VWL  KAFP + WI+LIN+PVL+ AT+ MPPAT +N+ +WI+VG +    VFRY
Sbjct  628   AVAPVFVWLLHKAFPSKTWIKLINLPVLLGATAAMPPATTLNFNSWILVGTIFNLFVFRY  687

Query  2109  RPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGII  2288
             R   WQR+NYVLS ALDAGLAFMGV+LY CLG+ENVS++WWG++ + C  ASCP+AKG+ 
Sbjct  688   RKRWWQRYNYVLSAALDAGLAFMGVVLYFCLGVENVSISWWGSNGEYCDLASCPTAKGVA  747

Query  2289  VEGCPV  2306
             V+GCPV
Sbjct  748   VDGCPV  753



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/737 (60%), Positives = 566/737 (77%), Gaps = 22/737 (3%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E  E+E SPI EV LTVP TDDP+LPV TFRMW+LG  SCVLLSFLNQFF YR EPL IT
Sbjct  19    EINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLIIT  78

Query  333   AISAQIAVVPLGQLMAARITD---RVFFRGTKWEFTLNPGPFNVKEHVLITIFANSG---  494
              I+ Q+A +P+G+ MAA +     R+   G++ EF+LNPGPFN+KEHVLITIFAN+G   
Sbjct  79    QITVQVATLPIGRFMAAVLPTTKFRILGFGSR-EFSLNPGPFNMKEHVLITIFANAGFAF  137

Query  495   -AGTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPAN  671
               G+ YA+ +V  +K FY ++I+F  S ++++TTQVLG+GWAG+ R+Y+VEPA MWWP+ 
Sbjct  138   GNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPST  197

Query  672   LVQVSLFRALHEKEERPKGGI----------TRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             LVQ+SLFRALHEKE+     I          +R +FFVIA +CSF++Y+FPGYLFQ L+S
Sbjct  198   LVQISLFRALHEKEDDDDNEIVNANGNKRPMSRAKFFVIALVCSFSWYIFPGYLFQTLSS  257

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             +SW+CW +P+SV AQQ+GSGL GLGIGA  LDW++++S+L SPL  P+FA AN+ VG+ L
Sbjct  258   ISWVCWAYPKSVTAQQIGSGLNGLGIGAFTLDWATVASFLFSPLIYPFFAIANVFVGYAL  317

Query  1002  ILYVFTPIFYWC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLY  1178
             ILYV  PI YW  +V+NAK FP++S +LFT+ GQ YNIS I+++ F LD   YD++G++ 
Sbjct  318   ILYVVIPISYWGFNVYNAKKFPLYSSDLFTAQGQVYNISLIVNNQFKLDEAEYDKQGRIN  377

Query  1179  LSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEW  1358
             LS FF LTYG GFA + +TL HV LF+GREI+++ ++S    K+D+HTRLM +Y+ +P W
Sbjct  378   LSLFFTLTYGFGFATIASTLSHVGLFYGREIYQRFRAS-SVGKVDVHTRLMRRYKDIPSW  436

Query  1359  WFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNI  1538
             WF+ +L+    +++  C + K Q+QLP+WG+LLA  +A IFTLPI IITA TNQTPGLNI
Sbjct  437   WFYLLLLMTTLVSLALCIFLKSQVQLPFWGLLLAAGLAFIFTLPISIITATTNQTPGLNI  496

Query  1539  ITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTV  1718
             ITEYI+G IYPG P+AN+CFK YGY+SMTQAI+FL DFKLGHYMKIPPR+MF+ Q VGT+
Sbjct  497   ITEYIMGTIYPGRPIANVCFKTYGYMSMTQAISFLSDFKLGHYMKIPPRSMFLVQFVGTI  556

Query  1719  IAGFVYLGTAWWLMETIPEIC-QTTATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             IAG V L  AWWL+ +I  IC Q   +N+ WTCP DHVF+DASVIWGL+ P+RIFG LG 
Sbjct  557   IAGTVNLTVAWWLLGSIDNICHQDKFSNSPWTCPGDHVFFDASVIWGLVSPKRIFGHLGN  616

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL G + PVLVWL  K+FP Q WI LIN+PVL+ AT+ MPPATA+NY +WI+V
Sbjct  617   YSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATAFMPPATALNYNSWILV  676

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGN-DLDGC  2252
             G +  + VFRYR   WQR+NY+LS ALDAG+AFM VLLY  +G+E+ S+NWWGN D + C
Sbjct  677   GTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGMEDRSINWWGNSDPEHC  736

Query  2253  PYASCPSAKGIIVEGCP  2303
               A+CP+AKGI + GCP
Sbjct  737   DLATCPTAKGITINGCP  753



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/723 (59%), Positives = 555/723 (77%), Gaps = 13/723 (2%)
 Frame = +3

Query  162   EEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAIS  341
             +E+ SP+ EV LTV   DDPSLPV TFRMW LG LSC+LLSFLN FF YRT+PL IT IS
Sbjct  16    DEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMIS  75

Query  342   AQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----TVY  509
              Q+  +PLG+LMA R+     ++   WEF+ NPGPFNVKEHVLI++FAN+GAG    T Y
Sbjct  76    VQVVTLPLGKLMA-RVLPETKYKIGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAY  134

Query  510   AIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSL  689
             A+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+PA MWWP +++QVSL
Sbjct  135   AVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSL  194

Query  690   FRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqq  869
             FRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+SW+CW FP+S+ AQQ
Sbjct  195   FRALHEKDH---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQ  251

Query  870   lgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-CDVF  1046
             LGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L++Y+  PI YW  +V+
Sbjct  252   LGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGMNVY  311

Query  1047  NAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAAL  1226
              A  FPIFS +LF   GQ YNIS I+++ F LD+E+Y QEG++YLSTFFA++YG+GFAA+
Sbjct  312   EAHKFPIFSSDLFDKQGQLYNISTIVNNKFELDMESYQQEGRVYLSTFFAISYGIGFAAI  371

Query  1227  TATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFA  1406
              +TL HV LF+G+ IW+Q ++S K  K+DIHTRLM KY+ +P WWF+ +L  ++ L++  
Sbjct  372   VSTLTHVALFNGKGIWQQVRASTK-AKVDIHTRLMKKYKDIPSWWFYGLLAISLVLSLVL  430

Query  1407  CEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVA  1586
             C + K+++Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNIITEY++G + PG P+A
Sbjct  431   CIFMKDEIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIA  490

Query  1587  NMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMET  1766
             N+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q +GTVIAG V +  AW+L+ +
Sbjct  491   NVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVIAGTVNISVAWYLLTS  550

Query  1767  IPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAP  1940
             +  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG Y A+NWFFL G I P
Sbjct  551   VENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIGP  610

Query  1941  VLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDL  2120
             +LVWL  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIVG +  Y VF++    
Sbjct  611   LLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKHCKKW  670

