BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c47746_g1_i1 len=533 path=[1:0-532]

Length=533
                                                                      Score     E

ref|XP_009595483.1|  PREDICTED: uncharacterized protein LOC104091775    211   2e-66   
ref|XP_009780959.1|  PREDICTED: uncharacterized protein LOC104229929    211   2e-66   
ref|XP_010326892.1|  PREDICTED: uncharacterized protein LOC104649430    197   5e-61   
ref|XP_006360364.1|  PREDICTED: uncharacterized protein LOC102589943    191   1e-58   
ref|XP_007224750.1|  hypothetical protein PRUPE_ppa024197mg             172   5e-51   
ref|XP_008342529.1|  PREDICTED: uncharacterized protein LOC103405338    171   1e-50   
ref|XP_009365486.1|  PREDICTED: uncharacterized protein LOC103955335    168   2e-49   
ref|XP_008368207.1|  PREDICTED: uncharacterized protein LOC103431818    164   8e-48   
ref|XP_011020698.1|  PREDICTED: uncharacterized protein LOC105122980    163   1e-47   
ref|XP_002297827.1|  self-incompatibility family protein                163   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007034478.1|  Plant self-incompatibility protein S1 family       162   5e-47   
ref|XP_009343409.1|  PREDICTED: uncharacterized protein LOC103935374    161   7e-47   
ref|XP_010650221.1|  PREDICTED: uncharacterized protein LOC100252771    161   7e-47   
ref|XP_004309597.1|  PREDICTED: uncharacterized protein LOC101298851    161   9e-47   
emb|CBI33341.3|  unnamed protein product                                159   3e-46   
ref|XP_002304696.1|  self-incompatibility family protein                159   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011002166.1|  PREDICTED: uncharacterized protein LOC105109234    158   8e-46   
ref|XP_010650246.1|  PREDICTED: uncharacterized protein LOC104879334    156   4e-45   
gb|KDP36439.1|  hypothetical protein JCGZ_09509                         157   4e-45   
gb|KGN56774.1|  hypothetical protein Csa_3G133250                       158   6e-45   
ref|XP_008438398.1|  PREDICTED: uncharacterized protein LOC103483...    157   6e-45   
ref|XP_004134017.1|  PREDICTED: uncharacterized protein LOC101218823    156   7e-45   
ref|XP_006420551.1|  hypothetical protein CICLE_v10006174mg             155   2e-44   
gb|EYU32616.1|  hypothetical protein MIMGU_mgv1a023482mg                154   3e-44   
ref|XP_010096914.1|  hypothetical protein L484_008282                   154   7e-44   
ref|XP_008460730.1|  PREDICTED: uncharacterized protein LOC103499491    152   4e-43   
ref|XP_008438399.1|  PREDICTED: uncharacterized protein LOC103483...    152   4e-43   
emb|CAN63635.1|  hypothetical protein VITISV_017182                     159   9e-43   Vitis vinifera
ref|XP_010069083.1|  PREDICTED: uncharacterized protein LOC104456063    150   1e-42   
ref|XP_004139019.1|  PREDICTED: uncharacterized protein LOC101209275    147   2e-41   
ref|XP_003594515.1|  hypothetical protein MTR_2g030080                  147   2e-41   
ref|NP_189048.1|  self-incompatibility S1 family protein                147   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486449.1|  PREDICTED: uncharacterized protein LOC101495365    146   5e-41   
ref|XP_002865598.1|  hypothetical protein ARALYDRAFT_331219             145   1e-40   
ref|XP_007147488.1|  hypothetical protein PHAVU_006G128700g             142   2e-39   
ref|XP_003547327.1|  PREDICTED: uncharacterized protein LOC100792052    142   2e-39   
ref|XP_003594517.1|  hypothetical protein MTR_2g030100                  140   1e-38   
ref|XP_010550841.1|  PREDICTED: uncharacterized protein LOC104821619    139   2e-38   
ref|XP_002883495.1|  hypothetical protein ARALYDRAFT_898978             139   4e-38   
ref|XP_010488501.1|  PREDICTED: uncharacterized protein LOC104766333    138   1e-37   
ref|XP_010466790.1|  PREDICTED: uncharacterized protein LOC104746939    137   2e-37   
ref|XP_010513251.1|  PREDICTED: uncharacterized protein LOC104789215    137   2e-37   
ref|XP_006299507.1|  hypothetical protein CARUB_v10015677mg             137   2e-37   
ref|XP_003534770.1|  PREDICTED: uncharacterized protein LOC100790348    135   6e-37   
ref|XP_010666187.1|  PREDICTED: uncharacterized protein LOC104883375    136   7e-37   
ref|XP_009106107.1|  PREDICTED: uncharacterized protein LOC103831913    135   1e-36   
ref|XP_006418796.1|  hypothetical protein EUTSA_v10003022mg             135   1e-36   
emb|CDY46340.1|  BnaC01g30300D                                          121   4e-31   
gb|EYU43800.1|  hypothetical protein MIMGU_mgv1a026584mg              80.9    8e-16   
gb|KDO39562.1|  hypothetical protein CISIN_1g042596mg                 77.0    1e-14   
gb|EYU43801.1|  hypothetical protein MIMGU_mgv1a018301mg              75.9    2e-14   
ref|XP_007034483.1|  Uncharacterized protein TCM_020416               73.6    3e-13   
ref|XP_002303912.1|  hypothetical protein POPTR_0003s20030g           71.2    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002518180.1|  conserved hypothetical protein                   70.9    3e-12   Ricinus communis
ref|XP_007034482.1|  Uncharacterized protein TCM_020415               69.7    7e-12   
ref|XP_002523926.1|  conserved hypothetical protein                   70.1    7e-12   Ricinus communis
ref|XP_002518178.1|  conserved hypothetical protein                   64.7    3e-10   Ricinus communis
ref|XP_002297829.1|  hypothetical protein POPTR_0001s14150g           63.9    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011002181.1|  PREDICTED: uncharacterized protein LOC105109247  62.8    2e-09   
ref|XP_010321600.1|  PREDICTED: uncharacterized protein LOC104647674  62.8    2e-09   
ref|XP_002518177.1|  conserved hypothetical protein                   62.8    2e-09   Ricinus communis
ref|XP_002518182.1|  conserved hypothetical protein                   62.8    2e-09   Ricinus communis
gb|EPS58024.1|  hypothetical protein M569_16794                       62.0    2e-09   
gb|KDO55824.1|  hypothetical protein CISIN_1g039071mg                 61.6    4e-09   
ref|XP_007034520.1|  Uncharacterized protein TCM_020442               62.0    5e-09   
ref|XP_006355757.1|  PREDICTED: uncharacterized protein LOC102589688  61.2    6e-09   
ref|XP_010245687.1|  PREDICTED: pumilio homolog 15-like               60.5    9e-09   
ref|XP_006340968.1|  PREDICTED: uncharacterized protein LOC102582688  60.5    1e-08   
ref|XP_010317606.1|  PREDICTED: uncharacterized protein LOC104646150  60.1    2e-08   
ref|XP_006442166.1|  hypothetical protein CICLE_v10023262mg           58.5    2e-08   
gb|EYU27292.1|  hypothetical protein MIMGU_mgv1a026865mg              60.1    2e-08   
ref|XP_006420550.1|  hypothetical protein CICLE_v10007007mg           58.2    4e-08   
ref|XP_007200013.1|  hypothetical protein PRUPE_ppa024656mg           58.5    4e-08   
ref|XP_002518181.1|  conserved hypothetical protein                   58.5    6e-08   Ricinus communis
gb|KDP44347.1|  hypothetical protein JCGZ_19214                       58.5    6e-08   
ref|XP_002523927.1|  conserved hypothetical protein                   57.8    9e-08   Ricinus communis
gb|KDP33370.1|  hypothetical protein JCGZ_12919                       56.6    3e-07   
ref|XP_009623632.1|  PREDICTED: uncharacterized protein LOC104114805  56.6    3e-07   
ref|XP_010321598.1|  PREDICTED: uncharacterized protein LOC104647671  56.2    3e-07   
ref|XP_010096912.1|  hypothetical protein L484_008280                 55.8    4e-07   
gb|KEH41902.1|  leguminosin group486 secreted peptide                 55.8    4e-07   
ref|XP_004309599.1|  PREDICTED: uncharacterized protein LOC101299438  55.8    4e-07   
gb|EYU43812.1|  hypothetical protein MIMGU_mgv1a024379mg              55.8    5e-07   
ref|XP_009372346.1|  PREDICTED: uncharacterized protein LOC103961515  55.5    7e-07   
ref|XP_008235750.1|  PREDICTED: uncharacterized protein LOC103334549  55.1    8e-07   
ref|XP_009800635.1|  PREDICTED: uncharacterized protein LOC104246522  54.7    9e-07   
gb|ACU31815.1|  self-incompatibility protein                          54.3    1e-06   Platystemon californicus [cream cups]
ref|XP_004139726.1|  PREDICTED: uncharacterized protein LOC101206205  54.7    1e-06   
ref|XP_008458117.1|  PREDICTED: uncharacterized protein LOC103497646  54.3    1e-06   
gb|KEH41903.1|  leguminosin group486 secreted peptide                 53.9    1e-06   
ref|XP_007200792.1|  hypothetical protein PRUPE_ppa024473mg           54.3    1e-06   
ref|XP_007163970.1|  hypothetical protein PHAVU_L001700g              53.9    2e-06   
gb|ACU31814.1|  self-incompatibility protein                          53.9    2e-06   Platystemon californicus [cream cups]
ref|XP_004154487.1|  PREDICTED: uncharacterized protein LOC101226577  53.9    2e-06   
ref|XP_007041600.1|  Plant self-incompatibility protein S1 family...  53.9    2e-06   
ref|XP_011100197.1|  PREDICTED: uncharacterized protein LOC105178433  57.0    2e-06   
ref|XP_007163969.1|  hypothetical protein PHAVU_L001600g              53.9    2e-06   
ref|XP_007034481.1|  Plant self-incompatibility protein S1 family...  53.5    2e-06   
ref|XP_008466659.1|  PREDICTED: uncharacterized protein LOC103504014  53.5    3e-06   
ref|XP_007132764.1|  hypothetical protein PHAVU_011G123100g           53.1    4e-06   
ref|XP_002532042.1|  conserved hypothetical protein                   53.1    4e-06   Ricinus communis
gb|ACV41067.1|  self-incompatibility protein                          52.4    4e-06   Platystemon californicus [cream cups]
gb|KDO55826.1|  hypothetical protein CISIN_1g039189mg                 52.8    4e-06   
ref|XP_006841528.1|  hypothetical protein AMTR_s00003p00152430        52.8    4e-06   
gb|EYU25357.1|  hypothetical protein MIMGU_mgv1a025761mg              52.8    5e-06   
ref|XP_004139722.1|  PREDICTED: uncharacterized protein LOC101205020  52.8    5e-06   
ref|XP_004164445.1|  PREDICTED: uncharacterized protein LOC101226385  52.8    5e-06   
ref|XP_004494009.1|  PREDICTED: uncharacterized protein LOC101507373  52.8    6e-06   
ref|XP_006361278.1|  PREDICTED: uncharacterized protein LOC102588639  52.8    6e-06   
gb|EYU39652.1|  hypothetical protein MIMGU_mgv1a022491mg              52.0    8e-06   
ref|XP_002301828.2|  hypothetical protein POPTR_0002s25380g           52.4    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002521143.1|  conserved hypothetical protein                   52.0    1e-05   Ricinus communis
ref|XP_011042558.1|  PREDICTED: uncharacterized protein LOC105138215  52.4    1e-05   
gb|EYU39676.1|  hypothetical protein MIMGU_mgv1a021328mg              52.0    1e-05   
ref|XP_004136435.1|  PREDICTED: uncharacterized protein LOC101208617  51.6    1e-05   
ref|XP_004154484.1|  PREDICTED: uncharacterized protein LOC101225891  51.6    1e-05   
ref|XP_009611687.1|  PREDICTED: uncharacterized protein LOC104105143  51.6    1e-05   
ref|XP_008372611.1|  PREDICTED: uncharacterized protein LOC103435959  52.8    1e-05   
ref|XP_004165662.1|  PREDICTED: uncharacterized protein LOC101227752  51.6    2e-05   
ref|XP_010043344.1|  PREDICTED: uncharacterized protein LOC104432574  51.2    2e-05   
ref|XP_002297828.1|  hypothetical protein POPTR_0001s14160g           51.2    2e-05   Populus trichocarpa [western balsam poplar]
gb|EYU31747.1|  hypothetical protein MIMGU_mgv1a025844mg              50.8    2e-05   
ref|XP_002521145.1|  conserved hypothetical protein                   51.2    2e-05   Ricinus communis
ref|XP_009372327.1|  PREDICTED: uncharacterized protein LOC103961497  51.2    2e-05   
ref|XP_002312833.1|  hypothetical protein POPTR_0009s16270g           51.2    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002521146.1|  conserved hypothetical protein                   51.2    2e-05   Ricinus communis
ref|XP_011084267.1|  PREDICTED: uncharacterized protein LOC105166571  50.8    2e-05   
ref|XP_006340966.1|  PREDICTED: uncharacterized protein LOC102582018  52.8    2e-05   
ref|XP_007163964.1|  hypothetical protein PHAVU_L001200g              51.2    2e-05   
ref|XP_007133349.1|  hypothetical protein PHAVU_011G171900g           51.2    2e-05   
ref|XP_002523920.1|  conserved hypothetical protein                   50.8    2e-05   Ricinus communis
gb|ACV41069.1|  self-incompatibility protein                          50.1    3e-05   Platystemon californicus [cream cups]
gb|KCW85351.1|  hypothetical protein EUGRSUZ_B02182                   51.2    3e-05   
ref|XP_010321599.1|  PREDICTED: uncharacterized protein LOC104647673  51.2    3e-05   
ref|XP_006420540.1|  hypothetical protein CICLE_v10006894mg           50.1    3e-05   
ref|XP_004136434.1|  PREDICTED: uncharacterized protein LOC101208376  50.8    3e-05   
gb|EYU39657.1|  hypothetical protein MIMGU_mgv1a025732mg              50.4    3e-05   
ref|XP_007049876.1|  S-protein, putative                              50.8    3e-05   
ref|XP_008235749.1|  PREDICTED: uncharacterized protein LOC103334548  50.4    4e-05   
ref|XP_006353389.1|  PREDICTED: uncharacterized protein LOC102595672  50.1    4e-05   
ref|XP_008462114.1|  PREDICTED: uncharacterized protein LOC103500542  50.4    4e-05   
gb|ACV41021.1|  self-incompatibility protein                          49.7    4e-05   Argemone munita
ref|XP_009779365.1|  PREDICTED: uncharacterized protein LOC104228586  50.1    4e-05   
gb|EYU38072.1|  hypothetical protein MIMGU_mgv1a025879mg              49.3    5e-05   
ref|XP_008461966.1|  PREDICTED: uncharacterized protein LOC103500444  52.0    5e-05   
ref|XP_007163968.1|  hypothetical protein PHAVU_L001500g              49.3    5e-05   
ref|XP_010040377.1|  PREDICTED: uncharacterized protein LOC104429177  50.1    5e-05   
ref|XP_004156927.1|  PREDICTED: pumilio homolog 15-like               50.1    5e-05   
ref|XP_008460739.1|  PREDICTED: uncharacterized protein LOC103499501  49.7    5e-05   
ref|XP_002521147.1|  conserved hypothetical protein                   50.1    5e-05   Ricinus communis
ref|XP_010321601.1|  PREDICTED: uncharacterized protein LOC104647675  49.7    5e-05   
ref|XP_002518161.1|  conserved hypothetical protein                   51.6    6e-05   Ricinus communis
ref|XP_002518174.1|  conserved hypothetical protein                   50.4    6e-05   Ricinus communis
ref|XP_009759835.1|  PREDICTED: uncharacterized protein LOC104212313  51.2    6e-05   
ref|XP_008462122.1|  PREDICTED: uncharacterized protein LOC103500551  50.1    6e-05   
ref|XP_002892233.1|  hypothetical protein ARALYDRAFT_470450           49.3    7e-05   
ref|XP_009800927.1|  PREDICTED: uncharacterized protein LOC104246751  49.7    7e-05   
ref|XP_003618906.1|  Self-incompatibility protein                     49.3    7e-05   
ref|XP_006388234.1|  hypothetical protein POPTR_0271s00210g           49.7    7e-05   
ref|XP_007224861.1|  hypothetical protein PRUPE_ppa022801mg           49.7    7e-05   
ref|XP_010665289.1|  PREDICTED: uncharacterized protein LOC104882727  49.3    7e-05   
ref|XP_008462119.1|  PREDICTED: uncharacterized protein LOC103500549  49.7    7e-05   
ref|XP_009623137.1|  PREDICTED: uncharacterized protein LOC104114396  49.7    7e-05   
gb|EYU31414.1|  hypothetical protein MIMGU_mgv1a020336mg              48.9    7e-05   
ref|XP_010245689.1|  PREDICTED: pumilio homolog 15-like               49.3    8e-05   
ref|XP_010273172.1|  PREDICTED: pumilio homolog 15-like               49.3    8e-05   
ref|XP_011024805.1|  PREDICTED: uncharacterized protein LOC105125855  49.7    8e-05   
ref|XP_008445791.1|  PREDICTED: uncharacterized protein LOC103488715  49.3    9e-05   
ref|XP_004244677.2|  PREDICTED: uncharacterized protein LOC101247144  48.9    9e-05   
gb|EYU39687.1|  hypothetical protein MIMGU_mgv1a024801mg              48.9    9e-05   
gb|KCW45273.1|  hypothetical protein EUGRSUZ_L01080                   50.1    9e-05   
ref|XP_009766249.1|  PREDICTED: uncharacterized protein LOC104217648  49.3    1e-04   
ref|XP_010319896.1|  PREDICTED: uncharacterized protein LOC104647034  49.3    1e-04   
ref|XP_010321411.1|  PREDICTED: uncharacterized protein LOC104647567  48.5    1e-04   
gb|EYU39659.1|  hypothetical protein MIMGU_mgv1a021533mg              48.1    1e-04   
ref|XP_009800634.1|  PREDICTED: uncharacterized protein LOC104246521  49.3    1e-04   
ref|XP_002892231.1|  hypothetical protein ARALYDRAFT_887637           48.9    1e-04   
ref|XP_006361275.1|  PREDICTED: uncharacterized protein LOC102587663  48.5    1e-04   
ref|XP_011004341.1|  PREDICTED: uncharacterized protein LOC105110858  48.9    1e-04   
ref|XP_004486317.1|  PREDICTED: uncharacterized protein LOC101504627  48.5    1e-04   
ref|XP_004149973.1|  PREDICTED: uncharacterized protein LOC101222271  48.5    1e-04   
gb|EYU31435.1|  hypothetical protein MIMGU_mgv1a020461mg              48.1    1e-04   
ref|XP_007200064.1|  hypothetical protein PRUPE_ppa022213mg           48.5    2e-04   
ref|XP_007225045.1|  hypothetical protein PRUPE_ppa019850mg           48.5    2e-04   
ref|XP_002322770.2|  hypothetical protein POPTR_0016s06720g           48.9    2e-04   Populus trichocarpa [western balsam poplar]
gb|EYU39656.1|  hypothetical protein MIMGU_mgv1a018626mg              48.5    2e-04   
ref|XP_011084392.1|  PREDICTED: uncharacterized protein LOC105166650  48.5    2e-04   
ref|XP_008462115.1|  PREDICTED: uncharacterized protein LOC103500543  48.5    2e-04   
ref|XP_008462118.1|  PREDICTED: pumilio homolog 15-like               48.5    2e-04   
ref|XP_008462113.1|  PREDICTED: pumilio homolog 15-like               48.5    2e-04   
ref|XP_004160477.1|  PREDICTED: uncharacterized LOC101222271          48.5    2e-04   
gb|KHN40154.1|  hypothetical protein glysoja_028775                   48.5    2e-04   
ref|XP_007224663.1|  hypothetical protein PRUPE_ppa026119mg           48.1    2e-04   
gb|KDP44437.1|  hypothetical protein JCGZ_16270                       48.5    2e-04   
ref|XP_008372609.1|  PREDICTED: uncharacterized protein LOC103435958  47.8    2e-04   
gb|KDP35223.1|  hypothetical protein JCGZ_09382                       48.1    2e-04   
ref|XP_011020981.1|  PREDICTED: uncharacterized protein LOC105123170  48.5    2e-04   
ref|XP_006574262.1|  PREDICTED: uncharacterized protein LOC102664660  48.5    2e-04   
ref|XP_008342625.1|  PREDICTED: uncharacterized protein LOC103405400  48.1    2e-04   
gb|KHN40158.1|  hypothetical protein glysoja_028779                   48.5    2e-04   
ref|XP_006573437.1|  PREDICTED: pumilio homolog 15-like               48.5    2e-04   
ref|XP_010326887.1|  PREDICTED: uncharacterized protein LOC104649425  48.1    2e-04   
ref|XP_009606986.1|  PREDICTED: uncharacterized protein LOC104101243  48.1    3e-04   
ref|XP_010243875.1|  PREDICTED: pumilio homolog 15-like               48.1    3e-04   
ref|XP_006420553.1|  hypothetical protein CICLE_v10007012mg           47.8    3e-04   
gb|EYU39658.1|  hypothetical protein MIMGU_mgv1a026733mg              48.1    3e-04   
ref|XP_009618539.1|  PREDICTED: uncharacterized protein LOC104110703  47.8    3e-04   
ref|XP_006295524.1|  hypothetical protein CARUB_v10024629mg           48.1    3e-04   
ref|XP_006573436.1|  PREDICTED: uncharacterized protein LOC102666420  48.1    3e-04   
ref|XP_008465559.1|  PREDICTED: uncharacterized protein LOC103503190  47.4    3e-04   
ref|XP_004142571.1|  PREDICTED: uncharacterized protein LOC101202846  47.8    3e-04   
gb|KDP27635.1|  hypothetical protein JCGZ_19640                       47.8    3e-04   
ref|XP_007139846.1|  hypothetical protein PHAVU_008G062800g           47.8    3e-04   
ref|XP_010313486.1|  PREDICTED: uncharacterized protein LOC104644783  47.4    3e-04   
ref|XP_006480253.1|  PREDICTED: uncharacterized protein LOC102617969  48.1    3e-04   
ref|XP_006487620.1|  PREDICTED: uncharacterized protein LOC102623103  47.4    4e-04   
ref|XP_002509911.1|  conserved hypothetical protein                   47.8    4e-04   Ricinus communis
ref|XP_007133310.1|  hypothetical protein PHAVU_011G168800g           47.8    4e-04   
ref|XP_010326891.1|  PREDICTED: uncharacterized protein LOC104649429  47.4    4e-04   
ref|XP_006443668.1|  hypothetical protein CICLE_v10024107mg           47.4    4e-04   
ref|XP_007133445.1|  hypothetical protein PHAVU_011G179400g           47.8    4e-04   
ref|XP_011020980.1|  PREDICTED: uncharacterized protein LOC105123169  47.4    4e-04   
gb|KDP44435.1|  hypothetical protein JCGZ_16268                       47.0    5e-04   
ref|XP_004139725.1|  PREDICTED: uncharacterized protein LOC101205959  47.4    5e-04   
ref|XP_004154486.1|  PREDICTED: pumilio homolog 15-like               47.4    5e-04   
gb|EYU32666.1|  hypothetical protein MIMGU_mgv11b022741mg             47.4    6e-04   
ref|XP_004142537.1|  PREDICTED: uncharacterized protein LOC101214402  47.0    6e-04   
ref|XP_006360979.1|  PREDICTED: uncharacterized protein LOC102593305  47.0    6e-04   
ref|XP_002517051.1|  conserved hypothetical protein                   47.0    6e-04   Ricinus communis
ref|XP_008460741.1|  PREDICTED: uncharacterized protein LOC103499504  47.0    6e-04   
ref|XP_008223933.1|  PREDICTED: uncharacterized protein LOC103323706  47.0    6e-04   
ref|XP_006595359.1|  PREDICTED: uncharacterized protein LOC102661112  47.8    6e-04   
ref|XP_010248454.1|  PREDICTED: uncharacterized protein LOC104591361  46.2    7e-04   
ref|XP_004491373.1|  PREDICTED: uncharacterized protein LOC101494747  46.6    7e-04   
gb|ACU31824.1|  self-incompatibility protein                          46.6    8e-04   Argemone munita
gb|ACV41033.1|  self-incompatibility protein                          46.2    8e-04   Argemone munita
ref|XP_006420549.1|  hypothetical protein CICLE_v10006952mg           46.2    8e-04   
ref|XP_010644707.1|  PREDICTED: uncharacterized protein LOC104877643  47.4    8e-04   
ref|XP_004139731.1|  PREDICTED: pumilio homolog 15-like               46.6    9e-04   
ref|XP_006420538.1|  hypothetical protein CICLE_v10006715mg           46.2    9e-04   
ref|XP_007141224.1|  hypothetical protein PHAVU_008G177700g           46.2    0.001   
ref|XP_006384775.1|  hypothetical protein POPTR_0004s20990g           47.0    0.001   
ref|XP_006406786.1|  hypothetical protein EUTSA_v10022389mg           46.6    0.001   
ref|XP_006341205.1|  PREDICTED: uncharacterized protein LOC102579165  46.6    0.001   



>ref|XP_009595483.1| PREDICTED: uncharacterized protein LOC104091775 [Nicotiana tomentosiformis]
Length=142

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            I LLI+G+A+Y+  I   QP  YFGN+Y VHIINGFTNNSSLPLVVWC+SGD  DIGGRA
Sbjct  6    IFLLILGLASYVTFISIKQPYDYFGNIYNVHIINGFTNNSSLPLVVWCSSGDTGDIGGRA  65

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            LQERDDFSWSVK   W N  + CTMK DQ+RR+F AF   RDV RCSPT++CFWLVKEDG
Sbjct  66   LQERDDFSWSVKTKFWKNSQYVCTMKLDQKRRRFQAFYGSRDVQRCSPTKQCFWLVKEDG  125

Query  109  FYFSVDGINWRKDFSWM  59
            FYFS D I W+KDFSW+
Sbjct  126  FYFSNDEIYWQKDFSWI  142



>ref|XP_009780959.1| PREDICTED: uncharacterized protein LOC104229929 [Nicotiana sylvestris]
Length=142

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
             I LL++G+A+Y+  I   QP  YFGN+Y VHIINGFTNNSSLPLVVWC+SGD  DIGGR
Sbjct  5    NIFLLMLGLASYVTFISIRQPYDYFGNIYDVHIINGFTNNSSLPLVVWCSSGDTGDIGGR  64

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQERDDFSWSVK   W N  + CTMK DQ+RR+F AF  GRDV RCSPT++CFWLVKED
Sbjct  65   ALQERDDFSWSVKTKFWKNSQYLCTMKLDQKRRRFQAFYGGRDVQRCSPTKQCFWLVKED  124

Query  112  GFYFSVDGINWRKDFSWM  59
            GFYFS D I W+KDFSW+
Sbjct  125  GFYFSNDEIYWQKDFSWI  142



>ref|XP_010326892.1| PREDICTED: uncharacterized protein LOC104649430 [Solanum lycopersicum]
Length=145

 Score =   197 bits (502),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVST-QPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
             IL +++G+A Y+  ++S  QPD YF  +Y +HIINGFTNNSS+PLVVWC S D  D+GG
Sbjct  5    VILFIMLGLACYLMTLISIIQPDDYFEKIYNIHIINGFTNNSSVPLVVWCISSDNVDLGG  64

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            RALQERD+FSWSVK + W N  F CTMKFD QRR F AF + RD+ RC PTR CFWLVKE
Sbjct  65   RALQERDEFSWSVKSTFWKNTKFLCTMKFDNQRRSFQAFQRRRDIQRCYPTRECFWLVKE  124

Query  115  DGFYFSVDGINWRKDFSW  62
            DGFY+S D I WRKDF+W
Sbjct  125  DGFYYSNDEIYWRKDFNW  142



>ref|XP_006360364.1| PREDICTED: uncharacterized protein LOC102589943 [Solanum tuberosum]
Length=128

 Score =   191 bits (484),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            +ALI   QPD YF   Y +HIINGFTNNSS+PLVVWC S D  D+GGRALQERD+FSWSV
Sbjct  1    MALISINQPDDYFEKNYNIHIINGFTNNSSVPLVVWCISSDNVDLGGRALQERDEFSWSV  60

Query  256  KPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWR  77
            K + W N  FSCTMKFD QRR F AF + RD+ RC PTR CFWLVKEDGFY+S D I WR
Sbjct  61   KSTFWKNTQFSCTMKFDNQRRSFQAFQRRRDIQRCYPTRECFWLVKEDGFYYSNDEIYWR  120

Query  76   KDFSW  62
            KDF+W
Sbjct  121  KDFNW  125



>ref|XP_007224750.1| hypothetical protein PRUPE_ppa024197mg [Prunus persica]
 ref|XP_008223992.1| PREDICTED: uncharacterized protein LOC103323760 [Prunus mume]
 gb|EMJ25949.1| hypothetical protein PRUPE_ppa024197mg [Prunus persica]
Length=141

 Score =   172 bits (435),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T +LLI G+A+++  +   QP  ++G  Y + +INGFTNNSSLPLV+WC S + +D+GGR
Sbjct  5    TSILLICGLASFVIFMSILQPQNFYGIEYDIRVINGFTNNSSLPLVIWCAS-EHSDLGGR  63

Query  292  ALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            ALQE DDFSWS++ + W TN  F CTMK+D+ RR F AF   RD  RC P R+C WLV+E
Sbjct  64   ALQEHDDFSWSLRTNFWGTNDHFKCTMKWDRTRRSFEAFKAPRDTQRCGPFRKCSWLVRE  123

Query  115  DGFYFSVDGINWRKDFSW  62
            DGFYFS D +NWRKDFSW
Sbjct  124  DGFYFSNDEVNWRKDFSW  141



>ref|XP_008342529.1| PREDICTED: uncharacterized protein LOC103405338 [Malus domestica]
Length=142

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T +LLI  +A ++  +   +P  ++G  Y + ++NGFTNNSSLPLV+WC S + +D+GGR
Sbjct  5    TSILLIFSLAFFVICMSILEPQNFYGTEYNIRVVNGFTNNSSLPLVIWCASQN-SDLGGR  63

Query  292  ALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            ALQE DDFSWS++ SLW T  LF CTMK+D+ RR F AF   RD+ RC P R+C WLV+E
Sbjct  64   ALQEHDDFSWSLRTSLWGTTDLFKCTMKWDRIRRSFEAFKASRDIQRCGPFRKCSWLVRE  123

Query  115  DGFYFSVDGINWRKDFSWM  59
            DGFYFS D +NW+KDFSW+
Sbjct  124  DGFYFSNDEVNWKKDFSWL  142



>ref|XP_009365486.1| PREDICTED: uncharacterized protein LOC103955335 [Pyrus x bretschneideri]
Length=142

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T +LLI  +A  +  +   +P  ++   Y V ++NGFTNNSSLPLV+WC S + +D+GGR
Sbjct  5    TSILLIFALAFVVICMSILEPQNFYSTEYNVRVVNGFTNNSSLPLVIWCASQN-SDLGGR  63

Query  292  ALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            ALQE DDFSWS++ SLW T  LF CTMK+D+ RR F AF   RD+ RC P R+C WLV+E
Sbjct  64   ALQEHDDFSWSLRTSLWGTTDLFKCTMKWDRIRRSFEAFKASRDIQRCGPLRKCSWLVRE  123

Query  115  DGFYFSVDGINWRKDFSWM  59
            DGFYFS D +NW++DFSW+
Sbjct  124  DGFYFSNDEVNWKRDFSWL  142



>ref|XP_008368207.1| PREDICTED: uncharacterized protein LOC103431818 [Malus domestica]
Length=141

 Score =   164 bits (414),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            T TI+LL+  +A ++ + +S +P  ++G  Y V +INGFTNNSSLPLV+WC S   +D+G
Sbjct  3    TLTIILLLCVLAFFV-ICMSIEPHNFYGTEYNVRVINGFTNNSSLPLVIWCAS-QHSDLG  60

Query  298  GRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            GRALQE +DFSWS++ +LW T   F CTMK+D+ RR F AF   RD  RC P R+C WLV
Sbjct  61   GRALQEHEDFSWSLRTNLWGTTDRFKCTMKWDRIRRSFEAFKAPRDFQRCGPFRKCSWLV  120

Query  121  KEDGFYFSVDGINWRKDFSWM  59
            +EDGFYFS D ++W+KDFSW+
Sbjct  121  REDGFYFSNDEVSWKKDFSWL  141



>ref|XP_011020698.1| PREDICTED: uncharacterized protein LOC105122980 [Populus euphratica]
Length=141

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T + L+V +A  I  + + QP+ ++G  Y V +INGF NNSSLPLV+WC+S +  D+GGR
Sbjct  5    TNIFLLVSLAIGIIFMSTYQPEYFYGLEYDVRVINGFRNNSSLPLVIWCSSNND-DLGGR  63

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDFSWS+K S W    F CTMK+D  RRKF AF   RD+ RCS  R+C W V+ED
Sbjct  64   ALQEGDDFSWSLKTSFWGTTHFLCTMKWDAMRRKFDAFKVPRDLQRCSLFRKCSWSVRED  123

Query  112  GFYFSVDGINWRKDFSWM  59
            GFYFS D +NW+KDFSW+
Sbjct  124  GFYFSNDEVNWKKDFSWL  141



>ref|XP_002297827.1| self-incompatibility family protein [Populus trichocarpa]
 gb|EEE82632.1| self-incompatibility family protein [Populus trichocarpa]
Length=141

 Score =   163 bits (412),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T + L+V +A  +  +   QP+ + G  Y V +INGFTNNSSLPLV+WC+S D  D+GGR
Sbjct  5    TKIFLVVSLAIGMIFMSIYQPEYFCGLEYDVRVINGFTNNSSLPLVIWCSS-DSDDLGGR  63

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDFSW ++ + W +  F CTMK+D  RRKF AF   RD+ RCSP R C WLV+ED
Sbjct  64   ALQEGDDFSWRLQINFWCSNHFRCTMKWDAMRRKFDAFKVPRDLQRCSPFRMCSWLVRED  123

Query  112  GFYFSVDGINWRKDFSWM  59
            GFYFS D +NW+KDFSW+
Sbjct  124  GFYFSNDEVNWKKDFSWL  141



>ref|XP_007034478.1| Plant self-incompatibility protein S1 family [Theobroma cacao]
 gb|EOY05404.1| Plant self-incompatibility protein S1 family [Theobroma cacao]
Length=169

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T +L++  +A  I  +   QP+ +FG  Y V +INGF+NNSSLPLV+WC S    D+GGR
Sbjct  32   TRVLIMFCVAVGIIFMSVYQPEHFFGMEYEVRVINGFSNNSSLPLVIWCISQQDGDMGGR  91

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDF W +K ++W N  + CT+K+D +RR F AF   RD  RC+P ++C WLVKED
Sbjct  92   ALQEGDDFGWRLKTNIWGNSHYLCTLKWDAKRRSFDAFKVPRDSQRCAPLKKCSWLVKED  151

Query  112  GFYFSVDGINWRKDFSW  62
            GFYFS D +NW+KDFSW
Sbjct  152  GFYFSSDEVNWKKDFSW  168



>ref|XP_009343409.1| PREDICTED: uncharacterized protein LOC103935374 [Pyrus x bretschneideri]
Length=141

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 103/141 (73%), Gaps = 3/141 (2%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            T T +LL+  +A ++ + +S +P  ++G  Y V +INGFTNNSSLPLV+WC S   +D+G
Sbjct  3    TLTSILLLCVLAFFV-ICMSIEPHNFYGTEYNVRVINGFTNNSSLPLVIWCAS-QHSDLG  60

Query  298  GRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            GRALQE +DFSWS++ +LW T   F CTMK+D+ RR F AF   RD  RC P R+C WLV
Sbjct  61   GRALQEHEDFSWSLRTNLWGTTDRFKCTMKWDRIRRSFEAFKAPRDFQRCGPFRKCSWLV  120