Query  2121  WQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSL-NWWGNDLDGCPYASCPSAKGIIVEG  2297
             WQR+NYVLS ALDAGLAFMGVLLY  L +   S+ +WWG   + CP ASCP+A GI VEG
Sbjct  671   WQRYNYVLSAALDAGLAFMGVLLYFSLTMNGKSIEHWWGAKGENCPLASCPTAPGIHVEG  730

Query  2298  CPV  2306
             CPV
Sbjct  731   CPV  733



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/736 (59%), Positives = 566/736 (77%), Gaps = 13/736 (2%)
 Frame = +3

Query  126   SKSKVESLPEAAEEEN--SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  299
             S S +E  P    +EN  SP+ EV LTV   DDP+LPV TFRMW LG  SC LLSFLN F
Sbjct  2     STSTLEIEPATKHDENDVSPVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTF  61

Query  300   FWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITI  479
             F YRTEPL I+ IS Q+A +P+G+ MA  +  R F  G+K EF+LNPGPFN+KEHVLI+I
Sbjct  62    FSYRTEPLIISMISVQVATLPIGRFMARALPKRKFQIGSK-EFSLNPGPFNMKEHVLISI  120

Query  480   FANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEP  647
             FAN+G+G    T YAI +V  +K FY + I+F  S I+V+TTQVLG+GWAGI RRY+V+P
Sbjct  121   FANAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDP  180

Query  648   AAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLS  827
             A MWWP++LVQVSLFRALHEK+      ++R +FF IA ICSFA++V PGYLF  L+++S
Sbjct  181   AEMWWPSSLVQVSLFRALHEKDNN---RMSRGKFFFIALICSFAWFVVPGYLFPTLSTIS  237

Query  828   WICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLIL  1007
             W+CW +P+SV AQQ+GSG+ GLGIGA  LDW+ I+SYL SPL SP+FA  N+A G+ L++
Sbjct  238   WVCWIYPKSVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVNVAAGYVLVM  297

Query  1008  YVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLS  1184
             Y+  PI YW  +++NAK F IFS  LF +SGQ YN+SA++++ F +D+ AY+++G++ LS
Sbjct  298   YMLLPIAYWGVNLYNAKNFAIFSSHLFDASGQIYNVSALVNNKFEIDMPAYERQGRINLS  357

Query  1185  TFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWF  1364
              FF+LTYG+GFA++ +TL HV LF+GREI++Q + + +  K DIHTRLM KY+ +P WWF
Sbjct  358   VFFSLTYGIGFASVVSTLTHVALFNGREIYKQYRRASQSVKEDIHTRLMRKYKDIPNWWF  417

Query  1365  WCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIIT  1544
               +L+ ++AL++  C + K+Q+Q+PWWG++ A  +A++FTLPI II A TNQ+PGLNIIT
Sbjct  418   HLMLLVSLALSLVMCIFMKDQVQMPWWGLIFAAGLALVFTLPISIIPATTNQSPGLNIIT  477

Query  1545  EyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIA  1724
             EYI+G I PG P+AN+CFK YGYISM+QAI+FL DFKLGHYMKIPP +MF+ Q +GT++A
Sbjct  478   EYIMGLILPGKPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPISMFIVQCIGTIVA  537

Query  1725  GFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTY  1898
             G V +G AWWL+ +I  ICQ      N+ WTCP D VF+DASVIWGL+GP+RIFG LG Y
Sbjct  538   GTVNIGVAWWLLSSIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNY  597

Query  1899  EAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVG  2078
             +A+NWFFL GA+ P+LVWL  KAFP Q+WI+LIN+PVL+ AT+ MPPAT VN+  WI+VG
Sbjct  598   KALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAMPPATTVNFNCWIVVG  657

Query  2079  FLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPY  2258
              +  Y VFRYR   WQR+NYVLS ALDAG+AFMGVLLY  L +   S++WWG + + C  
Sbjct  658   TIFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGTNGEHCDL  717

Query  2259  ASCPSAKGIIVEGCPV  2306
             A+CP+AKGI+V+GCPV
Sbjct  718   ATCPTAKGIVVDGCPV  733



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/726 (59%), Positives = 555/726 (76%), Gaps = 13/726 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E  +E+ SP+ EV LTV   DDPSLPV TFRMW LG +SCV+LSFLN FF YRT+PL I+
Sbjct  10    EMDDEDESPVEEVRLTVSNDDDPSLPVWTFRMWFLGLISCVMLSFLNTFFGYRTQPLMIS  69

Query  333   AISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----  500
              IS Q+  +P+G+LMA R+     +R   WEF+ NPGPFNVKEHVLI++FAN+GAG    
Sbjct  70    MISVQVVTLPIGKLMA-RVLPETKYRIGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSG  128

Query  501   TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  680
             T YA+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+PA MWWP +++Q
Sbjct  129   TAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  188

Query  681   VSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVl  860
             VSLFRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+SW+CW FP+S+ 
Sbjct  189   VSLFRALHEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  245

Query  861   aqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYW-C  1037
             AQQ+GSG+ GLGIG++ LDWS I+SYLGSPL +P+FA  N+ VG+ LI+Y+  PI YW  
Sbjct  246   AQQIGSGMSGLGIGSLALDWSVIASYLGSPLVTPFFAIVNVIVGYVLIMYMVIPISYWGM  305

Query  1038  DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGF  1217
             +V+ A  FPIFS +LF S GQ YNIS I++  F LD   Y +EG++YLSTFFA+TYG+GF
Sbjct  306   NVYEANKFPIFSSDLFDSRGQLYNISTIVNDKFELDEGMYQREGRVYLSTFFAITYGIGF  365

Query  1218  AALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALT  1397
             AA+ +TL HV LF+G+ IW+Q ++S    K+DIHTRLM KY+ +P WWF+ +L  ++AL+
Sbjct  366   AAIVSTLTHVALFNGKGIWQQVRAS-TSAKVDIHTRLMRKYKDIPSWWFYSLLGVSLALS  424

Query  1398  VFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgy  1577
             +  C   KEQ+Q+PWWG++LA  +A++FT+P+ IITA TNQTPGLNIITEY++G + PG 
Sbjct  425   LVLCTVMKEQIQMPWWGLILASFMALLFTVPVSIITATTNQTPGLNIITEYLMGVLLPGR  484

Query  1578  pVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWL  1757
             P+AN+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q +GTVIAG V +  AW+L
Sbjct  485   PIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQFIGTVIAGTVNISVAWYL  544

Query  1758  METIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGA  1931
             + ++  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG Y A+NWFFL G 
Sbjct  545   LTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGL  604

Query  1932  IAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYR  2111
             I P+LVWL  +AFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIVG +  Y VF+  
Sbjct  605   IGPILVWLLQRAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVVFNYFVFKNY  664

Query  2112  PDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSL-NWWGNDLDGCPYASCPSAKGII  2288
                WQR+NYVLS ALDAGLA MGVLLY  L +  +S+ NWWG++ + CP ASCP+A GI 
Sbjct  665   KKWWQRYNYVLSAALDAGLAIMGVLLYFSLTMNGISIGNWWGSNGENCPLASCPTAPGIH  724