Query  121  KEDGFYFSVDGINWRKDFSWM  59
            +EDGFYFS D ++W+KDFSW+
Sbjct  121  REDGFYFSNDEVSWKKDFSWL  141



>ref|XP_010650221.1| PREDICTED: uncharacterized protein LOC100252771 [Vitis vinifera]
Length=140

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
             LL+  +A +I  +   Q + + G  Y V I+NGFT+NSSL LV+WC S D  DIGGRAL
Sbjct  7    FLLMFLLAAFIIFMSLKQSENFSGAEYDVRIVNGFTDNSSLALVIWCTS-DNKDIGGRAL  65

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
            Q  DDFSWSVK +LW    F CTMK+D  R++F AF   RDV RC P R CFWLV+EDGF
Sbjct  66   QVGDDFSWSVKTNLWGATPFHCTMKWDATRKQFDAFQVQRDVQRCGPLRTCFWLVREDGF  125

Query  106  YFSVDGINWRKDFSW  62
            YFS D +NW+KDFSW
Sbjct  126  YFSNDQVNWKKDFSW  140



>ref|XP_004309597.1| PREDICTED: uncharacterized protein LOC101298851 [Fragaria vesca 
subsp. vesca]
Length=142

 Score =   161 bits (407),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            +L I G+A ++  +   +P    G  + V +INGFTNNSSLPLVVWC+S +  D+GGRAL
Sbjct  7    ILFICGLAFFVIFMSLLEPQNLLGTEFDVRVINGFTNNSSLPLVVWCSSKEN-DLGGRAL  65

Query  286  QERDDFSWSVKPSLWTNIL--FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            QE+DDFSW ++ + W +    F CTMK+D++RR+F AF   RD+ RC P R+C WLV+ED
Sbjct  66   QEKDDFSWRLRTNFWGSSYNHFVCTMKWDEKRRRFDAFKIPRDIQRCGPLRKCSWLVRED  125

Query  112  GFYFSVDGINWRKDFSW  62
            GFYFS D +NW+KDFSW
Sbjct  126  GFYFSNDEVNWKKDFSW  142



>emb|CBI33341.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T  LL+   +  I L+   Q   + G +Y V ++NGFT+NSSL LV+WC+S    D+GGR
Sbjct  5    TSFLLMFCFSLCIILMSFRQSQFFNGTIYDVRVVNGFTDNSSLVLVIWCSSQHN-DLGGR  63

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQ  DDFSWS+K +LW   LF CTMK+DQ+R  F AF   RD  RC+P R CFWLVKED
Sbjct  64   ALQAGDDFSWSLKTNLWATTLFHCTMKWDQRRTSFEAFQVQRDSQRCAPFRTCFWLVKED  123

Query  112  GFYFSVDGINWRKDFSW  62
            GFYFS D +NW+KDFSW
Sbjct  124  GFYFSNDQVNWKKDFSW  140



>ref|XP_002304696.1| self-incompatibility family protein [Populus trichocarpa]
 gb|EEE79675.1| self-incompatibility family protein [Populus trichocarpa]
Length=141

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            T + L+  +A  I  +   QP+ ++G  Y V +INGF NNSSLPLV+WC+S +  D+GGR
Sbjct  5    TNIFLVASLAIGIIFMSIYQPEYFYGLEYDVRVINGFKNNSSLPLVIWCSSNND-DLGGR  63

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDFSWS+K + W    F CTMK+D  RRKF AF   RD+ RCS  R+C W V+ED
Sbjct  64   ALQEGDDFSWSLKTNFWGTTHFLCTMKWDAMRRKFDAFKVPRDLQRCSLFRKCSWSVRED  123

Query  112  GFYFSVDGINWRKDFSWM  59
            GFYFS D +NW+KDFSW+
Sbjct  124  GFYFSNDEVNWKKDFSWL  141



>ref|XP_011002166.1| PREDICTED: uncharacterized protein LOC105109234 [Populus euphratica]
 ref|XP_011012223.1| PREDICTED: uncharacterized protein LOC105116524 [Populus euphratica]
Length=141

 Score =   158 bits (400),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQ  284
             L+V +A  +  +   QP+ + G  Y V +INGFTNNSSLPLV+WC+S D  D+GGRALQ
Sbjct  8    FLVVSLAIGMIFMSIYQPEYFCGLEYDVRVINGFTNNSSLPLVIWCSS-DSDDLGGRALQ  66

Query  283  ERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
            E DDFSW ++ + W +  F CTMK+D  RRKF AF   RD+ RCS  R+C WLV+EDGFY
Sbjct  67   EGDDFSWRLQINFWCSNHFWCTMKWDAMRRKFDAFTVPRDLQRCSLYRKCSWLVREDGFY  126

Query  103  FSVDGINWRKDFSWM  59
            FS D +NW+KDFSW+
Sbjct  127  FSNDEVNWKKDFSWL  141



>ref|XP_010650246.1| PREDICTED: uncharacterized protein LOC104879334 [Vitis vinifera]
Length=133

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -2

Query  460  LIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQE  281
            + VG  +    ++S Q   + G +Y V ++NGFT+NSSL LV+WC+S    D+GGRALQ 
Sbjct  1    MEVGDCSGFQRLLSWQSQFFNGTIYDVRVVNGFTDNSSLVLVIWCSSQHN-DLGGRALQA  59

Query  280  RDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
             DDFSWS+K +LW   LF CTMK+DQ+R  F AF   RD  RC+P R CFWLVKEDGFYF
Sbjct  60   GDDFSWSLKTNLWATTLFHCTMKWDQRRTSFEAFQVQRDSQRCAPFRTCFWLVKEDGFYF  119

Query  100  SVDGINWRKDFSW  62
            S D +NW+KDFSW
Sbjct  120  SNDQVNWKKDFSW  132



>gb|KDP36439.1| hypothetical protein JCGZ_09509 [Jatropha curcas]
Length=153

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
            + I+L+I  +A  I L    QP+ + G  Y V I+NGFTNNSSL LV+WC+S +  ++GG
Sbjct  16   KVIILVIFCLAITIILFSVYQPERFVGVEYDVRIVNGFTNNSSLALVIWCSS-EVEEMGG  74

Query  295  RALQERDDFSWSVKP-SLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
            RALQE DDFSWS K  SL TN  + CTMK+D++RRKF AF   RD++RCS  ++C+WLV+
Sbjct  75   RALQEGDDFSWSFKTNSLGTN-HYICTMKWDERRRKFDAFKIPRDIDRCSLFKKCYWLVR  133

Query  118  EDGFYFSVDGINWRKDFSW  62
            EDGFYFS D INW+KDFSW
Sbjct  134  EDGFYFSNDEINWKKDFSW  152



>gb|KGN56774.1| hypothetical protein Csa_3G133250 [Cucumis sativus]
Length=199

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = -2

Query  445  ATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFS  266
            AT+    + T  +  FG  Y V +INGFTNNSSLPLV+WC S DG DIGGRALQE DDFS
Sbjct  70   ATFDKKTIKTLKEQLFGIEYEVRVINGFTNNSSLPLVIWCASKDG-DIGGRALQEHDDFS  128

Query  265  WSVKPSLW---TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSV  95
            W VK + W   T   FSCT+K D+ R+ F AF   RD+ RCS  R+C WLV EDGFYFS 
Sbjct  129  WPVKTNFWITTTTSQFSCTVKLDRTRKSFDAFKVPRDIYRCSALRKCSWLVMEDGFYFSD  188

Query  94   DGINWRKDFSW  62
            D +NW+KDFSW
Sbjct  189  DEVNWKKDFSW  199



>ref|XP_008438398.1| PREDICTED: uncharacterized protein LOC103483510 isoform X1 [Cucumis 
melo]
Length=158

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            + ++ +T  +  FG  Y V +INGFTNNSSLPLV+WC S DG DIGGRALQE DDFSW V
Sbjct  32   LEILFATHLEQLFGIEYEVRVINGFTNNSSLPLVIWCASKDG-DIGGRALQEHDDFSWPV  90

Query  256  KPSLW---TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGI  86
            K + W   T   FSCT+K D+ R+ F AF   RD+ RCS  R+C WLV EDGFYFS D +
Sbjct  91   KTNFWITTTTSQFSCTVKLDRTRKSFDAFKVPRDIYRCSALRKCSWLVMEDGFYFSDDEV  150

Query  85   NWRKDFSW  62
            NW+KDFSW
Sbjct  151  NWKKDFSW  158



>ref|XP_004134017.1| PREDICTED: uncharacterized protein LOC101218823 [Cucumis sativus]
 ref|XP_004170218.1| PREDICTED: uncharacterized LOC101218823 [Cucumis sativus]
Length=145

 Score =   156 bits (395),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 97/141 (69%), Gaps = 7/141 (5%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQP-DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
            +IL+LI     +  + VS  P +  FG  Y V +INGFTNNSSLPLV+WC S DG DIGG
Sbjct  8    SILMLI--FFPFFTVFVSLLPAEQLFGIEYEVRVINGFTNNSSLPLVIWCASKDG-DIGG  64

Query  295  RALQERDDFSWSVKPSLW---TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWL  125
            RALQE DDFSW VK + W   T   FSCT+K D+ R+ F AF   RD+ RCS  R+C WL
Sbjct  65   RALQEHDDFSWPVKTNFWITTTTSQFSCTVKLDRTRKSFDAFKVPRDIYRCSALRKCSWL  124

Query  124  VKEDGFYFSVDGINWRKDFSW  62
            V EDGFYFS D +NW+KDFSW
Sbjct  125  VMEDGFYFSDDEVNWKKDFSW  145



>ref|XP_006420551.1| hypothetical protein CICLE_v10006174mg [Citrus clementina]
 ref|XP_006487589.1| PREDICTED: uncharacterized protein LOC102606604 [Citrus sinensis]
 gb|ESR33791.1| hypothetical protein CICLE_v10006174mg [Citrus clementina]
 gb|KDO55827.1| hypothetical protein CISIN_1g046294mg [Citrus sinensis]
Length=141

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            T   +LLI  +A  I  +   QP  ++G  Y V +INGFTNNSSL LV+WC+S +G D+G
Sbjct  3    TLNSILLIFCLAIGIIFMSVLQPQHFYGVEYDVRVINGFTNNSSLALVIWCSSEEG-DMG  61

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
            GRALQ  DD+ W ++  +W    F CTMK+DQ+RR+F AF   RD  RC+  R+C WLVK
Sbjct  62   GRALQAGDDYGWRLRTKIWGTTDFMCTMKWDQKRRRFHAFKVPRDSLRCNLFRKCSWLVK  121

Query  118  EDGFYFSVDGINWRKDFSW  62
            EDGFYFS D +NW+KDFSW
Sbjct  122  EDGFYFSNDEVNWKKDFSW  140



>gb|EYU32616.1| hypothetical protein MIMGU_mgv1a023482mg, partial [Erythranthe 
guttata]
Length=128

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 90/128 (70%), Gaps = 2/128 (2%)
 Frame = -2

Query  439  YIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWS  260
            Y   IV  QP  YFG  + V IINGF+NNSSLPLVVWC S D  DIGGRALQERDD+SW+
Sbjct  2    YTTFIVFIQP-AYFGITFDVRIINGFSNNSSLPLVVWCVSHDSGDIGGRALQERDDYSWT  60

Query  259  VKPS-LWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
            VK +  W++  F CTMK+D++  KF  F   RD  RC     CFWLVKEDGFYFS +GIN
Sbjct  61   VKINPFWSSSRFVCTMKWDEKTMKFEVFRASRDRYRCGDCGECFWLVKEDGFYFSNNGIN  120

Query  82   WRKDFSWM  59
            W K+F WM
Sbjct  121  WIKNFPWM  128



>ref|XP_010096914.1| hypothetical protein L484_008282 [Morus notabilis]
 gb|EXB66392.1| hypothetical protein L484_008282 [Morus notabilis]
Length=147

 Score =   154 bits (388),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 95/132 (72%), Gaps = 5/132 (4%)
 Frame = -2

Query  445  ATYIALIVSTQPDTYF----GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            A +I L+  + P   +    G  Y V +INGFT+NSSLPLV+WC+S + +D+GGRALQER
Sbjct  16   AVFIILLSFSPPGQEYLVLSGMEYDVRVINGFTDNSSLPLVIWCSS-EYSDLGGRALQER  74

Query  277  DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFS  98
            DDFSW +K   W N  F CTMK+DQ+R++F AF   RDV RC P R+C WLV E+GF+FS
Sbjct  75   DDFSWRLKTDFWGNPNFVCTMKWDQKRKRFDAFKVQRDVRRCGPLRKCSWLVTENGFFFS  134

Query  97   VDGINWRKDFSW  62
             D +NW+KDFSW
Sbjct  135  SDEVNWKKDFSW  146



>ref|XP_008460730.1| PREDICTED: uncharacterized protein LOC103499491 [Cucumis melo]
Length=145

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYF--GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            +LL+   + +  ++   QPD  +  G ++ V +INGF NNSSLPLV+WC+S + +D+GGR
Sbjct  10   ILLLFSFSAFSFIVFIVQPDRLYLHGVIFEVRVINGFKNNSSLPLVIWCSSKE-SDLGGR  68

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDFSW V   LW +  FSCTMK+D +R+ F AF   RD  RC   ++C WLV ED
Sbjct  69   ALQEHDDFSWKVTTKLWKSNQFSCTMKWDAKRKSFDAFKVPRDFYRCGNFKKCSWLVTED  128

Query  112  GFYFSVDGINWRKDFSW  62
            GFYFS D INW+KDF W
Sbjct  129  GFYFSPDEINWKKDFQW  145



>ref|XP_008438399.1| PREDICTED: uncharacterized protein LOC103483510 isoform X2 [Cucumis 
melo]
Length=154

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = -2

Query  409  DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW---T  239
            +  FG  Y V +INGFTNNSSLPLV+WC S DG DIGGRALQE DDFSW VK + W   T
Sbjct  37   EQLFGIEYEVRVINGFTNNSSLPLVIWCASKDG-DIGGRALQEHDDFSWPVKTNFWITTT  95

Query  238  NILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
               FSCT+K D+ R+ F AF   RD+ RCS  R+C WLV EDGFYFS D +NW+KDFSW
Sbjct  96   TSQFSCTVKLDRTRKSFDAFKVPRDIYRCSALRKCSWLVMEDGFYFSDDEVNWKKDFSW  154



>emb|CAN63635.1| hypothetical protein VITISV_017182 [Vitis vinifera]
Length=498

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = -2

Query  442  TYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSW  263
            T+I  +   Q + + G  Y V I+NGFT+NSSL LV+WC S D  DIGGRALQ  DDFSW
Sbjct  373  TFIIFMSLKQSENFSGAEYDVRIVNGFTDNSSLALVIWCTS-DNKDIGGRALQVGDDFSW  431

Query  262  SVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
            SVK +LW    F CTMK+D  R++F AF   RDV RC P R CFWLV+EDGFYFS D +N
Sbjct  432  SVKTNLWGATPFHCTMKWDATRKQFDAFQVQRDVQRCGPLRTCFWLVREDGFYFSNDQVN  491

Query  82   WRKDFSW  62
            W+KDFSW
Sbjct  492  WKKDFSW  498



>ref|XP_010069083.1| PREDICTED: uncharacterized protein LOC104456063 [Eucalyptus grandis]
 gb|KCW57306.1| hypothetical protein EUGRSUZ_H00103 [Eucalyptus grandis]
Length=145

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = -2

Query  415  QPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW-T  239
            +P+ ++G  + V +INGF+ NSSLPLV+WC+S D  DIGGRALQE DDFSW+V+ + W  
Sbjct  26   EPEYFYGAEFDVRVINGFSTNSSLPLVIWCSSDDHGDIGGRALQEGDDFSWAVRSNFWGA  85

Query  238  NILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSWM  59
               F CT+K+D  R++F AF   RD  RC P R+C WLV+EDGFYFS D +NW+KDFSW 
Sbjct  86   AARFLCTVKWDSTRKRFDAFEAERDGRRCGPFRKCSWLVREDGFYFSSDEVNWKKDFSWF  145



>ref|XP_004139019.1| PREDICTED: uncharacterized protein LOC101209275 [Cucumis sativus]
 ref|XP_004172851.1| PREDICTED: uncharacterized protein LOC101227623 [Cucumis sativus]
 gb|KGN61521.1| hypothetical protein Csa_2G153590 [Cucumis sativus]
Length=123

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 85/120 (71%), Gaps = 3/120 (3%)
 Frame = -2

Query  415  QPDTYF--GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW  242
            QPD  +  G V+ V +INGF NNSSLPLV+WC+S +  D+GGRALQE DDFSW V   LW
Sbjct  5    QPDRLYLHGVVFEVRVINGFKNNSSLPLVIWCSSKEN-DLGGRALQEHDDFSWKVTTKLW  63

Query  241  TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             +  FSCTMK+D +RR F AF   RD  RC   ++C WLV EDGFYFS D INW+KDF W
Sbjct  64   KSNQFSCTMKWDAKRRSFDAFKVPRDFYRCGHFKKCSWLVTEDGFYFSSDEINWKKDFQW  123



>ref|XP_003594515.1| hypothetical protein MTR_2g030080 [Medicago truncatula]
 ref|XP_003638386.1| hypothetical protein MTR_129s0010 [Medicago truncatula]
 gb|AES64766.1| leguminosin group486 secreted peptide [Medicago truncatula]
Length=143

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 3/141 (2%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYF--GNVYGVHIINGFTNNSSLPLVVWCNSGDGAD  305
            T  +  L+   A+ I ++V  Q   Y    + Y V +INGFTNNSS+PLV+WC S D  D
Sbjct  4    TACVFPLLCFSASIIIVMVVMQQSQYLFSSDEYYVRVINGFTNNSSVPLVIWC-SSDEMD  62

Query  304  IGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWL  125
            +G RA+QE DDFSW ++P+LW++    CTMK+D  R+KF AF   RD  RC   R C W 
Sbjct  63   LGSRAMQEHDDFSWIMRPNLWSSNHMKCTMKYDNTRKKFDAFKASRDAERCGTNRICSWR  122

Query  124  VKEDGFYFSVDGINWRKDFSW  62
            V +DGFYFS D +NWR DF+W
Sbjct  123  VTQDGFYFSNDEVNWRMDFTW  143



>ref|NP_189048.1| self-incompatibility S1 family protein [Arabidopsis thaliana]
 dbj|BAB03024.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76849.1| self-incompatibility S1 family protein [Arabidopsis thaliana]
Length=147

 Score =   147 bits (371),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 3/139 (2%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYF-GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            +L +++ ++  I   +  QP T F G  + V +IN F +NSSLPLV+WC S  G D+GGR
Sbjct  10   LLFMLIAISLTIIFTLMLQPQTMFLGEEFDVRVINSFRDNSSLPLVIWCTSPQG-DLGGR  68

Query  292  ALQERDDFSWSVKPSLWTNIL-FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            ALQE DDF W+ K  LW+ +  ++CTMK+D +R++F AF   RD NRC  T++C W V+E
Sbjct  69   ALQEGDDFEWTAKIDLWSWMAEYTCTMKWDSKRKQFEAFKVSRDSNRCGSTKKCSWSVRE  128

Query  115  DGFYFSVDGINWRKDFSWM  59
            DGFYFS D + W KDFSW+
Sbjct  129  DGFYFSSDEVYWTKDFSWL  147



>ref|XP_004486449.1| PREDICTED: uncharacterized protein LOC101495365 [Cicer arietinum]
Length=143

 Score =   146 bits (369),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 92/136 (68%), Gaps = 2/136 (1%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFG-NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            L+L    + +I + +  +    FG + Y V ++NGFTNNSS+PLV+WC+S +  D+GGRA
Sbjct  9    LILCFATSIFIVMAIVQRTQHIFGSDEYYVRVMNGFTNNSSVPLVIWCSSEE-VDLGGRA  67

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            LQE D+FSW ++P+ W++    CTMK+D+ R+ F AF   RD  RC P R C W V +DG
Sbjct  68   LQEHDEFSWIMRPNFWSSNYMKCTMKWDKTRKSFDAFKVSRDTERCGPHRLCSWRVTQDG  127

Query  109  FYFSVDGINWRKDFSW  62
            FYFS D +NWRKDF W
Sbjct  128  FYFSNDEVNWRKDFIW  143



>ref|XP_002865598.1| hypothetical protein ARALYDRAFT_331219 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41857.1| hypothetical protein ARALYDRAFT_331219 [Arabidopsis lyrata subsp. 
lyrata]
Length=133

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 94/137 (69%), Gaps = 5/137 (4%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYF-GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            +L+I  +   I L++  QP T   G  Y V +IN F +NSSLPLV+WC S  G D+GGRA
Sbjct  1    MLIITSLTIMITLML--QPQTMLLGEEYDVRVINNFRDNSSLPLVIWCTSPQG-DLGGRA  57

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            LQE DDF W+VK  LW+   ++CTMK++ +R++F AF   RD NRC  T++C W V+EDG
Sbjct  58   LQEGDDFEWTVKIDLWS-AEYTCTMKWNTKRKRFEAFKVSRDSNRCGSTKKCSWSVREDG  116

Query  109  FYFSVDGINWRKDFSWM  59
            FYFS D + W KDFSW+
Sbjct  117  FYFSNDEVYWTKDFSWL  133



>ref|XP_007147488.1| hypothetical protein PHAVU_006G128700g [Phaseolus vulgaris]
 gb|ESW19482.1| hypothetical protein PHAVU_006G128700g [Phaseolus vulgaris]
Length=143

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 92/138 (67%), Gaps = 4/138 (3%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYF---GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
            + L +  A+ I ++++T     F    + Y V +INGFT+NSS+PLV+WC+S +  D+GG
Sbjct  7    VYLTLCFASSIIMVMATIQRARFLLGTDDYYVRVINGFTDNSSVPLVIWCSSEE-IDLGG  65

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            RALQE DDFSW ++PS W++    CTMK+D  R+ F AF   RD  RC   R C W+V +
Sbjct  66   RALQEHDDFSWVMRPSFWSSNRMKCTMKWDTTRKSFEAFKASRDTERCGIHRMCSWMVTQ  125

Query  115  DGFYFSVDGINWRKDFSW  62
            DGFYFS D +NWRKDF W
Sbjct  126  DGFYFSNDEVNWRKDFLW  143



>ref|XP_003547327.1| PREDICTED: uncharacterized protein LOC100792052 [Glycine max]
 gb|KHN14335.1| hypothetical protein glysoja_012373 [Glycine soja]
Length=143

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 93/139 (67%), Gaps = 3/139 (2%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDT--YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            ++ L +   +++I ++ + Q     +  N Y V +INGF++NSS+PLV+WC S +  D+G
Sbjct  6    SVYLTLCLASSFIMMMATVQRARLLFATNEYYVRVINGFSDNSSVPLVIWCASEE-MDLG  64

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
            GRALQE DDFSW ++P+ W++    CTMK+D  R+ F AF   RD +RC   R C W+V 
Sbjct  65   GRALQEHDDFSWVMRPNFWSSNRMKCTMKWDNTRKSFEAFKASRDTDRCGIHRMCSWMVT  124

Query  118  EDGFYFSVDGINWRKDFSW  62
            +DGFYFS D +NWRKDF W
Sbjct  125  QDGFYFSNDEVNWRKDFLW  143



>ref|XP_003594517.1| hypothetical protein MTR_2g030100 [Medicago truncatula]
 gb|AES64768.1| leguminosin group486 secreted peptide [Medicago truncatula]
Length=143

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 2/136 (1%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFG-NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            L+L    + +I + +       FG + Y V +INGFT+NSS+PLV+WC+S +  D+GGRA
Sbjct  9    LILCFASSIFIVMALVQGTHNIFGSDEYYVRVINGFTDNSSVPLVIWCSSEE-MDLGGRA  67

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            LQE D+FSW+++P+ W++    CTMK+D  R+ F AF   RD+ RC   R C W V +DG
Sbjct  68   LQEHDEFSWTMRPNFWSSNYMKCTMKWDSIRKIFDAFEASRDIERCGLHRLCSWRVTQDG  127

Query  109  FYFSVDGINWRKDFSW  62
            FYFS D +NWRKDF W
Sbjct  128  FYFSNDEVNWRKDFIW  143



>ref|XP_010550841.1| PREDICTED: uncharacterized protein LOC104821619 [Tarenaya hassleriana]
Length=144

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 90/137 (66%), Gaps = 2/137 (1%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYF-GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            I+LL + ++  I      QP     G  + V +INGF +NSSLPLV+WC++  G D+GGR
Sbjct  8    IILLFLFISLTIVFTSMVQPQAMLLGMEFDVRVINGFRDNSSLPLVIWCSTERG-DLGGR  66

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            ALQE DDF W+V+  LW    + CT K+D +R+ F AF   RD  RC  TR+C WLV++D
Sbjct  67   ALQEGDDFGWTVRIELWGAREYLCTTKWDSRRKSFDAFRAPRDSRRCGLTRKCSWLVRDD  126

Query  112  GFYFSVDGINWRKDFSW  62
            GFYFS D +NW KDFSW
Sbjct  127  GFYFSSDEVNWIKDFSW  143



>ref|XP_002883495.1| hypothetical protein ARALYDRAFT_898978 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59754.1| hypothetical protein ARALYDRAFT_898978 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = -2

Query  436  IALIVSTQPDTYF-GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWS  260
            I   +  QP T F G  + V +IN F +NSSLPLV+WC S  G D+GGRALQE DDF W+
Sbjct  21   IIFTLILQPQTMFLGEEFDVRVINSFRDNSSLPLVIWCTSPQG-DLGGRALQEGDDFEWT  79

Query  259  VKPSLWTNIL-FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
             K  LW+ +  ++CTMK++ +R++F AF   RD NRC  T++C W V+EDGFYFS D + 
Sbjct  80   AKIDLWSWMAEYTCTMKWNSKRKRFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSSDEVY  139

Query  82   WRKDFSWM  59
            W KDFSW+
Sbjct  140  WTKDFSWL  147



>ref|XP_010488501.1| PREDICTED: uncharacterized protein LOC104766333 [Camelina sativa]
Length=146

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  415  QPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  Y V +IN F +NSSLPLV+WC S  G ++GGRALQE DDF W+ K   W+
Sbjct  27   QPQTMSLGEEYDVRVINNFRDNSSLPLVIWCTSPQG-ELGGRALQEGDDFEWTAKIDFWS  85

Query  238  NI-LFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             + +++CTMK+D  R++F AF   RD NRC  T++C W V+EDGFYFS D + W KDFSW
Sbjct  86   LMAVYTCTMKWDSMRKRFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSSDEVYWTKDFSW  145

Query  61   M  59
            +
Sbjct  146  L  146



>ref|XP_010466790.1| PREDICTED: uncharacterized protein LOC104746939 [Camelina sativa]
Length=146

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = -2

Query  436  IALIVSTQPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWS  260
            I L    QP T   G  Y V +IN F +NSSLPLV+WC S  G ++GGRALQE DDF W+
Sbjct  20   IILTSILQPQTMSLGEEYDVRVINNFRDNSSLPLVIWCTSPQG-ELGGRALQEGDDFEWT  78

Query  259  VKPSLWTNI-LFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
             K   W+ + +++CTMK+D  R++F AF   RD NRC  T++C W V+EDGFYFS D + 
Sbjct  79   AKIDFWSLMAVYTCTMKWDSVRKRFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSNDEVY  138

Query  82   WRKDFSWM  59
            W KDFSW+
Sbjct  139  WTKDFSWL  146



>ref|XP_010513251.1| PREDICTED: uncharacterized protein LOC104789215 [Camelina sativa]
Length=146

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  415  QPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  Y V +IN F +NSSLPLV+WC S  G ++GGRALQE DDF W+ K   W+
Sbjct  27   QPQTMSLGEEYDVRVINNFRDNSSLPLVIWCTSPQG-ELGGRALQEGDDFEWTAKIEFWS  85

Query  238  NI-LFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             + +++CTMK+D  R++F AF   RD NRC  T++C W V+EDGFYFS D + W KDFSW
Sbjct  86   LMAVYTCTMKWDSMRKRFEAFKVSRDSNRCGSTKKCSWSVREDGFYFSNDEVCWTKDFSW  145

Query  61   M  59
            +
Sbjct  146  L  146



>ref|XP_006299507.1| hypothetical protein CARUB_v10015677mg [Capsella rubella]
 gb|EOA32405.1| hypothetical protein CARUB_v10015677mg [Capsella rubella]
Length=146

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  415  QPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  Y V +IN   +NSSLPLV+WC S  G D+GGRALQE DDF W+ K  LW+
Sbjct  27   QPQTMSLGVEYDVRVINNLRDNSSLPLVIWCTSPQG-DLGGRALQEGDDFEWTAKIDLWS  85

Query  238  NIL-FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             +  ++CTMK+D +R++F AF   RD NRC  T++C W V+EDGFYFS D + W KDFSW
Sbjct  86   LMADYTCTMKWDSRRKRFEAFKGSRDSNRCGTTKKCSWSVREDGFYFSSDEVYWTKDFSW  145

Query  61   M  59
            +
Sbjct  146  L  146



>ref|XP_003534770.1| PREDICTED: uncharacterized protein LOC100790348 [Glycine max]
 gb|KHN22997.1| hypothetical protein glysoja_030667 [Glycine soja]
Length=143

 Score =   135 bits (341),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDT--YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
            + L +   +++I ++ + Q     +  N Y V +INGF++NSS+PLV+WC S +  D+GG
Sbjct  7    VYLTLWLASSFIIMMATVQRARLLFATNEYYVRVINGFSDNSSVPLVIWCASEE-MDLGG  65

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            RALQE DDFSW ++P+ W++    CTMK+   R+ F AF   RD +RC   R C W+V +
Sbjct  66   RALQEHDDFSWVMRPNFWSSNRMKCTMKWGNTRKSFEAFKASRDTDRCGLHRMCSWMVTQ  125

Query  115  DGFYFSVDGINWRKDFSW  62
            +GFYFS D +NWRKDF W
Sbjct  126  NGFYFSNDEVNWRKDFLW  143



>ref|XP_010666187.1| PREDICTED: uncharacterized protein LOC104883375 [Beta vulgaris 
subsp. vulgaris]
Length=155

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = -2

Query  457  IVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            I+ M T        + +   G+ Y V ++NGF+NNSSLPLV+WC + D  D+GGRALQE 
Sbjct  20   IIFMVTMRETNYLRETNYLHGSQYYVRVVNGFSNNSSLPLVIWCATLDN-DMGGRALQEG  78

Query  277  DDFSWSVKPSLW----TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            DD+SWS   +       N    CT+K+DQ R+KF AF   RD++RCSP++ C WLVKEDG
Sbjct  79   DDYSWSQSINFLGVGSNNNRVFCTLKWDQMRKKFDAFLMSRDIHRCSPSKMCLWLVKEDG  138

Query  109  FYFSVDGINWRKDFSW  62
            FYFS DG+ + KDFSW
Sbjct  139  FYFSNDGLLFNKDFSW  154



>ref|XP_009106107.1| PREDICTED: uncharacterized protein LOC103831913 [Brassica rapa]
Length=144

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  415  QPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  + V +IN F +NSSLPLV+WC S  G D+GGRALQE DDF W+ +  LW+
Sbjct  25   QPHTLSLGEEFDVRVINSFRDNSSLPLVIWCTSPQG-DLGGRALQEGDDFRWTARIELWS  83

Query  238  -NILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
                ++CTMK++ +R++F AF   RD NRC  T++C W V+EDGFYFS D I W KDFSW
Sbjct  84   WRAEYTCTMKWELKRKRFEAFKVSRDSNRCGITKKCSWSVREDGFYFSSDEIYWTKDFSW  143

Query  61   M  59
            +
Sbjct  144  L  144



>ref|XP_006418796.1| hypothetical protein EUTSA_v10003022mg [Eutrema salsugineum]
 gb|ESQ37232.1| hypothetical protein EUTSA_v10003022mg [Eutrema salsugineum]
Length=146

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -2

Query  415  QPDTYF-GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  Y V +IN F +NSSLPLV+WCNS  G ++GGRALQE DDF W+ +  LW+
Sbjct  27   QPQTMLLGKEYDVRVINSFRDNSSLPLVIWCNSPQG-ELGGRALQEGDDFRWTARIELWS  85

Query  238  -NILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
                ++CTMK++ +R++F AF   RD+NRC  T +C W V+EDGFYFS D + W KDFSW
Sbjct  86   WKADYTCTMKWESKRKRFDAFKISRDINRCGFTGKCSWSVREDGFYFSSDEVYWTKDFSW  145

Query  61   M  59
            +
Sbjct  146  L  146



>emb|CDY46340.1| BnaC01g30300D [Brassica napus]
 emb|CDY18064.1| BnaA01g23250D [Brassica napus]
Length=157

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -2

Query  415  QPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            QP T   G  + V +IN F +NSSLPLV+WC S  G D+GGRALQE DDF W+ +  LW+
Sbjct  25   QPHTLSLGEEFDVRVINSFRDNSSLPLVIWCTSPQG-DLGGRALQEGDDFRWTARIELWS  83

Query  238  -NILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
                ++CT+K++ +R++F AF   RD NRC  T++C W V+EDGFYFS D I+
Sbjct  84   WRAEYTCTIKWELKRKRFEAFKVSRDSNRCGITKQCSWSVREDGFYFSSDEIS  136



>gb|EYU43800.1| hypothetical protein MIMGU_mgv1a026584mg [Erythranthe guttata]
Length=149

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 2/113 (2%)
 Frame = -2

Query  400  FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSC  221
            FG  Y VH+INGF  N+  PL+V C S    DIG  +L    + +W  K       LF C
Sbjct  39   FGLEYHVHVINGFKKNTK-PLMVHCWSKQD-DIGQHSLNVDQEITWHFKVRFDGTTLFIC  96

Query  220  TMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             +K  +  + F AF    + ++C+   +C+WLV E GFYFS D   W K + W
Sbjct  97   DVKQGEHAKHFDAFDAQVEGSKCAEFGKCYWLVAEGGFYFSTDNFTWFKQYDW  149



>gb|KDO39562.1| hypothetical protein CISIN_1g042596mg [Citrus sinensis]
Length=124

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
             +  +IING  N+S  PL + C S D  D+G   L+  +DF W    + +   LF C MK
Sbjct  16   TFDEYIING-INSSDKPLFIHCQSRDD-DLGEHYLKAGEDFHWHFWVNFFRTTLFFCHMK  73

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            ++ +  +F  F  G++  +C  T   +WLV+E GFY S D  +W K + W
Sbjct  74   WEDKETRFDVFTAGKEGKKCDKTGNVYWLVQESGFYLSDDKSSWSKQYDW  123



>gb|EYU43801.1| hypothetical protein MIMGU_mgv1a018301mg, partial [Erythranthe 
guttata]
Length=118

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VHIIN F NN+   L+V C S D  D+G   L + +D+ W  + + + + LF C +++
Sbjct  11   YEVHIINNFENNTD-ELIVNCRSADD-DLGEHFLDKGEDWHWQFRVNFFRSTLFYCNVQW  68

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             +  ++F +F      + C  T  CFW V+EDG YFS D  N+ K   W
Sbjct  69   GELGQRFTSFDTDNISSTCEETSTCFWSVREDGIYFSCDNKNYEKRHLW  117



>ref|XP_007034483.1| Uncharacterized protein TCM_020416 [Theobroma cacao]
 gb|EOY05409.1| Uncharacterized protein TCM_020416 [Theobroma cacao]
Length=144

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (52%), Gaps = 9/115 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLP-----LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFS  224
            Y +HIIN     S LP     L + C S D  D+G + + E  D++W  + +L+   L+ 
Sbjct  33   YHIHIINDLP--SDLPPNIPALSLHCKSKDK-DLGEKNMLEHQDYTWDSRINLFRTTLYF  89