Query  2289  VEGCPV  2306
             VEGCPV
Sbjct  725   VEGCPV  730



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/719 (60%), Positives = 552/719 (77%), Gaps = 13/719 (2%)
 Frame = +3

Query  174   SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIA  353
             SP+ EV LTV   DDPSLPV TFRMW LG LSCVLLSFLN FF YRT+PL IT IS Q+ 
Sbjct  22    SPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVV  81

Query  354   VVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAG----TVYAIHV  521
              +PLG+LMA R+     ++   WEF+LNPGPFNVKEHVLI++FAN+GAG    T YA+ +
Sbjct  82    TLPLGKLMA-RVLPETKYKIGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGI  140

Query  522   VTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRAL  701
             V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+PA MWWP +++QVSLFRAL
Sbjct  141   VDIIVAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQVSLFRAL  200

Query  702   HEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsg  881
             HEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+SW+CW FP+S+ AQQLGSG
Sbjct  201   HEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSITAQQLGSG  257

Query  882   lqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPI-FYWCDVFNAKT  1058
             + GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L++Y+  PI +Y  +++ A  
Sbjct  258   MSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILVMYMVIPISYYGMNMYEANK  317

Query  1059  FPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATL  1238
             FPIFS +LF   GQ YNIS I++  F LD+  Y QEG++YLSTFFA++YG+GFAA+ +TL
Sbjct  318   FPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVYLSTFFAISYGIGFAAIVSTL  377

Query  1239  VHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYY  1418
              HV LF+G+ IW+Q ++S K  K+DIHTRLM KY+ +P WWF+ +L  +I L++  C + 
Sbjct  378   THVALFNGKGIWQQVRASTKS-KVDIHTRLMKKYKDIPGWWFYGLLAISIVLSLVLCIFM  436

Query  1419  KEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCF  1598
             KEQ+Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNIITEY++G + PG P+AN+CF
Sbjct  437   KEQIQMPWWGLLLASFMAVTFTVPVSIITATTNQTPGLNIITEYLMGVLLPGRPIANVCF  496

Query  1599  KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEI  1778
             K YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q++GTVIAG V +  AW+L+ ++  I
Sbjct  497   KTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVIAGTVNISVAWYLLTSVENI  556

Query  1779  CQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVW  1952
             CQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG Y A+NWFFL G I PVLVW
Sbjct  557   CQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVW  616

Query  1953  LATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRH  2132
             L  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIVG +  Y VF+Y    WQR+
Sbjct  617   LLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRY  676

Query  2133  NYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             NYVLS ALDAGLAFMGVLLY  L +  +S++ WWG   + CP A+CP+A GI VEGCPV
Sbjct  677   NYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKGENCPLAACPTAPGIQVEGCPV  735



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 560/730 (77%), Gaps = 17/730 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E+ +++ SPI EV LTV  TDD +LPV TFRMW LG +SC LLSFLNQFF YRTEPL IT
Sbjct  6     ESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVIT  65

Query  333   AISAQIAVVPLGQLMAARITDRVF----FRGTKWEFTLNPGPFNVKEHVLITIFANSGA-  497
              I+ Q+A +P+G  +A  +    F    F  T+  F+LNPGPFN+KEHVLI+IFAN+G+ 
Sbjct  66    QITVQVATLPIGHFLAKVLPKTQFGIPGFGSTR--FSLNPGPFNMKEHVLISIFANAGSA  123

Query  498   ---GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
                G+ YA+ +VT +K FY K+I+F    ++++TTQVLG+GWAG+ R+Y+VEPA MWWP+
Sbjct  124   FGSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
              LVQVSLFRALHEK+E+    +TR +FFVIA +CSF +Y+ PGYLF  LTS+SWICW FP
Sbjct  184   TLVQVSLFRALHEKDEQR---MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFP  240

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             RSV AQQ+GSG++GLG+GA  LDW++++S+L SPL SP+FA AN+ +G+ L++Y+  P+ 
Sbjct  241   RSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLS  300

Query  1029  YWC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
             YW  D +NA  FPIFS  LFTS GQTYNI AI++  F LDL  Y+Q+G++ LSTFFA+TY
Sbjct  301   YWGFDAYNATRFPIFSSHLFTSVGQTYNIPAIVNDKFELDLAKYEQQGRINLSTFFAMTY  360

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVAN  1385
             G+GFA + +TL HV LF+GREI E+ + S+K ++ D+HTRLM +Y+ +P WWF+ +L A 
Sbjct  361   GLGFATIASTLTHVALFYGREITERFRVSYKGKE-DVHTRLMKRYKDIPSWWFYSMLGAT  419

Query  1386  IALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyi  1565
             + +++  C +  +Q+Q+PWWG++ A  +A +FTLPI IITA TNQTPGLNIITEY +G I
Sbjct  420   LLISLALCIFLNDQVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAMGII  479

Query  1566  ypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGT  1745
             YPG P+AN+CFKVYGY+SM QA++FL DFKLGHYMKIPPR+MF+ Q +GT++AG + +  
Sbjct  480   YPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINITV  539

Query  1746  AWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
             AWW + TI  ICQ      N+ WTCP D VF+DASVIWGL+GP+RIFG  G Y A+NWFF
Sbjct  540   AWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFF  599

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GAI PV+VWL  KAFP + WI L+N+PVL+ AT+ MPPATAVNY +WI+VG +    V
Sbjct  600   LGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNLFV  659

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAK  2279
             FRYR   WQR+NYVLS A+DAG+AFM VLLY  +G+E+ SL+WWG   + C  A CP+A+
Sbjct  660   FRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTQGEHCDLARCPTAR  719

Query  2280  GIIVEGCPVI  2309
             G+IV+GCPV+
Sbjct  720   GVIVKGCPVV  729



>ref|XP_002977317.1| hypothetical protein SELMODRAFT_232939 [Selaginella moellendorffii]
 gb|EFJ21321.1| hypothetical protein SELMODRAFT_232939 [Selaginella moellendorffii]
Length=711

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/718 (62%), Positives = 549/718 (76%), Gaps = 15/718 (2%)
 Frame = +3

Query  165   EENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISA  344
              E SPI EVALTVPTTDD SLPV TFRMW LG LSC LL+F+NQFF YRTEPLT+  ISA
Sbjct  6     REQSPIEEVALTVPTTDDASLPVYTFRMWTLGLLSCALLAFINQFFSYRTEPLTVGVISA  65

Query  345   QIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVV  524
             QIA +PLG+LMAA +      R     F+LNPGPFNVKEHVLITIFAN+GAG  YAI +V
Sbjct  66    QIAALPLGRLMAAALPSAQL-RLLGRSFSLNPGPFNVKEHVLITIFANAGAGGAYAIGIV  124

Query  525   TAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  704
               VK FYG+ ++F ++          G+GWAGIFRRYLV+PA MWWP+NLVQVS+F  LH
Sbjct  125   NIVKAFYGRELSFVIT----------GYGWAGIFRRYLVDPAEMWWPSNLVQVSIFNTLH  174