Query  223  CTMKFDQQRRKFAAFAQGRDVNRCSPTRR-CFWLVKEDGFYFSVDGINWRKDFSW  62
            C  +++ ++R F AF   RD +RC      C W V++DG YFS D   W  ++ W
Sbjct  90   CNARWEGKQRYFEAFKATRDEHRCRVHHNSCLWSVRDDGIYFSNDNSTWTNEYPW  144



>ref|XP_002303912.1| hypothetical protein POPTR_0003s20030g [Populus trichocarpa]
 gb|EEE78891.1| hypothetical protein POPTR_0003s20030g [Populus trichocarpa]
Length=151

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 8/146 (5%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQP------DTYFGNVYGVHIINGFTNNSSLPLVVWCNSG  317
            + +  LL +   +Y  L   ++P       ++F   + VHIINGF++N + PL + C S 
Sbjct  7    SASFPLLFILAISYPVLAWGSKPIPFNDNKSFFCFKFRVHIINGFSSNKN-PLSLHCWSQ  65

Query  316  DGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRR  137
            D  D+G   L    DF++    + +   +F C  K+ ++ R    F  G + + C  T  
Sbjct  66   DN-DLGNHTLYIGGDFNFKFGLASFGKTIFHCDFKWAEKHRFANVFTDGMESSTCCDTNS  124

Query  136  CFWLVKEDGFYFSVDGINWRKDFSWM  59
            C+W  ++DG YFS D  N+ K   W+
Sbjct  125  CYWKTEDDGIYFSNDNKNYIKRLDWL  150



>ref|XP_002518180.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44313.1| conserved hypothetical protein [Ricinus communis]
Length=151

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (50%), Gaps = 11/149 (7%)
 Frame = -2

Query  478  TQTILLLIVGMATYIAL--IVSTQPDTY----FGNVYGVHIINGFTNNSSLPLVVWCNSG  317
            T TI  LI  ++T + L  + + +P       F   Y VH++NG +NN+  PL++ C+S 
Sbjct  4    TMTIFCLIFLLSTTVDLHPVGAWRPTLMEIDRFCLAYIVHVMNGLSNNNH-PLLLQCHSR  62

Query  316  DGADIGGRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPT-  143
            D  D+G   L    DF +     ++  + LF+C M++  +   F  F Q    + C    
Sbjct  63   DD-DLGNHTLYIGGDFHFGFGIKIFGKHTLFNCGMEWGNKHHNFDVFNQDVHASICCTHH  121

Query  142  -RRCFWLVKEDGFYFSVDGINWRKDFSWM  59
             R CFW  ++DG YFS D   W K F W+
Sbjct  122  GRSCFWRAQDDGIYFSTDNEEWAKTFPWI  150



>ref|XP_007034482.1| Uncharacterized protein TCM_020415 [Theobroma cacao]
 gb|EOY05408.1| Uncharacterized protein TCM_020415 [Theobroma cacao]
Length=144

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 6/142 (4%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNN--SSLP-LVVWCNSGDGAD  305
            + +LL ++ +     L  +   D  F   Y +HI N    +    +P L + C S D  D
Sbjct  5    KELLLPMLALCILYPLAFAVNEDLLFIK-YHIHITNDMPPDFPPYIPALSLHCKSKD-ED  62

Query  304  IGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRR-CFW  128
            +G + L E  D++W+   + +   L+ C  ++++++R F AF   RD +RC      C W
Sbjct  63   LGEKELSEHQDYTWNSSINDFRTTLYFCNARWEKKQRYFVAFKATRDEHRCRVYHNSCLW  122

Query  127  LVKEDGFYFSVDGINWRKDFSW  62
             V+ DG YFS +   W  ++ W
Sbjct  123  SVRGDGIYFSNNNSTWTNEYPW  144



>ref|XP_002523926.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38495.1| conserved hypothetical protein [Ricinus communis]
Length=160

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (54%), Gaps = 2/121 (2%)
 Frame = -2

Query  424  VSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSL  245
            V T+ +  F   + VH+ING ++N++ PL + C S D  D+G   L    DF++     +
Sbjct  37   VETENEDGFCFKFRVHVINGLSSNAN-PLFLRCWSLDD-DLGEHHLYIGGDFNFKFGLKV  94

Query  244  WTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFS  65
            +   LF+C  ++D + +    F    + N C  T+ CFW  +++G +FSVD   W K F+
Sbjct  95   FGRTLFTCFFEWDNKNQHVDVFRDNVEANLCCDTQTCFWRAQDEGIFFSVDSQTWDKKFN  154

Query  64   W  62
            W
Sbjct  155  W  155



>ref|XP_002518178.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44311.1| conserved hypothetical protein [Ricinus communis]
Length=150

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 73/148 (49%), Gaps = 11/148 (7%)
 Frame = -2

Query  478  TQTILLLIVGMAT--YIALIVSTQP-----DTYFGNVYGVHIINGFTNNSSLPLVVWCNS  320
            T TI  LI  ++T  Y+  +++ +P     D  F   Y VH++NG ++N + PL + C S
Sbjct  4    TLTIFCLIFLLSTTIYLHPVLAWRPTLLETDKLFCIKYRVHVMNGLSSNEN-PLYIHCQS  62

Query  319  GDGADIGGRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRC-SP  146
             D  D+G   L    DF++  +  L   N  FSC M +  + +    F Q  +   C + 
Sbjct  63   RDD-DLGDHTLNVGGDFNFKFRIKLIGPNTWFSCDMVWGSKHQHVDVFRQKVEGPMCCAD  121

Query  145  TRRCFWLVKEDGFYFSVDGINWRKDFSW  62
               C+W  ++DG YFS + + W + + W
Sbjct  122  GNSCYWRAQDDGIYFSTNNVEWIRRYEW  149



>ref|XP_002297829.1| hypothetical protein POPTR_0001s14150g [Populus trichocarpa]
 gb|EEE82634.1| hypothetical protein POPTR_0001s14150g [Populus trichocarpa]
Length=140

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 3/109 (3%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + V+I N    + S  L+V C      D+G + L ++  F +      +   LF C M++
Sbjct  35   HHVYITNDLPGDPSKTLMVHCKDK-TKDLGFKYLSQKQVFHFKASIDFFRRRLFFCNMQW  93

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            + ++    AF   RD NRC   + C W V+EDGFYFS    +W +++ W
Sbjct  94   NGKQTYIDAFYAKRDENRCR--KHCMWSVREDGFYFSKGDSHWNREYQW  140



>ref|XP_011002181.1| PREDICTED: uncharacterized protein LOC105109247 [Populus euphratica]
 ref|XP_011012226.1| PREDICTED: uncharacterized protein LOC105116527 [Populus euphratica]
Length=140

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y ++I N    + S  L+V C      D+G + L ++  F +      +   LF C M++
Sbjct  35   YHIYITNDLPGDPSKTLMVHCKDK-TKDLGIKYLSQKQVFRFKASIDFFRRRLFFCNMQW  93

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            + ++    AF   RD NRC   + C W V+EDGFYFS     W +++ W
Sbjct  94   NGKQTYIDAFYAKRDENRCR--KHCMWSVREDGFYFSRGDSRWIREYQW  140



>ref|XP_010321600.1| PREDICTED: uncharacterized protein LOC104647674 [Solanum lycopersicum]
Length=140

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 68/142 (48%), Gaps = 8/142 (6%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
             +T  +L V +  YI  I     D   G  Y VH+I+  +++  +PL   C SGD  D+G
Sbjct  4    NKTFFILFVTL--YIFNICQAAVDDN-GFQYEVHVIDALSDDK-IPLKFHCLSGDD-DLG  58

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCS---PTRRCFW  128
                +  DDF +  + +++ +  FSC   +D + R F  F +   +  CS   PTR C+W
Sbjct  59   FHYPKVGDDFHFKFRMNIFESTRFSCRFWWDNKERVFEVFNRILIIKHCSGDFPTRFCYW  118

Query  127  LVKEDGFYFSVDGINWRKDFSW  62
             V+ DGFY         K + W
Sbjct  119  KVQNDGFYVGPQLDQMEKMYDW  140



>ref|XP_002518177.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44310.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 70/151 (46%), Gaps = 19/151 (13%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTY------FGNVYGVHIINGFTNNSSLPLVVWCNSGDG  311
            T+  LI+ +A +   ++S QP         F   + VH+ING + N   PL + C S D 
Sbjct  7    TLFSLILLVANFYHPVLSWQPQVVEKPRVRFCFKFTVHVINGLSTNQH-PLFIHCQSRDD  65

Query  310  ADIGGRALQERDDFSWS-----VKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSP  146
             D+GG  L +  DF++      + P  W    F+C M +  + +    F Q  + + C  
Sbjct  66   -DLGGHTLYKGGDFNFRFGVKFIGPKTW----FTCDMTWGSKHQHVDVFRQKIEGSMCCN  120

Query  145  T--RRCFWLVKEDGFYFSVDGINWRKDFSWM  59
                 C+W  ++DG YFSVD   W   + W+
Sbjct  121  DGGNICYWRAQDDGIYFSVDNEMWLLRYDWL  151



>ref|XP_002518182.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44315.1| conserved hypothetical protein [Ricinus communis]
Length=150

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 70/147 (48%), Gaps = 17/147 (12%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQP-----DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            L+ ++   TY+  +++ +P     D  F   Y VH++NG ++N + PL + C S D  ++
Sbjct  10   LIFLLSTTTYLNPVLAWRPTLIETDKLFCIKYRVHVMNGLSSNEN-PLFIHCQSRDD-NL  67

Query  301  GGRALQERDDFSWSVK-----PSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCS-PTR  140
            G   L    DF++  +     P  W    F+C M +  + +    F Q  + + C     
Sbjct  68   GDHTLNVGGDFNFKFRIKFFGPDSW----FTCEMMWGSKHQHVDVFRQKVEGSMCCVDGN  123

Query  139  RCFWLVKEDGFYFSVDGINWRKDFSWM  59
             C+W  ++DG YFS D   W K + W+
Sbjct  124  SCYWRAQDDGIYFSTDYTEWIKRYDWL  150



>gb|EPS58024.1| hypothetical protein M569_16794 [Genlisea aurea]
Length=116

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 1/109 (1%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + V I N       L + V C S D  D+G   L +  D  W  + +L+ + LF C++  
Sbjct  5    FEVSIANNMNETGGLMIAVHCKSADD-DLGEHYLWKDQDLRWKFRINLFRSTLFFCSVNS  63

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
             +   +F  F       +C  + +CFW V+++GFY S DG  + K   W
Sbjct  64   GETTLRFDVFDTDYISFKCQDSSKCFWSVRDEGFYLSCDGSTFEKQHEW  112



>gb|KDO55824.1| hypothetical protein CISIN_1g039071mg [Citrus sinensis]
Length=133

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
            V  VH++N    +S+ PL + CNS D A++  + L+  DD+SWSV+    T   + C   
Sbjct  30   VTQVHVMNALPKDSA-PLEIRCNSAD-ANLDAKQLKSGDDYSWSVEEETAT---YFCEAF  84

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            +  +   + AF   RD NR    +  FWL+ E+GF+   D   W +  +W
Sbjct  85   WGNKFASWHAFEPPRDANR----KTVFWLINENGFFLGYDNSTWVEKSTW  130



>ref|XP_007034520.1| Uncharacterized protein TCM_020442 [Theobroma cacao]
 gb|EOY05446.1| Uncharacterized protein TCM_020442 [Theobroma cacao]
Length=206

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 3/108 (3%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VHI+NGF +N+  PL++ C+S D  D+G   L +  +F +           F C   +
Sbjct  39   YKVHILNGFADNAK-PLIIHCHSRDD-DLGEHTLWKDQEFRFKFIVHFVKTTHFVCDFNW  96

Query  208  -DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDF  68
              +     + F    + + C  T  CFW  +EDG YFS +  NW K F
Sbjct  97   GSKSLDNISVFKNDAETSSCRATGNCFWKAEEDGIYFSNNDQNWVKRF  144



>ref|XP_006355757.1| PREDICTED: uncharacterized protein LOC102589688 [Solanum tuberosum]
Length=141

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 5/116 (4%)
 Frame = -2

Query  397  GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCT  218
            G  Y VH+I+   NN  +PL   C SGD  D+G    +  DDF +  + ++  +  F+C 
Sbjct  28   GFQYEVHVIDALPNNV-IPLKFHCFSGDD-DLGFHYPKVGDDFHFKFRMNIVESTRFTCR  85

Query  217  MKFDQQRRKFAAFAQGRDVNRCS---PTRRCFWLVKEDGFYFSVDGINWRKDFSWM  59
              +D + + F  F +   +  CS   PTR C+W V+ DGFY         K + W+
Sbjct  86   FWWDNKEKVFDVFNRILIIKHCSGDFPTRFCYWKVQNDGFYVGPQLDQMEKMYDWL  141



>ref|XP_010245687.1| PREDICTED: pumilio homolog 15-like [Nelumbo nucifera]
Length=127

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 4/112 (4%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            +AL +S QP    G  Y V +IN    N +L L   C S +  D+G   +    +F+WS 
Sbjct  4    LALALSKQPLMVAGK-YHVFVINDLGENETLNLH--CASKNN-DLGTHLITFGSNFNWSF  59

Query  256  KPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
              +     LF C M +   R  +  F   RD + C   +RC+W V++DG YF
Sbjct  60   NINFSETTLFWCDMNWKSFRMHYDVFEAKRDRSICDAQQRCYWRVQQDGLYF  111



>ref|XP_006340968.1| PREDICTED: uncharacterized protein LOC102582688 [Solanum tuberosum]
Length=148

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
 Frame = -2

Query  430  LIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKP  251
            L +ST    +  N + VH+IN   +NSSL L + C SGD  D+G R L    +F WS   
Sbjct  19   LNLSTTKACFLTNRFEVHVINNLPSNSSL-LKIHCASGDD-DLGDRYLTVNQEFKWSFCQ  76

Query  250  SLWTNILFSCTMKFDQQRRKFAAFAQG----RDVNRCSPTRRCFWLVKEDGFYF  101
            +L    LF C   +D + + F  F       +D      T +C W+VK DGFY 
Sbjct  77   ALAWTTLFFCHFWWDSKSKVFNVFDDPVHCVKDGLLPKITTQCAWVVKSDGFYL  130



>ref|XP_010317606.1| PREDICTED: uncharacterized protein LOC104646150 [Solanum lycopersicum]
Length=139

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (52%), Gaps = 12/130 (9%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            T+ I+ L+V M+     I+    ++ F   + VHIIN  +NN + P  V C S D  D+G
Sbjct  2    TKIIVFLVVIMS-----ILVQTTNSAFTKRFTVHIINALSNNDT-PFFVHCKSQDD-DLG  54

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRR----CF  131
             +     DD+++S + +++    F C   +  +++ F  F + +    C   +R    CF
Sbjct  55   LKTPTVGDDYNFSFRANVFKTTRFYCHFLWGSRKQVFDVFNRYQSY-ECGKIKRNNYECF  113

Query  130  WLVKEDGFYF  101
            W V++DGFYF
Sbjct  114  WKVQDDGFYF  123



>ref|XP_006442166.1| hypothetical protein CICLE_v10023262mg, partial [Citrus clementina]
 gb|ESR55406.1| hypothetical protein CICLE_v10023262mg, partial [Citrus clementina]
Length=84

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 39/82 (48%), Gaps = 0/82 (0%)
 Frame = -2

Query  307  DIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFW  128
            D+G   L  +++F +      W    F C M F    R    F  G +++ C  T  CFW
Sbjct  3    DLGAHLLWMKEEFRFEFTVDFWKKTHFGCDMGFGTNERTVDVFQTGIEIHTCRSTGNCFW  62

Query  127  LVKEDGFYFSVDGINWRKDFSW  62
             ++EDG YFS +  +W K + W
Sbjct  63   SMREDGIYFSNNDQSWVKKYDW  84



>gb|EYU27292.1| hypothetical protein MIMGU_mgv1a026865mg, partial [Erythranthe 
guttata]
Length=164

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 53/118 (45%), Gaps = 6/118 (5%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            I +    +  T  G  Y VHI+N    NS+ PL + C S D  D+G   L   DDF+W  
Sbjct  35   IQIFDKIERKTSPGQGYEVHIVNKLPINSTFPLNIHCASKDD-DLGNHTLNLNDDFNWHF  93

Query  256  KPSLWTNILFSCTMKFDQQRRKFAAFAQG-----RDVNRCSPTRRCFWLVKEDGFYFS  98
            K +   + +F C  K+  + +    F +         N  +    C W +KEDGF+ S
Sbjct  94   KMNYGLSTMFFCRFKWGSKDQAHEVFNKHIAFYCEGYNEKADGNICLWSIKEDGFWIS  151



>ref|XP_006420550.1| hypothetical protein CICLE_v10007007mg, partial [Citrus clementina]
 gb|ESR33790.1| hypothetical protein CICLE_v10007007mg, partial [Citrus clementina]
Length=115

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
            V  VH++N     S+ PL + CNS D A++  + L+   D+SW V+    T   + C   
Sbjct  12   VTQVHVMNALPKESA-PLEIRCNSAD-ANLDAKQLKSGYDYSWRVEEETAT---YFCEAF  66

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            +  +   + AF   RD N+    +R FWL+KE+GF+   D  +W +  +W
Sbjct  67   WGNKFASWHAFEPPRDANQ----KRVFWLIKENGFFLGYDNSSWVEKSTW  112



>ref|XP_007200013.1| hypothetical protein PRUPE_ppa024656mg [Prunus persica]
 gb|EMJ01212.1| hypothetical protein PRUPE_ppa024656mg [Prunus persica]
Length=144

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 66/139 (47%), Gaps = 11/139 (8%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            I +L++ +  +++    TQ      N Y VH+ING + ++   L + C S D  D+G   
Sbjct  12   ISMLLLALVIFLS---QTQVTYSLFNKYRVHVINGLSKDT---LTIHCQSKD-TDLGIHE  64

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD--VNRCSPTRRCFWLVKE  116
            L    +F W  + + +   LF C ++++   + F AF       +N CS    C WL ++
Sbjct  65   LAVNQEFEWEFRTNFFDTTLFFCNLRWNGGHKSFDAFKVDEKGLLNDCSAN-DCMWLARD  123

Query  115  DGF-YFSVDGINWRKDFSW  62
            DG   F+     +R+ + W
Sbjct  124  DGINLFNYPHKEYRQKYKW  142



>ref|XP_002518181.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44314.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 72/148 (49%), Gaps = 12/148 (8%)
 Frame = -2

Query  472  TILLLIVGMATYIAL---IVSTQP-----DTYFGNVYGVHIINGFTNNSSLPLVVWCNSG  317
            TI  LI  ++T + L   +++ +P     D      Y VH++NG ++N   PL + C S 
Sbjct  6    TIFSLIFLLSTTVYLHHPVLAWRPTLIETDKLMCITYRVHVMNGLSSNKD-PLFLHCQSR  64

Query  316  DGADIGGRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGRDVNRCS-PT  143
            D  D+G   L    DF++  +  L+  +  FSC M +  + +    F +  +   C    
Sbjct  65   DD-DLGDHTLYLGGDFNFKFRIKLFGKSTWFSCDMIWGSKHQHVDVFTEKIEGPMCCIEG  123

Query  142  RRCFWLVKEDGFYFSVDGINWRKDFSWM  59
              C W  ++DG YFS++ ++W K + W+
Sbjct  124  NSCHWRAQDDGIYFSMNNVDWIKRYDWL  151



>gb|KDP44347.1| hypothetical protein JCGZ_19214 [Jatropha curcas]
Length=156

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (45%), Gaps = 5/143 (3%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNS--SLPLVVWCNSGDGADI  302
             +++   +  A  I L  + +  +     Y VHIING  N     +P+   C   +   I
Sbjct  6    NSVIFYFLFTALAICLTHARESPSPPRFKYDVHIINGCENQKFPLIPINGSCVDENKHPI  65

Query  301  GGRALQE-RDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN--RCSPTRRCF  131
            G  +L+   D+F WSVK +   +  + C ++    +    AF Q RD    RC  T  C+
Sbjct  66   GTFSLRRFTDEFHWSVKINPRGHSTYVCHLRRADTKAGIVAFDQHRDDKDRRCKKTGMCW  125

Query  130  WLVKEDGFYFSVDGINWRKDFSW  62
            W V E G YFS    N+ K + W
Sbjct  126  WKVDEIGIYFSNQNYNYSKYYDW  148



>ref|XP_002523927.1| conserved hypothetical protein [Ricinus communis]
 ref|XP_002523929.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38496.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38498.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 4/112 (4%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT-NILFSCTMK  212
            + VHII+GF+NN++ PL++ C S D  D+G   L    DF++    +++     F+C+  
Sbjct  42   FRVHIIDGFSNNNN-PLLLHCWSLDD-DLGNHTLYIGGDFNFKFGLNVFGGKTRFTCSFN  99

Query  211  FDQQRRKFAAFAQGRDVNRCS-PTRRCFWLVKEDGFYFSVDGINWRKDFSWM  59
            +  + ++   F    + + C      C+W  ++DG YFSVD  NW K   W+
Sbjct  100  WGAKHQQIDVFRDNIEASLCCVGDDNCYWRTQDDGIYFSVDNQNWSKSVDWL  151



>gb|KDP33370.1| hypothetical protein JCGZ_12919 [Jatropha curcas]
Length=154

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 7/130 (5%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWS  260
            I++I + +  ++    Y VHIING  +    P+   C S    +IG   L    D++ WS
Sbjct  18   ISMIHAREGPSHPRFKYDVHIINGCESGIVRPISGTCRS-PTREIGTFDLPHLWDEYHWS  76

Query  259  VKPSLWTNILFSCTMK--FDQQRRKFAAFAQGRDV--NRCSPTRRCFWLVKEDGFYFSVD  92
             K +  +  ++ C +   F QQR  F AF Q  D   NRC  T  C+W + E G YF  +
Sbjct  77   FKLNRRSQHVYRCHVARGFGQQR-TFMAFDQQDDTKDNRCGRTGMCWWKITEVGIYFGNN  135

Query  91   GINWRKDFSW  62
               W K ++W
Sbjct  136  NATWTKAYNW  145



>ref|XP_009623632.1| PREDICTED: uncharacterized protein LOC104114805 [Nicotiana tomentosiformis]
Length=152

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 8/94 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VHIIN   N    P+ + C S D  D+G   LQ+ D+ SWS + + W   LF C +++D+
Sbjct  43   VHIINRLVNGK--PMTLHCQSHDN-DLGSSILQDGDEVSWSFRVNFWATTLFYCDVQWDK  99

Query  202  QR---RKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
                   F A+   RD  RC     C W++  +G
Sbjct  100  DSIIWYHFDAYDADRDYWRCQS--ECRWMITHEG  131



>ref|XP_010321598.1| PREDICTED: uncharacterized protein LOC104647671 [Solanum lycopersicum]
Length=140

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 7/117 (6%)
 Frame = -2

Query  439  YIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWS  260
            +I L +ST     F N + VHI+N   N+  +PL   C SG+  + G   L+   +F + 
Sbjct  11   FIVLYISTSTVDSFVNHWEVHIVNTLPNDD-IPLWYHCASGN-HNFGYDILRVGQNFHFD  68

Query  259  VKPSL-WTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTR----RCFWLVKEDGFY  104
             K +  W   LF C   + ++   F  F++G   + CS  R     CFW ++EDGF+
Sbjct  69   FKVNYPWKTTLFFCHFWWGEKENSFDVFSKGLMKHICSNVRDKIHSCFWKIQEDGFF  125



>ref|XP_010096912.1| hypothetical protein L484_008280 [Morus notabilis]
 gb|EXB66390.1| hypothetical protein L484_008280 [Morus notabilis]
Length=123

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 6/90 (7%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            + V C S D  D+G   L    +F WS   + W   LF C   +D  +  F  F   RD 
Sbjct  36   ITVHCASKD-TDLGTHKLTFGGNFHWSFNVNFWRTTLFYCDKSWDNVKGHFDVFMAKRDT  94

Query  160  NRCSPTRRCFWLVKEDGFYFSVDGINWRKD  71
            +RC+    CFW VK+DG Y  +    W  D
Sbjct  95   HRCAED-ECFWEVKKDGLYLYI----WEHD  119



>gb|KEH41902.1| leguminosin group486 secreted peptide [Medicago truncatula]
Length=134

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 58/131 (44%), Gaps = 15/131 (11%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            TQ IL+L V        ++S Q      NV GVH+  G     +L L V C S D  DIG
Sbjct  5    TQKILMLCV------LSLLSLQ------NVLGVHVTIGNNLAKNLDLTVHCKSADD-DIG  51

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
               L  RD F W    S      F C+ K++ + + F  + Q RD++ C     C W + 
Sbjct  52   IHLLHHRDIFGWHFGSSWIGQTRFYCSFKWNNELKWFDIYVQSRDLHVCDS--HCNWYII  109

Query  118  EDGFYFSVDGI  86
            + G    VD I
Sbjct  110  QSGPCRMVDAI  120



>ref|XP_004309599.1| PREDICTED: uncharacterized protein LOC101299438 [Fragaria vesca 
subsp. vesca]
Length=130

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 9/96 (9%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            +  ++ N    N++L  VV C S  G+D+G + +    DF+W+V      N + +C M +
Sbjct  24   HKANVFNNLPGNANL--VVHCTSA-GSDLGTQTITYLHDFTWTV------NNVLNCDMSW  74

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
               +  F  +   RD  RC+    CFW VKEDG Y 
Sbjct  75   GTVKGNFDIYDPKRDATRCAYGNTCFWRVKEDGLYL  110



>gb|EYU43812.1| hypothetical protein MIMGU_mgv1a024379mg [Erythranthe guttata]
Length=162

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 45/105 (43%), Gaps = 6/105 (6%)
 Frame = -2

Query  424  VSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSL  245
             S +  +  G    V + N    N +L L   C S D  D G   LQ  D F W  +P+ 
Sbjct  28   ASARKLSLLGRKTTVRVYNNLGENINLNLR--CKSKDN-DFGPHLLQNGDHFQWKFRPNF  84

Query  244  WTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            W   LFSC M++      F  +   RD +RC     C W V EDG
Sbjct  85   WGTTLFSCNMQWKNVTGGFNIYEDARDSDRCV---NCVWRVTEDG  126



>ref|XP_009372346.1| PREDICTED: uncharacterized protein LOC103961515 [Pyrus x bretschneideri]
Length=158

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 8/102 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y +H++N     +S  LV  C S D  D+G R L +  +F+WS + +L  + L+ C M  
Sbjct  45   YTLHVVNQM--GASRTLVAHCESLDD-DLGIRDLSDGTEFNWSFRENLSGSTLYWCDMHN  101

Query  208  DQQRRKFAAFAQGRDVN----RCSPTRRCFWLVKEDGFYFSV  95
            D Q   F  F    + +    RC+  + CFW+ KEDG Y  V
Sbjct  102  DHQHASFKVFWPESNHSWLRYRCN-YKECFWIAKEDGIYLRV  142



>ref|XP_008235750.1| PREDICTED: uncharacterized protein LOC103334549 [Prunus mume]
Length=144

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 55/114 (48%), Gaps = 8/114 (7%)
 Frame = -2

Query  394  NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTM  215
            N Y VH+ING + ++   L + C S D  D+G   L    +F W  + + +   LF C +
Sbjct  34   NKYRVHVINGLSKDT---LTIHCQSKD-TDLGIHELAVNQEFEWKFRTNFFETTLFFCNL  89

Query  214  KFDQQRRKFAAFAQGRD--VNRCSPTRRCFWLVKEDGF-YFSVDGINWRKDFSW  62
            +++   + F AF       +N CS    C WL ++DG   F+     +R+ + W
Sbjct  90   QWNGGHKSFDAFIVDEKGLLNDCSAN-DCMWLARDDGINLFNYPHKEYRQKYKW  142



>ref|XP_009800635.1| PREDICTED: uncharacterized protein LOC104246522 [Nicotiana sylvestris]
Length=136

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 8/105 (8%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+IN     +++   V C S D  D+G   LQ+ D+  WS + ++W   LF C +++D 
Sbjct  32   VHVINRLGKGNNMR--VHCQSHDN-DLGSSMLQDGDEVKWSFQENIWDTTLFCCDVQWDT  88

Query  202  QRR---KFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWR  77
                   F A+   RD NRC     C+W++ ++G  F  D  + R
Sbjct  89   DSSIWYHFDAYDADRDQNRCWS--ECWWIIFKEGLLFGYDQASHR  131



>gb|ACU31815.1| self-incompatibility protein [Platystemon californicus]
Length=131

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 21/125 (17%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
             ++LL  G A Y+ +               V I+N   N  S+   V C SGD  D+  +
Sbjct  17   VLILLEHGQANYVPI--------------HVRIMNRRGNGKSIE--VHCKSGDD-DLENQ  59

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFAQGRD-VNRCSPTRRCFWLVK  119
             + + D+  W+ K S W N LF C +K++++    F AF   RD + RC     C+WLV 
Sbjct  60   VVLDGDEQKWTFKESFWENTLFYCNLKWNEEVFSPFDAFDSERDNIGRCFTI--CYWLVT  117

Query  118  EDGFY  104
            E G Y
Sbjct  118  EIGLY  122



>ref|XP_004139726.1| PREDICTED: uncharacterized protein LOC101206205 [Cucumis sativus]
Length=146

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG +N     L V C S D  D+G + L  R DDF W+ K +++   LF C ++
Sbjct  34   YYVHVVNGLSNYD---LGVHCQSKDN-DLGYQHLINRGDDFQWNFKVNIFGTTLFWCKLE  89

Query  211  FDQQRRKFAAF-AQGRDV---NRCSPTRRCFWLVKEDGFYFSVDGIN  83
                   F +F  + R+    +RC P   C W  K+DG Y   +  N
Sbjct  90   KQDAYVSFESFWPESRNFWLRDRCGPQGNCIWTAKDDGIYLRNNPTN  136



>ref|XP_008458117.1| PREDICTED: uncharacterized protein LOC103497646 [Cucumis melo]
Length=136

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 48/101 (48%), Gaps = 9/101 (9%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMK  212
            Y +H++NG +N     L+V C S D  D+G   L  R DD+ W+ K + W   LF C ++
Sbjct  22   YYIHVMNGLSNAD---LIVHCQSKDD-DLGYHHLANRGDDYQWNFKENFWQTTLFWCKLE  77

Query  211  FDQQRRKFAAF-AQGRDV---NRCSPTRRCFWLVKEDGFYF  101
                   F +F  + +     +RC     C W  K+DG Y 
Sbjct  78   KQNVHVSFESFWPESKSTWLRDRCGYQGTCIWTAKDDGIYL  118



>gb|KEH41903.1| leguminosin group486 secreted peptide [Medicago truncatula]
Length=131

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 58/123 (47%), Gaps = 15/123 (12%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            TQ IL+L V        ++S Q      NV GVH+  G     +L L V C S D  DIG
Sbjct  5    TQKILMLCV------LSLLSLQ------NVLGVHVTIGNNLADNLDLTVHCKSADD-DIG  51

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
               L +RD F W    +      F C+ +++ + + F  + + RD+++C+    C W V 
Sbjct  52   IHLLHQRDIFGWHFGNNFIGETRFYCSFQWNDELKWFDIYVERRDLHKCNS--HCNWYVT  109

Query  118  EDG  110
            + G
Sbjct  110  QSG  112



>ref|XP_007200792.1| hypothetical protein PRUPE_ppa024473mg [Prunus persica]
 gb|EMJ01991.1| hypothetical protein PRUPE_ppa024473mg [Prunus persica]
Length=140

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 8/114 (7%)
 Frame = -2

Query  394  NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTM  215
            N Y VHIING TN +   L   C S D  D+G   L    +FSW  + + +   L+ C +
Sbjct  30   NKYRVHIINGLTNET---LTAHCKSKDD-DLGVHELAVDQEFSWEFRINFFDRTLYFCNL  85

Query  214  KFDQQRRKFAAFAQGRD--VNRCSPTRRCFWLVKEDGFY-FSVDGINWRKDFSW  62
             ++   + F AF       +N CS +  C W  ++DG Y F+     +R  + W
Sbjct  86   VWNGGHKTFDAFLVDEKALLNSCSSS-DCMWRARDDGVYLFNYPHKQYRLKYQW  138



>ref|XP_007163970.1| hypothetical protein PHAVU_L001700g, partial [Phaseolus vulgaris]
 gb|ESW35964.1| hypothetical protein PHAVU_L001700g, partial [Phaseolus vulgaris]
Length=132

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L++ C   D  D+G + L   D+FSWS K + +   LF C+ +++    +F  +   RD+
Sbjct  45   LLLHCKFADD-DLGVQHLHPHDNFSWSFKNNFFRTTLFHCSFQWESVLHRFDIYKANRDI  103

Query  160  NRCSPTRRCFWLVKEDG  110
            N C     C W+V+EDG
Sbjct  104  NIC---YLCSWVVREDG  117



>gb|ACU31814.1| self-incompatibility protein [Platystemon californicus]
Length=131

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (47%), Gaps = 21/124 (17%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            ++L   G A+Y+ +               V I+N   N  S+   V C SGD  D+G + 
Sbjct  18   LILFEHGQASYVPI--------------HVRIMNRRGNGKSIE--VHCKSGDN-DLGNQV  60

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFAQGRD-VNRCSPTRRCFWLVKE  116
            + + D+  W  K S W N LF C +K++++    F A+   RD   RC     C+WLV E
Sbjct  61   VLDGDEQKWKFKESFWENTLFYCNLKWNEEVFSPFDAYDSDRDNFGRCFSI--CYWLVTE  118

Query  115  DGFY  104
             G Y
Sbjct  119  VGLY  122



>ref|XP_004154487.1| PREDICTED: uncharacterized protein LOC101226577 [Cucumis sativus]
Length=143

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 9/107 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG +N     L V C S D  D+G + L  R DDF W+ K +++   LF C ++
Sbjct  31   YYVHVVNGLSNYD---LGVHCQSKDN-DLGYQHLINRGDDFQWNFKVNIFGTTLFWCKLE  86

Query  211  FDQQRRKFAAF-AQGRDV---NRCSPTRRCFWLVKEDGFYFSVDGIN  83
                   F +F  + R+    +RC P   C W  K+DG Y   +  N
Sbjct  87   KQDAYVSFESFWPESRNFWLRDRCGPQGNCIWTAKDDGIYLRNNPTN  133



>ref|XP_007041600.1| Plant self-incompatibility protein S1 family, putative [Theobroma 
cacao]
 gb|EOX97431.1| Plant self-incompatibility protein S1 family, putative [Theobroma 
cacao]
Length=135

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 7/119 (6%)
 Frame = -2

Query  457  IVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            ++G A  I LI+S        NV+ V + N   N  +L L   C S D  D+G + + + 
Sbjct  6    VIGNALVILLILSFCNSVRTDNVH-VSVKNRLGNGKNLTLH--CQSKD-TDLGEQNVGDG  61

Query  277  DDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
             +F W    ++W + LF C M +D  Q+  F A++  RD  RC    +C WLV  +G Y
Sbjct  62   GEFGWDFSVNVWGSTLFYCDMGWDAVQQYHFDAYSFDRDFARCET--QCSWLVSGEGMY  118



>ref|XP_011100197.1| PREDICTED: uncharacterized protein LOC105178433 [Sesamum indicum]
Length=2001

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/108 (30%), Positives = 54/108 (50%), Gaps = 7/108 (6%)
 Frame = -2

Query  409   DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNIL  230
             + + G  Y VHI+N    N+S PL V C S D  D+G   L+ +DDF+W    ++    L
Sbjct  1413  NVFPGQGYEVHIVNNLPFNAS-PLFVHCASKDD-DLGNHTLRLKDDFNWHFHMNIGLTTL  1470

Query  229   FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRR-----CFWLVKEDGFYF  101
             + C   ++ + +    F +   V+  S   +     CFW +++DGF+ 
Sbjct  1471  YYCRFMWESKNKICDVFNKNLAVDCESYDEKEDGNICFWSIRQDGFWL  1518



>ref|XP_007163969.1| hypothetical protein PHAVU_L001600g [Phaseolus vulgaris]
 gb|ESW35963.1| hypothetical protein PHAVU_L001600g [Phaseolus vulgaris]
Length=143