Query  705   EKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsgl  884
             EK+ R KG +TR QFF+I   CSF YY  PGYLF+ LTS+SW+CW +P+SVLA QLGSG+
Sbjct  175   EKDSRRKGDVTRLQFFLITLACSFLYYSLPGYLFKTLTSISWVCWAWPKSVLAHQLGSGM  234

Query  885   qglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIFYWCDVFNAKTFP  1064
              G+GIGA+G DWS+++SYL SPLA+PWFA AN+ VGF +++YV TP  Y+ +V++AKTFP
Sbjct  235   SGMGIGAVGFDWSTVASYLSSPLATPWFAIANVMVGFLIVMYVITPAAYFSNVYSAKTFP  294

Query  1065  IFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVH  1244
             IFS +LF   G  YNIS +++  F LD++AY+   KL LSTFF  TYGVGFAALTAT+ H
Sbjct  295   IFSSQLFADDGSRYNISRVVNERFELDVQAYNSYSKLNLSTFFVFTYGVGFAALTATVSH  354

Query  1245  VVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKE  1424
             VVLFHG+E+W ++ ++F   K+D+HTRLM KY+  P+WWF  +L  +I  ++  C  +K+
Sbjct  355   VVLFHGKEMWSRAVAAFHAEKLDVHTRLMRKYKPCPQWWFLALLALSIFGSIITCVVFKD  414

Query  1425  QLQLPWWGVLLACVIAIIFTLPIGIITAITN-QTPGLNIITEyiigyiypgypVANMCFK  1601
             Q+QLPWWGVLLAC +A +FTLPIG+ITA TN QTPGLN+ITEYIIGY+ PG P+AN+CFK
Sbjct  415   QVQLPWWGVLLACGLAFVFTLPIGVITATTNQQTPGLNVITEYIIGYMLPGKPIANVCFK  474

Query  1602  VYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEIC  1781
              YGYISMTQAI+FLQDFKLGHYMK+PPR+MF  QV+GT++A  V + TAWW++ ++  IC
Sbjct  475   TYGYISMTQAISFLQDFKLGHYMKVPPRSMFAVQVLGTIVAAVVNVATAWWMLTSVENIC  534

Query  1782  QTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWL  1955
              T     ++ WTCP+D VFY ASVIWGLIGP+RIFG LG Y  ++WFFL GA+APV++WL
Sbjct  535   DTDKLPADSPWTCPNDSVFYSASVIWGLIGPKRIFGSLGNYSELSWFFLVGALAPVVLWL  594

Query  1956  ATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHN  2135
              TKAFP   W+  IN+PV++ ATS MPPA+AVNY +W  VG    Y V+ YR   WQR+N
Sbjct  595   LTKAFPRARWLSYINLPVILGATSMMPPASAVNYISWTSVGLFFNYFVYTYRRRWWQRYN  654

Query  2136  YVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPVI  2309
             YVLS ALDAG+AFMGVLLY  L +   S+ WWGND   CP A CP+  GI+V GCPVI
Sbjct  655   YVLSAALDAGVAFMGVLLYFALQMNGTSVTWWGND-SHCPLARCPTYPGIVVPGCPVI  711



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/738 (59%), Positives = 561/738 (76%), Gaps = 13/738 (2%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A+    K E      +E+ SP+ EV LTV   DDPSLPV TFRMW LG LSCVLLSFLN 
Sbjct  2     AAIESHKPEITNADDDEDESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNT  61

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFRGTKWEFTLNPGPFNVKEHVLIT  476
             FF YRT+PL IT IS Q+  +PLG+LMA R+     ++   WEF+ NPGPFNVKEHVLI+
Sbjct  62    FFGYRTQPLMITMISVQVVTLPLGKLMA-RVLPETKYKIGSWEFSFNPGPFNVKEHVLIS  120

Query  477   IFANSGAG----TVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVE  644
             +FAN+GAG    T YA+ +V  +  FY + I+F  S I+V+TTQ+LG+GWAGI R+ +V+
Sbjct  121   MFANAGAGFGSGTAYAVGIVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVD  180

Query  645   PAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSL  824
             PA MWWP +++QVSLFRALHEK+      ++R +FFVIAF+CSFA+Y+FP YLF  L+S+
Sbjct  181   PAQMWWPTSVLQVSLFRALHEKDN---ARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSI  237

Query  825   SWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLI  1004
             SW+CW FP+S+ AQQLGSG+ GLGIGA  LDWS I+SYLGSPL +P+FA  N+ VG+ L+
Sbjct  238   SWVCWAFPKSITAQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYILV  297

Query  1005  LYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             +Y+  PI YW  +V+ A  FPIFS +LF   G+ YNIS I+++ F LD+  Y QEG++YL
Sbjct  298   MYMVIPISYWGMNVYEANKFPIFSSDLFDKQGELYNISTIVNNKFELDMGNYQQEGRVYL  357

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFA++YG+GFAA+ +TL HV LF+G+ IW+Q ++S K  K+DIHTRLM KY+ +P WW
Sbjct  358   STFFAISYGIGFAAIVSTLTHVALFNGKGIWQQVRASTK-AKVDIHTRLMKKYKDIPSWW  416

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F+ +L  ++AL++  C + K+Q+Q+PWWG+LLA  +A+ FT+P+ IITA TNQTPGLNII
Sbjct  417   FYGLLAISLALSLVLCIFMKDQIQMPWWGLLLASFMALTFTVPVSIITATTNQTPGLNII  476

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEY++G + PG P+AN+CFK YGYISM+QAI+FL DFKLGHYMKIPPR+MF+ Q++GTVI
Sbjct  477   TEYLMGVLLPGRPIANVCFKTYGYISMSQAISFLNDFKLGHYMKIPPRSMFLVQLIGTVI  536

Query  1722  AGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             AG V +  AW+L+ ++  ICQ      N+ WTCPSD VF+DASVIWGL+GP+RIFG LG 
Sbjct  537   AGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGN  596

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y A+NWFFL G I PVLVWL  KAFP + WI  IN+PVL+ AT+ MPPAT+VN+  WIIV
Sbjct  597   YPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIV  656

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLN-WWGNDLDGC  2252
             G +  Y VF+Y    WQR+NYVLS ALDAGLAFMGVLLY  L +  +S++ WWG + + C
Sbjct  657   GVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGANGENC  716

Query  2253  PYASCPSAKGIIVEGCPV  2306
             P ASCP+A GI VEGCPV
Sbjct  717   PLASCPTAPGIQVEGCPV  734



>ref|XP_002960906.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
 gb|EFJ38445.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
Length=739

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/738 (58%), Positives = 554/738 (75%), Gaps = 11/738 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A     + E     ++EE SPI +VALTV   DDPS PV TFRMW +G L+C +LSFLNQ
Sbjct  3     AGKRGEQEEEFHGDSKEEQSPIEQVALTVDVEDDPSQPVWTFRMWAIGILACAMLSFLNQ  62