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L++ C S D  D+G + L  +  FSWS K + +   LF C+ ++D    +F  +   RD 
Sbjct  45   LLLHCKSADD-DLGVQHLHPQGTFSWSFKLNFFGTTLFHCSFQWDSVLHRFDIYKANRDA  103

Query  160  NRCSPTRRCFWLVKEDG  110
             RCS    C W+V+EDG
Sbjct  104  ARCS---LCSWVVREDG  117



>ref|XP_007034481.1| Plant self-incompatibility protein S1 family, putative [Theobroma 
cacao]
 gb|EOY05407.1| Plant self-incompatibility protein S1 family, putative [Theobroma 
cacao]
Length=131

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 10/107 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+IN    +S  P+ + C+S    D G + L   DD+   V+       L+ C     +
Sbjct  32   VHVINAMPRDSE-PMQIRCSS-KSTDHGMQELHVGDDYQCGVRE----KALYYCEAISGR  85

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            Q   + AF   RD N     +  FWLVKEDGFY S D  +W +   W
Sbjct  86   QIASWHAFQPRRDKNH----KAVFWLVKEDGFYLSWDNSSWVRKSGW  128



>ref|XP_008466659.1| PREDICTED: uncharacterized protein LOC103504014 [Cucumis melo]
Length=144

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 9/131 (7%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFG-NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            + IVG+   ++   + QP      + + ++++N  + +S   L + C S D  D+G R L
Sbjct  7    IAIVGVILTLSGQCNGQPGAEVPLSSWNINVLNEMSKDS---LFLHCKSKDD-DLGARNL  62

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAF---AQGRDVNRCSPTRRCFWLVKE  116
              +  FSWS K ++W   L+ C M        F  F     G    RC P R C W  ++
Sbjct  63   GIKQQFSWSFKENVWQTTLYWCYMHNANSHASFNVFWPEKSGWLAFRCQP-RNCIWSARD  121

Query  115  DGFYFSVDGIN  83
            DG Y   +  N
Sbjct  122  DGIYLKTNPHN  132



>ref|XP_007132764.1| hypothetical protein PHAVU_011G123100g [Phaseolus vulgaris]
 gb|ESW04758.1| hypothetical protein PHAVU_011G123100g [Phaseolus vulgaris]
Length=133

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 12/131 (9%)
 Frame = -2

Query  454  VGMATYIALIVSTQPDTY--FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQE  281
            V +  +  L +  QP T   FG    V + NG      +  ++ C S D  D+G + +  
Sbjct  3    VTVKKFFLLFLLVQPSTSISFGPKITVVVQNGLQGGRDM--LLHCESADD-DLGVQLIHP  59

Query  280  RDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG---  110
             + F W  + +++   LF C+ +++    KF  +   RD N C     C W+VKEDG   
Sbjct  60   NNSFQWKFQNNVFGRTLFHCSFQWESVLHKFVIYKTSRDHNTC---HICNWIVKEDGPCL  116

Query  109  -FYFSVDGINW  80
             F    D  NW
Sbjct  117  IFSGRTDCYNW  127



>ref|XP_002532042.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30332.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 51/121 (42%), Gaps = 9/121 (7%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            L +I+ +    +  V+ +P TY      VHIING    +   L + C S D  D+G   L
Sbjct  8    LFIILAIMAMNSPCVNARPKTY------VHIINGLV--AKYVLNIHCYSRDD-DLGHHTL  58

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
                 F WS   S++ N +F C M +      F  F +   + R      C WL   DG 
Sbjct  59   PVSGHFDWSFGTSIFGNTVFKCDMNWAGGHGVFKVFWEDEQLQRKCHFNNCIWLAAIDGL  118

Query  106  Y  104
            Y
Sbjct  119  Y  119



>gb|ACV41067.1| self-incompatibility protein [Platystemon californicus]
Length=105

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFAQGRD  164
            + V C SGD  D+G + + + D+  W  K S W N LF C +K++++    F AF   RD
Sbjct  10   IEVHCKSGDN-DLGNQVVLDGDEQKWKFKESFWENTLFYCNLKWNEEVFSPFDAFDSERD  68

Query  163  -VNRCSPTRRCFWLVKEDGFY  104
             + RC     C+WLV E G Y
Sbjct  69   NIGRCFTI--CYWLVTELGLY  87



>gb|KDO55826.1| hypothetical protein CISIN_1g039189mg [Citrus sinensis]
Length=125

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 9/112 (8%)
 Frame = -2

Query  397  GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCT  218
            G+   VH+IN     S+ P+ + CNS    ++  + L+  DD+ W V+    T   + C 
Sbjct  20   GSSIEVHVINALPRGSA-PMEIRCNS-RSTNLDAKQLKSGDDYRWIVQKERAT---YLCA  74

Query  217  MKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
              +  +   +  F   RD N+ S     FWLVKE+GF+   D  +W K  +W
Sbjct  75   ALWVNKIASWHGFQPRRDANQKS----VFWLVKENGFFLGFDNSSWVKKSTW  122



>ref|XP_006841528.1| hypothetical protein AMTR_s00003p00152430 [Amborella trichopoda]
 gb|ERN03203.1| hypothetical protein AMTR_s00003p00152430 [Amborella trichopoda]
Length=135

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 6/94 (6%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            + I N      SL L   C S D  D+G + L+E + F +   P+ +   LF C M++++
Sbjct  30   IQITNRLGGERSLNLH--CQSKDD-DLGKQTLKEGNSFRFEFSPNFFGGTLFYCDMEWER  86

Query  202  -QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
              +  F A+++ RDV++C    +C WLV E+G Y
Sbjct  87   VSKFSFDAYSEERDVDQCRS--KCMWLVAEEGIY  118



>gb|EYU25357.1| hypothetical protein MIMGU_mgv1a025761mg [Erythranthe guttata]
Length=139

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 8/128 (6%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            LLLI+    +++  V      +F   Y V ++N    N+S  L + C SGD  ++G R +
Sbjct  10   LLLII----FLSANVFQATSCFFARKYKVQVVNRLPPNNS-SLFLHCASGDD-ELGRRTI  63

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
              R  F W+   S ++  LF C + +  + R F  F     +N C  +  C W    DG 
Sbjct  64   YARQTFEWAFCASGFSKTLFFCQLWWGSKDRAFEVFNSKHSINDCR-SFLCSWSAMSDGI  122

Query  106  YFSVDGIN  83
            Y+  DG N
Sbjct  123  YYQ-DGQN  129



>ref|XP_004139722.1| PREDICTED: uncharacterized protein LOC101205020 [Cucumis sativus]
Length=142

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + +H++NG +N +   L+V C SGD  D+G + L    +F W+ + SL+   LF C ++ 
Sbjct  31   WHIHVVNGLSNET---LLVHCKSGDD-DLGIQHLVRGAEFHWTFRVSLFGRTLFWCYLEK  86

Query  208  DQQRRKFAAFAQGRDV---NRCSPTRRCFWLVKEDGFYFSVDGIN  83
                  F +F   + V   +RC   + C W+ K+DG Y   + +N
Sbjct  87   PNFSVSFESFWVEKHVWLNSRCY-DKNCIWIAKDDGIYLRNNPVN  130



>ref|XP_004164445.1| PREDICTED: uncharacterized protein LOC101226385 [Cucumis sativus]
Length=142

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + +H++NG +N +   L+V C SGD  D+G + L    +F W+ + SL+   LF C ++ 
Sbjct  31   WHIHVVNGLSNET---LLVHCKSGDD-DLGIQHLVRGAEFHWTFRVSLFGRTLFWCYLEK  86

Query  208  DQQRRKFAAFAQGRDV---NRCSPTRRCFWLVKEDGFYFSVDGIN  83
                  F +F   + V   +RC   + C W+ K+DG Y   + +N
Sbjct  87   PNFSVSFESFWVEKHVWLNSRCY-DKNCIWIAKDDGIYLRNNPVN  130



>ref|XP_004494009.1| PREDICTED: uncharacterized protein LOC101507373 [Cicer arietinum]
Length=148

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (47%), Gaps = 13/139 (9%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            ++LL+++ +      + ++Q +++FG    V I N     S L  +V C SGD  D+G +
Sbjct  9    SVLLVVIRVG-----VQASQTNSFFGGRSSVLITNDLPAPSKL--IVHCKSGD-DDLGIQ  60

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
             L       W+ +P+++   LF C   +D        F    D   C  T  C   V++D
Sbjct  61   NLPTGGQKYWTFRPNIFGTTLFYCYFNWDNMVMSVEVFNDKHDGGEC--TGHCLRSVRKD  118

Query  112  GFYF--SVDGINWRKDFSW  62
            G YF  + DG+ W +  SW
Sbjct  119  GIYFLNAKDGL-WERKKSW  136



>ref|XP_006361278.1| PREDICTED: uncharacterized protein LOC102588639 [Solanum tuberosum]
Length=158

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 12/136 (9%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNV---YGVHIINGFTNNS---SLPLVVWCNSG  317
            T+  LLL++     I L++ T   ++  NV   +   +   F +N    + P+ V C S 
Sbjct  7    TKVQLLLLISFI--INLVMMTNVSSFEPNVTESFEPQVTEIFVSNVPYITAPVRVHCQSE  64

Query  316  DGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCS-PTR  140
            D  D+G R L+ ++ F +S + + W N  F C   +  +   F  + + +   R   P +
Sbjct  65   DD-DLGVRTLERKEKFDFSFRQNFWGNTHFYCAFSWGLKNNAFDVYFKRKSPCRFKFPMK  123

Query  139  --RCFWLVKEDGFYFS  98
               C WLVKE GFYF+
Sbjct  124  DIYCTWLVKESGFYFA  139



>gb|EYU39652.1| hypothetical protein MIMGU_mgv1a022491mg, partial [Erythranthe 
guttata]
Length=133

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 47/101 (47%), Gaps = 6/101 (6%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y V+I+N    NS LPL+  C S +  D+G R LQ    F+WS   S   N LF C  ++
Sbjct  26   YTVYIVNSLPRNS-LPLIAHCASKND-DLGNRTLQAGQSFNWSFCDSYIENTLFFCNFRW  83

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGI  86
              + R F  +      +     + C+W    +G  F  DG+
Sbjct  84   GSKHRAFNVYTSKHRAD--CFKKACYWEADPEGILF--DGV  120



>ref|XP_002301828.2| hypothetical protein POPTR_0002s25380g, partial [Populus trichocarpa]
 gb|EEE81101.2| hypothetical protein POPTR_0002s25380g, partial [Populus trichocarpa]
Length=155

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 4/126 (3%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDT-YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            T  +L L +        + + +    Y    + V+++NG +NN  L   V C S D  D+
Sbjct  13   TALVLALAINFTHQYCFVAAKKERILYEFTTWHVYVVNGLSNNRELS--VHCKSKDD-DL  69

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            G   L   D+F+WS +   +   LF C +  D     F  F     +      + C W V
Sbjct  70   GFHCLSAGDNFTWSFREDFFLRTLFWCDVNKDDAHAVFKVFWHDVLLFYKCMWKNCVWTV  129

Query  121  KEDGFY  104
            K+DG Y
Sbjct  130  KDDGIY  135



>ref|XP_002521143.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41294.1| conserved hypothetical protein [Ricinus communis]
Length=139

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 53/113 (47%), Gaps = 6/113 (5%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            +A+     P+      Y VHIIN   N+  L   V C S D  D+G   LQ    +SW  
Sbjct  12   LAMSFFVTPNNCSDLSYHVHIINEMKNHKFLH--VHCKSKDD-DLGIHHLQHGQQYSWHF  68

Query  256  KPSLWTNILFSCTMKFDQQ-RRKFAAFAQGRDV-NRCSPTRRCFWLVKEDGFY  104
              +++   LF C M  D +   +F  F   + + +RC P   C+W+ K+DG Y
Sbjct  69   NINIFATTLFWCYMSPDHKLHARFDVFWDAKYLYDRCGP-HDCWWVAKDDGAY  120



>ref|XP_011042558.1| PREDICTED: uncharacterized protein LOC105138215 [Populus euphratica]
Length=170

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 46/98 (47%), Gaps = 5/98 (5%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y +HI+NG + N  L  +V C S +  D+G   +    +F WS + ++W   LF C +  
Sbjct  57   YHLHILNGLSPNKIL--LVHCQSKNN-DLGVHNIPVNSEFEWSFRSNVWGTTLFWCYLAP  113

Query  208  DQQRR-KFAAFAQGRDV-NRCSPTRRCFWLVKEDGFYF  101
            D      F AF     + + C     C W+ K+DG Y 
Sbjct  114  DDHSHADFNAFQDKEKITDSCDGNGNCCWIAKDDGVYL  151



>gb|EYU39676.1| hypothetical protein MIMGU_mgv1a021328mg [Erythranthe guttata]
Length=162

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 7/140 (5%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            + LI+    + +  ++ QP+  F   + + ++N     S  PL + C S +  D+G   L
Sbjct  16   IFLILQSIIFKSTTIAPQPNCVFTRKWEIRVVNRLPLYSIEPLQLHCASKN-KDLGNHTL  74

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFA--QGRDVNRCSPTRRCFWLVKE  116
               +D SWS   +++ N LF C +K++  R  K  AF     + +  C  +  C+W   E
Sbjct  75   DVFEDLSWSFCDNIFGNTLFFCHLKWNSNRGPKHKAFDVFTSKWLAECG-SGICYWSADE  133

Query  115  DGFYF--SVDGINWRKDFSW  62
            DG  F  S    +W+K + W
Sbjct  134  DGIRFTGSDPPNHWQKIYDW  153



>ref|XP_004136435.1| PREDICTED: uncharacterized protein LOC101208617 [Cucumis sativus]
Length=144

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (46%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + V+I+N  T +S   L + C S D  D+G + L  +  FSWS K +LW   L+ C M  
Sbjct  33   WKVNILNEMTKDS---LFIRCKSKDD-DLGAQNLGVKQQFSWSFKENLWQTTLYWCYMHN  88

Query  208  DQQRRKFAAFAQGRD---VNRCSPTRRCFWLVKEDGFYFSVDGIN  83
             +    F  +   R      RC   R C W  ++DG Y   +  N
Sbjct  89   AKSHASFNVYWPERSGWLAFRCQ-LRNCIWSARDDGIYLKTNTHN  132



>ref|XP_004154484.1| PREDICTED: uncharacterized protein LOC101225891 [Cucumis sativus]
Length=155

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 46/102 (45%), Gaps = 10/102 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL-QERDDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG  ++S   L V C S D  D+G   L +  DDF W+   +LW   LF C ++
Sbjct  41   YYVHVLNGLNHHS---LDVHCQSKDN-DLGHHYLVKHGDDFQWNFIENLWRTTLFWCRLE  96

Query  211  FDQQRRKFAAFAQGRDVN-----RCSPTRRCFWLVKEDGFYF  101
                   F +F      N     RC     C W  K+DG Y 
Sbjct  97   KSDAYVSFESFWPESLKNPWLRHRCGTQLTCLWTAKDDGIYL  138



>ref|XP_009611687.1| PREDICTED: uncharacterized protein LOC104105143 [Nicotiana tomentosiformis]
Length=146

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 13/113 (12%)
 Frame = -2

Query  421  STQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW  242
            ST    +F   Y VHIIN   +N+  PL + C SGD  D G       +D++WS   +L+
Sbjct  21   STARKCFFTPKYEVHIINNLPSNTP-PLKIHCASGDD-DFGDYFPSINEDYNWSFCGNLF  78

Query  241  TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSP-------TRRCFWLVKEDGFY  104
               L+ C   +++++     F    + N C         +R+C W+VK DGFY
Sbjct  79   GKSLYFCHFWWEKEK----VFDVFNNTNTCVSGGQIPYFSRQCVWVVKSDGFY  127



>ref|XP_008372611.1| PREDICTED: uncharacterized protein LOC103435959 [Malus domestica]
Length=211

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 8/102 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + VH++N     +   L   C S +  DIG R +    + +WS KP+ +   L+ C  + 
Sbjct  98   WHVHVVNNL--GAGKTLFAHCQSKND-DIGNRTIAPGAEITWSFKPNFFGTTLYWCYTRT  154

Query  208  DQQRRKFAAFAQGRDVN----RCSPTRRCFWLVKEDGFYFSV  95
            D +   F  + +    N    RC+  + CFW+ K+DGFY  V
Sbjct  155  DHEHTAFDVYWEESKHNWLRYRCN-YKECFWIAKDDGFYIRV  195



>ref|XP_004165662.1| PREDICTED: uncharacterized protein LOC101227752 [Cucumis sativus]
Length=144

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (46%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + V+I+N  T +S   L + C S D  D+G + L  +  FSWS K +LW   L+ C M  
Sbjct  33   WKVNILNEMTKDS---LFIRCKSKDD-DLGAQNLGVKQQFSWSFKENLWQTTLYWCYMHN  88

Query  208  DQQRRKFAAFAQGRD---VNRCSPTRRCFWLVKEDGFYFSVDGIN  83
             +    F  +   R      RC   R C W  ++DG Y   +  N
Sbjct  89   AKSHASFNVYWPERSGWLAFRCQ-LRNCIWSARDDGIYLKTNTHN  132



>ref|XP_010043344.1| PREDICTED: uncharacterized protein LOC104432574 [Eucalyptus grandis]
Length=145

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 17/123 (14%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            + LL+ G  ++ AL+ S            VH+       S   + + C S D  D+G + 
Sbjct  13   VFLLLTG--SFFALVFSE-----------VHVSVKNRLGSGKNMTLHCQSED-DDLGEQN  58

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            + +  +F W    ++W   LF C M ++  Q  +F A++  RD+ RC    +C WLV E+
Sbjct  59   VADGSEFGWDFNVNVWGTTLFYCDMGWESVQDYQFDAYSFARDLVRCDA--QCLWLVSEE  116

Query  112  GFY  104
            G Y
Sbjct  117  GMY  119



>ref|XP_002297828.1| hypothetical protein POPTR_0001s14160g [Populus trichocarpa]
 gb|EEE82633.1| hypothetical protein POPTR_0001s14160g [Populus trichocarpa]
Length=133