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF-FRGTKWEFTLNPGPFNVKEHVLI  473
             FF YRTEPL IT  SAQI  +P+G+ MAA +  R++    T +EF+LNPGPFN KEHVLI
Sbjct  63    FFSYRTEPLVITLTSAQIVALPIGRFMAAVLPTRIYRVPFTGFEFSLNPGPFNKKEHVLI  122

Query  474   TIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLV  641
             TIFAN+G+    G  YA+ +V  +K FY + I F+  L++V+TTQVLG+GWAG+ R+YLV
Sbjct  123   TIFANAGSAFGNGGAYAVFIVDIIKAFYKRKIHFYTGLLLVITTQVLGYGWAGLLRKYLV  182

Query  642   EPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             EPA+MWWP NLVQVSLF+ LH+KE     G+TR QFF+I     FAYY  PGYLF +L+S
Sbjct  183   EPASMWWPGNLVQVSLFKTLHDKESVK--GLTRIQFFLIFLTVGFAYYALPGYLFSVLSS  240

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             +SW+CW FP SVLAQQLGSG QGLG+GAIGLDW+S SSYLGSPL SP+FA AN+AVG+ L
Sbjct  241   ISWVCWAFPNSVLAQQLGSGFQGLGLGAIGLDWASASSYLGSPLVSPFFAIANVAVGYIL  300

Query  1002  ILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             I YV  P FYW +++NAKTFPIFS  LFTS GQ Y+I  +++  F LD+  Y ++G +++
Sbjct  301   IAYVMMPTFYWANIYNAKTFPIFSSHLFTSKGQIYDIQKVVNDKFELDMAEYQRQGPIHM  360

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFA+TYG GFAA+ +T+ HV+ FHG++IW  S+S+ K    D+H R+M +Y  +P  W
Sbjct  361   STFFAMTYGFGFAAVASTITHVLCFHGKDIWRMSRSALKSPP-DVHARMMQRYPTIPNLW  419

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F  +++ ++ + +  C  +KEQ+QLPWWGV+L+C IA  FTLP+G+ITA TN TPGLNII
Sbjct  420   FVILMLVSLGVAIATCLGFKEQIQLPWWGVILSCAIAATFTLPVGVITATTNITPGLNII  479

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEYI+GY+ PG P+AN+ FK YGY+SMTQA++FL DFKLGHYMKIPPR+MF  Q+VGT+I
Sbjct  480   TEYIVGYMLPGKPIANVVFKTYGYMSMTQALSFLSDFKLGHYMKIPPRSMFTVQIVGTII  539

Query  1722  AGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             A  V +G AWWL+  I  IC T     ++ WTCPSD VF+DASVIWGL+GP+RIFG LG 
Sbjct  540   AATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGE  599

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y  ++WFFL G +AP+ VW+ ++A P  E++R +N+PV++ AT  MPPAT+VNYTTWI +
Sbjct  600   YSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITL  659

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWG-NDLDGC  2252
             G +  Y V++YR   W+R+NYVLS ALDAG AFM V+LY  LGLE+VSL WWG +D D C
Sbjct  660   GVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHC  719

Query  2253  PYASCPSAKGIIVEGCPV  2306
             P A CP+  GI+V+GCPV
Sbjct  720   PLAKCPTQPGIVVDGCPV  737



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/744 (57%), Positives = 571/744 (77%), Gaps = 18/744 (2%)
 Frame = +3

Query  114   FASSSKSKVES-LPEAAEEEN-SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSF  287
             + SS  + +E  + +A E+++ SPI EV LTV  TDDP+LP+ TFRMW LG +SC LL+F
Sbjct  10    YTSSRLTDLEKPIADAVEDDDVSPIEEVRLTVANTDDPTLPIWTFRMWFLGLISCSLLAF  69

Query  288   LNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNV  455
             LNQFF YRTEPL I+ I+ Q+A +P+G+ MAA +  +  F+    G++  F+LNPGPFN+
Sbjct  70    LNQFFSYRTEPLIISQITVQVASLPIGRSMAA-VLPKTKFKIPGFGSR-TFSLNPGPFNI  127

Query  456   KEHVLITIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGI  623
             KEHVLI+IFAN+G+    G+ YA+ +VT +K FYG+ I+F    +++ TTQVLG+GWAG+
Sbjct  128   KEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYGRRISFLAGWLLITTTQVLGYGWAGL  187

Query  624   FRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYL  803
              R+Y+VEPA MWWP  LVQVSLFRALHEK++  +  +TR +FFVIA  CSF +Y+FPGYL
Sbjct  188   LRKYVVEPAHMWWPGTLVQVSLFRALHEKDDGHR--MTRAKFFVIALACSFVWYLFPGYL  245

Query  804   FQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANI  983
             F  L+S+SW+CW FP+SV AQQLGSG++GLG+GAI LDWS ++S+L SPL SP+FA AN+
Sbjct  246   FTTLSSISWVCWVFPKSVTAQQLGSGMRGLGLGAITLDWSVVASFLFSPLISPFFAIANV  305

Query  984   AVGFFLILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYD  1160
              VG+  I+YV  P+ YW  D+++A+ FPIFS  LFT+ G  YNI+AI+++ F LDL  Y+
Sbjct  306   LVGYVFIIYVAMPLSYWGLDLYSARKFPIFSSHLFTAEGHKYNITAIVNNKFQLDLPNYE  365

Query  1161  QEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKY  1340
             Q+G+++LS FFALTYG GFA + ATL HV  F+GREI ++ ++S+K ++ DIHT+LM +Y
Sbjct  366   QQGRIHLSMFFALTYGFGFATIAATLTHVAFFYGREILQKYRASYKGKE-DIHTKLMKRY  424

Query  1341  RQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQ  1520
             + +P WWF+ +L   + + +  C +  +Q+Q+PWWG++ A  +A +FTLPI IITA TNQ
Sbjct  425   KDIPSWWFYLLLGVTLIVALALCIFLNDQIQMPWWGLIFASAMAFVFTLPISIITATTNQ  484

Query  1521  TPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMA  1700
             TPGLNIITEY++G I PG P+AN+CFK YGY+SM QA++FL DFKLGHYMKIPPR+MF+ 
Sbjct  485   TPGLNIITEYVMGVILPGRPIANVCFKTYGYMSMAQAVSFLSDFKLGHYMKIPPRSMFLV  544

Query  1701  QVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRR  1874
             Q +GTV+AG + L  AWWL+ +I  ICQ      N+ WTCP D VF+DASVIWGL+GP+R
Sbjct  545   QFIGTVLAGTINLAVAWWLLNSIENICQDDLLPVNSPWTCPGDRVFFDASVIWGLVGPKR  604

Query  1875  IFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVN  2054
             IFG LG Y+A+NWFFL GA+ PV++WL  K+FP Q WI LIN+PVL+ AT+ MPPAT VN
Sbjct  605   IFGTLGNYQAMNWFFLGGALGPVIIWLLHKSFPKQSWIPLINLPVLLGATAMMPPATPVN  664

Query  2055  YTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWG  2234
             Y  WIIVG +  + +FRY+   WQR+NYVLS ALDAG+AFM VLLY  +G+E+ SLNWWG
Sbjct  665   YNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIEDRSLNWWG  724

Query  2235  NDLDGCPYASCPSAKGIIVEGCPV  2306
              + + C  A+CP+AKGI+V+GCPV
Sbjct  725   TNGEHCELATCPTAKGIMVDGCPV  748



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   857 bits (2215),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 559/730 (77%), Gaps = 17/730 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E+ +++ SPI EV LTV  TDD +LPV TFRMW LG +SC LLSFLNQFF YRTEPL IT
Sbjct  6     ESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVIT  65

Query  333   AISAQIAVVPLGQLMAARITDRVF----FRGTKWEFTLNPGPFNVKEHVLITIFANSGA-  497
              I+ Q+A +P+G  +A  +    F    F  T+  F+LNPGPFN+KEHVLI+IFAN+G+ 
Sbjct  66    QITVQVATLPIGHFLAKVLPKTQFGIPGFGSTR--FSLNPGPFNMKEHVLISIFANAGSA  123

Query  498   ---GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
                G+ YA+ +VT +K FY K+I+F    ++++TTQVLG+GWAG+ R+Y+VEPA MWWP+
Sbjct  124   FGSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
              LVQVSLFRALHEK+E+    +TR +FFVIA +CSF +Y+ PGYLF  LTS+SWICW FP
Sbjct  184   TLVQVSLFRALHEKDEQR---MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFP  240

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             RSV AQQ+GSG++GLG+GA  LDW++++S+L SPL SP+FA AN+ +G+ L++Y+  P+ 
Sbjct  241   RSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLS  300

Query  1029  YWC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
             YW  D +NA  FPIFS  LFTS GQTY+I AI++  F LDL  Y+Q+G++ LSTFFA+TY
Sbjct  301   YWGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRINLSTFFAMTY  360

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVAN  1385
             G+GFA + +TL HV LF+GREI E+ + S+K ++ D+HTRLM +Y+ +P WWF+ +L A 
Sbjct  361   GLGFATIASTLTHVALFYGREITERFRVSYKGKE-DVHTRLMKRYKDIPSWWFYSMLAAT  419

Query  1386  IALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyi  1565
             + +++  C +  +Q+Q+PWWG++ A  +A +FTLPI IITA TNQTPGLNIITEY +G I
Sbjct  420   LLISLALCIFLNDQVQMPWWGLVFASAMAFVFTLPISIITATTNQTPGLNIITEYAMGII  479

Query  1566  ypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGT  1745
             YPG P+AN+CFKVYGY+SM QA++FL DFKLGHYMKIPPR+MF+ Q +GT++AG + +  
Sbjct  480   YPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINITV  539

Query  1746  AWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
             AWW + TI  ICQ      N+ WTCP D VF+DASVIWGL+GP+RIFG  G Y A+NWFF
Sbjct  540   AWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFF  599

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GAI PV+VWL  KAFP   WI L+N+PVL+ AT+ MPPATAVNY +WI+VG +    V
Sbjct  600   LGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNLFV  659

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAK  2279
             FRYR   WQR+NYVLS A+DAG+AFM VLLY  +G+E+ SL+WWG   + C  A CP+A+
Sbjct  660   FRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRGEHCDLARCPTAR  719

Query  2280  GIIVEGCPVI  2309
             G+IV+GCPVI
Sbjct  720   GVIVKGCPVI  729



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/731 (60%), Positives = 567/731 (78%), Gaps = 17/731 (2%)
 Frame = +3

Query  150   PEAAEEEN--SPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPL  323
             P AA++ +  SPI EV LTV  TDDP+LPV TFRMW LG LSC LLSFLNQFF YRTEPL
Sbjct  26    PTAADDADDVSPIEEVRLTVSNTDDPTLPVWTFRMWFLGLLSCGLLSFLNQFFAYRTEPL  85

Query  324   TITAISAQIAVVPLGQLMAARITDRVFFR----GTKWEFTLNPGPFNVKEHVLITIFANS  491
              IT I+ Q+A +P+G  +A+ +  +  FR    G+K  F+LNPGPFN+KEHVLI+IFAN+
Sbjct  86    VITQITVQVATLPIGHFLAS-VLPKTKFRIAGFGSK-TFSLNPGPFNMKEHVLISIFANA  143

Query  492   GA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMW  659
             G+    G+ YA+ +VT +K FY + I+FF S I+++TTQVLG+GWAG+ R+Y+VEPA MW
Sbjct  144   GSAFGSGSAYAVGIVTIIKAFYQRKISFFASWILIVTTQVLGYGWAGLLRKYVVEPAHMW  203

Query  660   WPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICW  839
             WP+ LVQVSLFRALHEK+++ +G +TR +FF+IA +CSF++YV PGYLF  LTS+SW+CW
Sbjct  204   WPSTLVQVSLFRALHEKDDKGQG-MTRAKFFLIALVCSFSWYVVPGYLFTTLTSISWVCW  262

Query  840   FFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFT  1019
              F +SV AQQLGSG++GLG+GA  LDWS+++S+L SPL SP+FA  N+A+G+ LILY+  
Sbjct  263   VFSKSVTAQQLGSGMRGLGLGAFTLDWSAVASFLFSPLISPFFAIVNVAIGYVLILYIAI  322

Query  1020  PIFYW-CDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFA  1196
             P+ YW  D++NA  FPIFS  LFT+ GQ YNI AI++  F LDL  YD++G+++LS FFA
Sbjct  323   PVAYWGLDLYNAHRFPIFSSHLFTAQGQKYNIPAIVNDKFELDLPKYDEQGRIHLSMFFA  382

Query  1197  LTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCIL  1376
             LTYG GFA + +TL+HV LF+GREI EQ ++S K ++ DIHTRLM +Y+ +P WWF+ +L
Sbjct  383   LTYGFGFATIASTLMHVALFYGREILEQYRASSKGKE-DIHTRLMKRYKDIPAWWFYLLL  441

Query  1377  VANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyii  1556
               ++A+++  C +  +Q+Q+PWW ++ A  +A  FTLPI IITA TNQTPGLNIITEY++
Sbjct  442   AVSLAVSLLLCIFLNDQVQMPWWALIFASAMAFFFTLPISIITATTNQTPGLNIITEYVM  501

Query  1557  gyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVY  1736
             G IYPG P+AN+CFK YGYISM QA++FL DFKLGHYMKIPPR+MF+ Q +GT++AG + 
Sbjct  502   GIIYPGRPIANVCFKTYGYISMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTMLAGTIN  561

Query  1737  LGTAWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVN  1910
             L  AWWL+ +I  ICQ      N+ WTCP D VF+DASVIWGL+GPRRIFG LG Y+A+N
Sbjct  562   LAVAWWLLNSITNICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGSLGNYQAMN  621

Query  1911  WFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSG  2090
             WFFL GA+ P++VWL  K+FP + WI LIN+PVL+ +T  MPPATAVNY +WIIVG +  
Sbjct  622   WFFLGGAVGPIIVWLLHKSFPRKSWIPLINLPVLLGSTGMMPPATAVNYNSWIIVGTIFN  681

Query  2091  YVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCP  2270
             + VFRYR   WQR+NY+LS ALDAG+AFM VLLY  LG+EN SL WWG D + C  ASCP
Sbjct  682   FFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGIENRSLTWWGTDGEHCDLASCP  741

Query  2271  SAKGIIVEGCP  2303
             +AKGI V GCP
Sbjct  742   TAKGIDVAGCP  752



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 559/730 (77%), Gaps = 17/730 (2%)
 Frame = +3

Query  153   EAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTIT  332
             E+ +++ SPI EV LTV  TDD +LPV TFRMW LG +SC LLSFLNQFF YRTEPL IT
Sbjct  6     ESYDDDVSPIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVIT  65

Query  333   AISAQIAVVPLGQLMAARITDRVF----FRGTKWEFTLNPGPFNVKEHVLITIFANSGA-  497
              I+ Q+A +P+G  +A  +    F    F  T+  F+LNPGPFN+KEHVLI+IFAN+G+ 
Sbjct  66    QITVQVATLPIGHFLAKVLPKTQFGIPGFGSTR--FSLNPGPFNMKEHVLISIFANAGSA  123

Query  498   ---GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLVEPAAMWWPA  668
                G+ YA+ +VT +K FY K+I+F    ++++TTQVLG+GWAG+ R+Y+VEPA MWWP+
Sbjct  124   FGSGSAYAVGIVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  183

Query  669   NLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWFFP  848
              LVQVSLFRALHEK+E+    +TR +FFVIA +CSF +Y+ PGYLF  LTS+SWICW FP
Sbjct  184   TLVQVSLFRALHEKDEQR---MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFP  240

Query  849   RSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFLILYVFTPIF  1028
             RSV AQQ+GSG++GLG+GA  LDW++++S+L SPL SP+FA AN+ +G+ L++Y+  P+ 
Sbjct  241   RSVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLS  300

Query  1029  YWC-DVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYLSTFFALTY  1205
             YW  D +NA  FPIFS  LFTS GQTY+I AI++  F LDL  Y+Q+G++ LSTFFA+TY
Sbjct  301   YWGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRINLSTFFAMTY  360

Query  1206  GVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWWFWCILVAN  1385
             G+GFA + +TL HV LF+GREI E+ + S+K ++ D+HTRLM +Y+ +P WWF+ +L A 
Sbjct  361   GLGFATIASTLTHVALFYGREITERFRVSYKGKE-DVHTRLMKRYKDIPSWWFYSMLGAT  419

Query  1386  IALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNIITEyiigyi  1565
             + +++  C +  +Q+Q+PWWG++ A  +A IFTLPI IITA TNQTPGLNIITEY +G I
Sbjct  420   LLISLALCVFLNDQVQMPWWGLVFASAMAFIFTLPISIITATTNQTPGLNIITEYAMGII  479

Query  1566  ypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVIAGFVYLGT  1745
             YPG P+AN+CFKVYGY+SM QA++FL DFKLGHYMKIPPR+MF+ Q +GT++AG + +  
Sbjct  480   YPGRPIANVCFKVYGYMSMAQAVSFLNDFKLGHYMKIPPRSMFLVQFIGTILAGTINITV  539

Query  1746  AWWLMETIPEICQTT--ATNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYEAVNWFF  1919
             AWW + TI  ICQ      N+ WTCP D VF+DASVIWGL+GP+RIFG  G Y A+NWFF
Sbjct  540   AWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFF  599

Query  1920  LAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIVGFLSGYVV  2099
             L GAI PV+VWL  KAFP   WI L+N+PVL+ AT+ MPPATAVNY +WI+VG +    V
Sbjct  600   LGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGTIFNLFV  659

Query  2100  FRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWGNDLDGCPYASCPSAK  2279
             FRYR   WQR+NYVLS A+DAG+AFM VLLY  +G+E+ SL+WWG   + C  A CP+A+
Sbjct  660   FRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRGEHCDLARCPTAR  719

Query  2280  GIIVEGCPVI  2309
             G+IV+GCPV+
Sbjct  720   GVIVKGCPVV  729



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/759 (56%), Positives = 562/759 (74%), Gaps = 18/759 (2%)
 Frame = +3

Query  60    EIKTPLLPKVEEYEGRHGFASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLT  239
             EI+ P          +H   S     VE      ++E SPI +V LTV  TDDP+LPV T
Sbjct  2     EIQAPHPITKSSDPEKHDATSGGNHDVE------DDEISPIEQVRLTVTNTDDPTLPVWT  55

Query  240   FRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVFFR---  410
             FRMW LG  SC LLSFLNQFF YRTEPL IT I+ Q++ +P+G  MA+ +    F     
Sbjct  56    FRMWFLGLFSCALLSFLNQFFSYRTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGF  115

Query  411   GTKWEFTLNPGPFNVKEHVLITIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLI  578
             G+K  F+LNPGPFN+KEHVLI IFAN+G+    G+ YA+ +V  +K FYG++I+F    +
Sbjct  116   GSK-RFSLNPGPFNMKEHVLICIFANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWL  174

Query  579   IVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVI  758
             +++TTQVLG+GWAG+ R+Y+VEPA MWWP+ LVQVSLFRALHEK+++    +TR +FF+I
Sbjct  175   LIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLI  234

Query  759   AFICSFAYYVFPGYLFQMLTSLSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSY  938
               ICSF +Y+ PGYLF  LTS+SWICW F +SV AQQ+GSGL+GLG+GA  LDWS+++S+
Sbjct  235   ILICSFVWYLVPGYLFTTLTSISWICWIFSKSVTAQQIGSGLKGLGLGAFTLDWSAVASF  294

Query  939   LGSPLASPWFATANIAVGFFLILYVFTPIFYW-CDVFNAKTFPIFSDELFTSSGQTYNIS  1115
             L SPL SP+FA AN+ VG+ LI+Y+  P+ YW  D++NA  FPIFS  LFT+ GQ YNI+
Sbjct  295   LFSPLISPFFAIANVFVGYVLIIYIAIPVAYWGLDLYNASRFPIFSSHLFTAQGQKYNIT  354

Query  1116  AIIDSNFHLDLEAYDQEGKLYLSTFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSF  1295
             AI++  F +DL  Y+++G++ LS FFALTYG GFA + +T+ HV LF+GREI+++ ++S 
Sbjct  355   AIVNDKFEIDLAKYEEQGRINLSMFFALTYGFGFATIASTMTHVALFYGREIYDRYRASH  414

Query  1296  KDRKMDIHTRLMSKYRQVPEWWFWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAI  1475
               ++ DIHTRLM KY+ +P WWF+ +L A   +++  C +  +Q+Q+PWWG+L A  +A 
Sbjct  415   TGKE-DIHTRLMRKYKDIPSWWFYALLAATFVVSLVLCIFLNDQVQMPWWGLLFAGAMAF  473

Query  1476  IFTLPIGIITAITNQTPGLNIITEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFK  1655
             IFTLPI IITA TNQTPGLNIITEY++G IYPG P+AN+CFK YGY+SM QA++FL DFK
Sbjct  474   IFTLPISIITATTNQTPGLNIITEYVMGLIYPGRPIANVCFKTYGYMSMAQAVSFLNDFK  533

Query  1656  LGHYMKIPPRTMFMAQVVGTVIAGFVYLGTAWWLMETIPEICQTT--ATNTVWTCPSDHV  1829
             LGHYMKIPPR+MF+ Q +GT++AG + +  AWWL+ +I  ICQ      N+ WTCP D V
Sbjct  534   LGHYMKIPPRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPANSPWTCPGDRV  593

Query  1830  FYDASVIWGLIGPRRIFGDLGTYEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPV  2009
             F+DASVIWGL+GP+RIFG LG Y A+NWFFL GA+ PV+VWL  K FP Q WI LIN+PV
Sbjct  594   FFDASVIWGLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPV  653

Query  2010  LISATSNMPPATAVNYTTWIIVGFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLL  2189
             L+ AT  MPPAT +NY  WI+VG +  + VFRYR   WQR+NY+LS ALDAG+AFM +LL
Sbjct  654   LLGATGMMPPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILL  713

Query  2190  YLCLGLENVSLNWWGNDLDGCPYASCPSAKGIIVEGCPV  2306
             Y  +G+EN S+ WWG + + C  A+CP+AKGI+V+GCPV
Sbjct  714   YFSVGMENRSVTWWGTEGEHCELATCPTAKGIMVDGCPV  752



>ref|XP_002967106.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
 gb|EFJ31705.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
Length=739

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/738 (58%), Positives = 554/738 (75%), Gaps = 11/738 (1%)
 Frame = +3

Query  117   ASSSKSKVESLPEAAEEENSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQ  296
             A     + E     ++EE SPI +VALTV   DDPS PV TFRMW +G L+C +LSFLNQ
Sbjct  3     AGKRGEQEEEFHGDSKEEQSPIEQVALTVDVEDDPSQPVWTFRMWAIGILACAMLSFLNQ  62

Query  297   FFWYRTEPLTITAISAQIAVVPLGQLMAARITDRVF-FRGTKWEFTLNPGPFNVKEHVLI  473
             FF YRTEPL IT  SAQI  +P+G+ MAA +  R++    T +EF+LNPGPFN KEHVLI
Sbjct  63    FFSYRTEPLVITLTSAQIVALPIGRFMAAVLPTRIYRVPFTGFEFSLNPGPFNKKEHVLI  122

Query  474   TIFANSGA----GTVYAIHVVTAVKVFYGKHITFFVSLIIVLTTQVLGFGWAGIFRRYLV  641
             TIFAN+G+    G  YA+ +V  +K FY + I F+  L++V+TTQVLG+GWAG+ R++LV
Sbjct  123   TIFANAGSAFGNGGAYAVFIVDIIKAFYKRKIHFYTGLLLVITTQVLGYGWAGLLRKFLV  182

Query  642   EPAAMWWPANLVQVSLFRALHEKEERPKGGITRTQFFVIAFICSFAYYVFPGYLFQMLTS  821
             EPA+MWWP NLVQVSLF+ LH+KE     G+TR QFF+I     FAYY  PGYLF +L+S
Sbjct  183   EPASMWWPGNLVQVSLFKTLHDKESVK--GLTRIQFFLIFLTVGFAYYALPGYLFSVLSS  240

Query  822   LSWICWFFPRSVlaqqlgsglqglgigaiglDWSSISSYLGSPLASPWFATANIAVGFFL  1001
             +SW+CW FP SVLAQQLGSG QGLG+GAIGLDW+S SSYLGSPL SP+FA AN+AVG+ L
Sbjct  241   ISWVCWAFPNSVLAQQLGSGFQGLGLGAIGLDWASASSYLGSPLVSPFFAIANVAVGYIL  300

Query  1002  ILYVFTPIFYWCDVFNAKTFPIFSDELFTSSGQTYNISAIIDSNFHLDLEAYDQEGKLYL  1181
             I YV  P FYW +++NAKTFPIFS  LFTS GQ Y+I  +++  F LD+  Y ++G +++
Sbjct  301   IAYVMMPTFYWANIYNAKTFPIFSSHLFTSKGQIYDIQKVVNDKFELDMAEYQRQGPIHM  360

Query  1182  STFFALTYGVGFAALTATLVHVVLFHGREIWEQSKSSFKDRKMDIHTRLMSKYRQVPEWW  1361
             STFFA+TYG GFAA+ +T+ HV+ FHG++IW  S+S+ K    D+H R+M +Y  +P  W
Sbjct  361   STFFAMTYGFGFAAVASTITHVLCFHGKDIWRMSRSALKSPP-DVHARMMQRYPTIPNLW  419

Query  1362  FWCILVANIALTVFACEYYKEQLQLPWWGVLLACVIAIIFTLPIGIITAITNQTPGLNII  1541
             F  +++ ++ + +  C  +KEQ+QLPWWGV+L+C IA  FTLP+G+ITA TN TPGLNII
Sbjct  420   FVILMLVSLGVAIATCLGFKEQIQLPWWGVILSCAIAATFTLPVGVITATTNITPGLNII  479

Query  1542  TEyiigyiypgypVANMCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTVI  1721
             TEYI+GY+ PG P+AN+ FK YGY+SMTQA++FL DFKLGHYMKIPPR+MF  Q+VGT+I
Sbjct  480   TEYIVGYMLPGKPIANVVFKTYGYMSMTQALSFLSDFKLGHYMKIPPRSMFTVQIVGTII  539

Query  1722  AGFVYLGTAWWLMETIPEICQTTA--TNTVWTCPSDHVFYDASVIWGLIGPRRIFGDLGT  1895
             A  V +G AWWL+  I  IC T     ++ WTCPSD VF+DASVIWGL+GP+RIFG LG 
Sbjct  540   AATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGE  599

Query  1896  YEAVNWFFLAGAIAPVLVWLATKAFPGQEWIRLINMPVLISATSNMPPATAVNYTTWIIV  2075
             Y  ++WFFL G +AP+ VW+ ++A P  E++R +N+PV++ AT  MPPAT+VNYTTWI +
Sbjct  600   YSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITL  659

Query  2076  GFLSGYVVFRYRPDLWQRHNYVLSGALDAGLAFMGVLLYLCLGLENVSLNWWG-NDLDGC  2252
             G +  Y V++YR   W+R+NYVLS ALDAG AFM V+LY  LGLE+VSL WWG +D D C
Sbjct  660   GVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHC  719

Query  2253  PYASCPSAKGIIVEGCPV  2306
             P A CP+  GI+V+GCPV
Sbjct  720   PLAKCPTQPGIVVDGCPV  737



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8142878191968