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 50/107 (47%), Gaps = 10/107 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V +IN    NS  P+ V C S    +IG R+L   + F W          L SC   +++
Sbjct  34   VQVINALPKNSK-PMQVSC-STKNINIGKRSLVNGEVFKWRAA----QRKLHSCGALWER  87

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
                + AF   RD N  +     +W+VKEDGF+ S D  NW + + W
Sbjct  88   LFASWHAFQPRRDENHET----VYWMVKEDGFFISWDKANWVRKYRW  130



>gb|EYU31747.1| hypothetical protein MIMGU_mgv1a025844mg [Erythranthe guttata]
Length=132

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 47/98 (48%), Gaps = 4/98 (4%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VH++N    ++  P+   C SGD  ++G   L   DDF+WS+        LF C + +
Sbjct  28   YIVHVVNKIRPDAG-PMFAHCASGD-KELGNHTLYYNDDFNWSLCEGFLHRTLFFCRITW  85

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSV  95
              +   F  + +  D   C  T  C+W  + DG YFSV
Sbjct  86   GSKSVSFDVY-RSSDRGEC-LTDVCYWEARLDGIYFSV  121



>ref|XP_002521145.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41296.1| conserved hypothetical protein [Ricinus communis]
Length=148

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 57/127 (45%), Gaps = 10/127 (8%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
            + + + ++ M+ Y+     T  +  F   Y VH++NG +      L V C S D  ++GG
Sbjct  9    KLLFMFVIAMSFYV-----TPNNCQFFIRYHVHVVNGLS--PGKILFVHCKSADN-NLGG  60

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFAQGRD-VNRCSPTRRCFWLV  122
              +    +FSWS K +     L+ C M  D Q       F   +  ++ C    +C W+ 
Sbjct  61   YNVGNGQEFSWSFKMNFLRRTLYWCRMAPDNQSYADLKVFWDDKHLLDSCGDDHQCIWIA  120

Query  121  KEDGFYF  101
            K+DG Y 
Sbjct  121  KDDGVYL  127



>ref|XP_009372327.1| PREDICTED: uncharacterized protein LOC103961497 [Pyrus x bretschneideri]
Length=151

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 10/133 (8%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYF--GNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
               L +   +A     + +   D +      + VH++N      +L     C S +  DI
Sbjct  7    HAFLFVCAALALSAPCLANFHEDNWELRPETWHVHVVNNLGARKTL--FAHCQSKND-DI  63

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN----RCSPTRRC  134
            G   +    + +WS KP+ +   L+ C  + D +   F  + +    N    RC+  + C
Sbjct  64   GNHTIAPGAEITWSFKPNFFGTTLYWCYTRTDHEHTAFDVYWEESKHNWLRYRCN-YKEC  122

Query  133  FWLVKEDGFYFSV  95
            FW+ K+DGFY  +
Sbjct  123  FWIAKDDGFYIRI  135



>ref|XP_002312833.1| hypothetical protein POPTR_0009s16270g [Populus trichocarpa]
 gb|EEE86788.1| hypothetical protein POPTR_0009s16270g [Populus trichocarpa]
Length=150

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 63/134 (47%), Gaps = 16/134 (12%)
 Frame = -2

Query  445  ATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFS  266
            A ++ L ++  P T     + V I+N  +N   L     C SGD  D+G + ++ RD+F 
Sbjct  8    AIFLLLAIAITPST----AWTVRIVNRLSNKKVL--FAHCKSGDD-DLGPQYIKTRDEFK  60

Query  265  WSVKPSLWTNILFSCTMKFDQQRRK----FAAFAQ-----GRDVNRCSPTRRCFWLVKED  113
            +S + + +   LF C M  D++       F +F+      G D++  +      W+V++D
Sbjct  61   FSFRVNFFRTTLFWCNMSKDKKSHASLDVFWSFSNAGKHGGFDLSTWAVNEEALWIVRDD  120

Query  112  GFYFSVDGINWRKD  71
            G Y  +    W +D
Sbjct  121  GIYLWMKAPGWPED  134



>ref|XP_002521146.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41297.1| conserved hypothetical protein [Ricinus communis]
Length=138

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 58/124 (47%), Gaps = 10/124 (8%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            + +L++ +  Y+     T     F   + VH++NG + +  L   V C S D  D+G R 
Sbjct  6    LFILLLALGFYV-----TPNSCKFFPKFHVHVVNGLSPDKIL--FVHCKSADN-DLGARN  57

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRR-KFAAFAQGRDVN-RCSPTRRCFWLVKE  116
            L    +FSWS + + +   L+ C M  D         F   + ++ RC   ++C W+ K+
Sbjct  58   LSNGQEFSWSFRMNFFMTTLYWCHMAPDDHSYVDMKVFWDSQYLSERCGHDQQCIWIAKD  117

Query  115  DGFY  104
            +G Y
Sbjct  118  NGVY  121



>ref|XP_011084267.1| PREDICTED: uncharacterized protein LOC105166571 [Sesamum indicum]
Length=128

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 13/108 (12%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+ N     S+ PL + C S D  D+G   L    +FSWS   S   + LF C +    
Sbjct  33   VHLANQL---SAGPLTIHCQSKDD-DLGIHTLATNQEFSWSFCDSAVLSTLFYCDISAGS  88

Query  202  QRRKFAAF-AQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSW  62
            + + F A+ +  RD  R     +C W VK+DG Y     ++  K FSW
Sbjct  89   KSKHFDAYTSTSRDACR---NNQCNWFVKDDGIY-----LDQAKYFSW  128



>ref|XP_006340966.1| PREDICTED: uncharacterized protein LOC102582018 [Solanum tuberosum]
Length=247

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 11/107 (10%)
 Frame = -2

Query  394  NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTM  215
            N   VH+++G   N    L+  C SG   D+G    +  DDF +S K +++   +F C  
Sbjct  26   NAITVHVVDGIEKNDPQ-LIYHCASG-SDDLGKHYPKFNDDFHFSFKRNIFFETVFFCHF  83

Query  214  KFDQQRRKFAAFAQGRDVNRC------SPTRRCFWLVKEDGFYFSVD  92
             + ++  KF  +   R+   C      S    C+WLVKEDGFYF+++
Sbjct  84   WWGKKDIKFEVY---RETGACGHETGGSNKGICYWLVKEDGFYFAIN  127



>ref|XP_007163964.1| hypothetical protein PHAVU_L001200g [Phaseolus vulgaris]
 gb|ESW35958.1| hypothetical protein PHAVU_L001200g [Phaseolus vulgaris]
Length=143

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (45%), Gaps = 8/121 (7%)
 Frame = -2

Query  460  LIVGMATYIALIVSTQPDTYFG----NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGR  293
            + V + ++  L +  QP T       N+    +I G        L V C S D  D+G +
Sbjct  1    MYVTLKSFFLLWLLLQPSTSHAFSVPNLPQRTVIVGNDLRGGQDLFVHCKSADD-DLGVQ  59

Query  292  ALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
             L     FSW  + + +   LF C+ +++     F  +   RD +RCS    C W+V+ED
Sbjct  60   ELHPHRYFSWGFEINFFKTTLFHCSFQWESVLHTFDIYKASRDADRCS---LCSWVVRED  116

Query  112  G  110
            G
Sbjct  117  G  117



>ref|XP_007133349.1| hypothetical protein PHAVU_011G171900g [Phaseolus vulgaris]
 gb|ESW05343.1| hypothetical protein PHAVU_011G171900g [Phaseolus vulgaris]
Length=151

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (52%), Gaps = 4/77 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L + C S D  D+G + L     FSWS K + +   L+ C+ ++D    +F  +   RD 
Sbjct  53   LFLHCESAD-YDLGVQHLHPHGTFSWSFKLNFFGTTLYHCSFQWDFVLHRFDIYKANRDA  111

Query  160  NRCSPTRRCFWLVKEDG  110
             RCS    C W+V+EDG
Sbjct  112  ARCS---LCSWVVREDG  125



>ref|XP_002523920.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38489.1| conserved hypothetical protein [Ricinus communis]
Length=133

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 44/91 (48%), Gaps = 6/91 (7%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VHI     NN  + L V C S D  D+G   L +++ + +  KP+ W N LF C+  +  
Sbjct  31   VHI--NIINNFGVDLTVHCKSKDD-DLGAHLLHDQEAYRFGFKPNYWGNTLFYCSFAWTG  87

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            + + F  +   RD  RC     C W V E+G
Sbjct  88   EVKWFDIYVDERDYGRCLD---CKWRVDENG  115



>gb|ACV41069.1| self-incompatibility protein [Platystemon californicus]
Length=105

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQR-RKFAAFAQGR  167
             + V C SGD  D+G + + + D+  W  K S W N LF C +K++++    F A+   R
Sbjct  9    SIEVHCKSGDN-DLGNQVVLDGDEQKWKFKESFWENTLFYCNLKWNEEVFSPFDAYDSDR  67

Query  166  D-VNRCSPTRRCFWLVKEDGFY  104
            D   RC     C+WLV E G Y
Sbjct  68   DNFGRCFSI--CYWLVTEVGLY  87



>gb|KCW85351.1| hypothetical protein EUGRSUZ_B02182 [Eucalyptus grandis]
Length=171

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 17/123 (14%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
            + LL+ G  ++ AL+ S            VH+       S   + + C S D  D+G + 
Sbjct  39   VFLLLTG--SFFALVFSE-----------VHVSVKNRLGSGKNMTLHCQSED-DDLGEQN  84

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFAAFAQGRDVNRCSPTRRCFWLVKED  113
            + +  +F W    ++W   LF C M ++  Q  +F A++  RD+ RC    +C WLV E+
Sbjct  85   VADGSEFGWDFNVNVWGTTLFYCDMGWESVQDYQFDAYSFARDLVRCDA--QCLWLVSEE  142

Query  112  GFY  104
            G Y
Sbjct  143  GMY  145



>ref|XP_010321599.1| PREDICTED: uncharacterized protein LOC104647673 [Solanum lycopersicum]
Length=175

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 64/143 (45%), Gaps = 17/143 (12%)
 Frame = -2

Query  457  IVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            I+ +  YI  I            + VHIIN   +N+ +PL + C S    D G R L+  
Sbjct  40   ILLLTLYIVSITPEATKVDSDARFEVHIINDLPDNN-IPLWIHCKSK-THDFGNRLLKVE  97

Query  277  DDFSWSVKPSLW-TNILFS---------CTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFW  128
            DDF++  K +L+ TN+ FS             +++  +K+ A  Q       +  R C+W
Sbjct  98   DDFTFWFKLNLFETNLYFSHFWWGKKHNVFDVYNRHLKKYCAKPQPT-----TDIRTCYW  152

Query  127  LVKEDGFYFSVDGINWRKDFSWM  59
             V+EDGFY   +     K   W+
Sbjct  153  KVQEDGFYLGANADITEKMHDWL  175



>ref|XP_006420540.1| hypothetical protein CICLE_v10006894mg, partial [Citrus clementina]
 gb|ESR33780.1| hypothetical protein CICLE_v10006894mg, partial [Citrus clementina]
Length=105

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  352  SSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQ  173
            S   + V C SGD  D+G   L+ R++F W+   +     L+ C +    +  +F AF  
Sbjct  11   SGEDITVHCKSGD-DDLGPHVLKTRENFHWNFHGNFGGTTLYFCHVTTQDKSTRFDAFKY  69

Query  172  GRDVNRCSPTRRCFWLVKEDG  110
             +D  RCSP  +C W V++ G
Sbjct  70   SKDRQRCSP--KCTWKVQKSG  88



>ref|XP_004136434.1| PREDICTED: uncharacterized protein LOC101208376 [Cucumis sativus]
Length=144

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (46%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + ++I+N  T ++   L + C S D  D+G + L  +  FSWS K +LW   L+ C M  
Sbjct  33   WKINILNEMTKDT---LFLQCKSKDD-DLGAQNLGVKQQFSWSFKENLWQTTLYWCYMHN  88

Query  208  DQQRRKFAAF---AQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
             +    F  F     G    RC   R C W  ++DG Y   +  N
Sbjct  89   AESHASFNVFWPEKSGWLAFRCQ-LRNCIWSARDDGIYLKTNPHN  132



>gb|EYU39657.1| hypothetical protein MIMGU_mgv1a025732mg, partial [Erythranthe 
guttata]
Length=125

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 47/97 (48%), Gaps = 6/97 (6%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y +H++N      S  L + C S D  D+G R   E  DF+W    S W+N LF C++ +
Sbjct  19   YTIHVVNKL---PSPQLNLHCASKDN-DLGYRTTSENYDFTWKFCESFWSNTLFFCSLAW  74

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFS  98
                  F  F + +  + C     C++ + EDG YF+
Sbjct  75   KNNHVSFDVF-KSKKSDECF-DGTCYYEIWEDGIYFA  109



>ref|XP_007049876.1| S-protein, putative [Theobroma cacao]
 gb|EOX94033.1| S-protein, putative [Theobroma cacao]
Length=160

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 42/98 (43%), Gaps = 3/98 (3%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
             + +H +NG ++   L L   C SGD  D+G   L    +F+W  KP +    LF C M 
Sbjct  42   TWHIHAVNGMSHEKILFLH--CKSGDN-DLGIHNLTAGTEFNWKFKPQILGKTLFWCYMA  98

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFS  98
            +      F  F    D+      + C W  K+DG Y  
Sbjct  99   WGNVHASFKVFWDDNDLFYRCNWKNCIWTAKDDGVYLK  136



>ref|XP_008235749.1| PREDICTED: uncharacterized protein LOC103334548 [Prunus mume]
Length=143

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 54/122 (44%), Gaps = 8/122 (7%)
 Frame = -2

Query  418  TQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWT  239
            TQ      N   VHIING TN +   L   C S D  D+G   L    +FSW  + + + 
Sbjct  25   TQVTYSLFNKCRVHIINGLTNET---LTAHCKSKDD-DLGVHELAVDQEFSWEFRINFFD  80

Query  238  NILFSCTMKFDQQRRKFAAFAQGRD--VNRCSPTRRCFWLVKEDGFY-FSVDGINWRKDF  68
              L+ C + +    + F AF       +N CS +  C W  ++DG Y F+     +R  +
Sbjct  81   RTLYFCNLVWKGGHKTFDAFLVDEKALLNSCSSS-DCMWRARDDGVYLFNYPHKQYRLKY  139

Query  67   SW  62
             W
Sbjct  140  QW  141



>ref|XP_006353389.1| PREDICTED: uncharacterized protein LOC102595672 [Solanum tuberosum]
Length=128

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + VHIIN  +NN + P  V C S D  D+G +  +  DD+++S   ++     F C   +
Sbjct  16   FTVHIINALSNNDT-PFSVQCKSQDD-DLGLKTPKVGDDYTFSFHMNVLKTTRFYCHYSW  73

Query  208  DQQRRKFAAFAQGRDVNRCSPTR----RCFWLVKEDGFYF  101
              +++ F  F + +    C         CFW V++DGFYF
Sbjct  74   GSKKQLFDVFNRYQSY-ECGKINGNDYECFWKVQDDGFYF  112



>ref|XP_008462114.1| PREDICTED: uncharacterized protein LOC103500542 [Cucumis melo]
Length=145

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + +H++NG +N +   L+V C S D  D+G + L +  +F W+ + SL+   LF C ++ 
Sbjct  34   WHIHVVNGLSNET---LLVHCKSRDD-DLGIQHLVKGAEFHWTFRVSLFGRTLFWCYLEK  89

Query  208  DQQRRKFAAFAQGRDV---NRCSPTRRCFWLVKEDGFYFSVDGIN  83
                  F +F   + V   +RC   + C W+ K+DG Y   + +N
Sbjct  90   PNFSVSFESFWVEKHVWLNSRCY-DKNCIWIAKDDGIYLRNNPVN  133



>gb|ACV41021.1| self-incompatibility protein [Argemone munita]
Length=108

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 7/95 (7%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V I+N   N  S+   V C S D  D+  + + + ++  W+ K S+W N  FSC +K+++
Sbjct  1    VRIMNRRGNGKSIE--VHCRSLDN-DLDNQVVADGNELKWTFKESIWENTRFSCDLKWNE  57

Query  202  QRR-KFAAFAQGRD-VNRCSPTRRCFWLVKEDGFY  104
                 F A+   RD + RCS   +C W + EDG Y
Sbjct  58   MYNFHFDAYWSVRDNLGRCST--KCLWKILEDGLY  90



>ref|XP_009779365.1| PREDICTED: uncharacterized protein LOC104228586 [Nicotiana sylvestris]
Length=145

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPS-LWTNILFSCTMK  212
            Y V+I +   NN+  PL V C SGD  D+G + L   ++FS+S +   L  + L+ C   
Sbjct  31   YNVYITSNLPNNTQ-PLTVHCQSGDD-DLGYKVLHPNEEFSFSFRRKVLIGSTLYFCHFW  88

Query  211  FDQQRRKFAAFAQGRDVNRCSPTR----RCFWLVKEDGFYF  101
            ++ + + F  F        C         C+W V+ DGFYF
Sbjct  89   WENKDKSFEVFNNHIAEKDCGNVNGDLDECYWRVQADGFYF  129



>gb|EYU38072.1| hypothetical protein MIMGU_mgv1a025879mg, partial [Erythranthe 
guttata]
Length=94

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 42/88 (48%), Gaps = 2/88 (2%)
 Frame = -2

Query  352  SSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQ  173
            SS PL++ C S D   +G   L    DF +    S++ +  F+C  +++ +++ F  F  
Sbjct  9    SSPPLLLTCASKDDK-LGNHTLYVNQDFHFHFCESVFADTTFACEFRWESKKKLFDVFNA  67

Query  172  GRDVNRCSPTRRCFWLVKEDGFYFSVDG  89
             R    C     C+W  K DG YFS D 
Sbjct  68   AR-RKLCGKDNFCYWAAKTDGIYFSNDN  94



>ref|XP_008461966.1| PREDICTED: uncharacterized protein LOC103500444 [Cucumis melo]
Length=352

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 9/125 (7%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVST----QPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGAD  305
            TI LL+  +   I++  S+    +   +   +  V+I N  T+   L   V C SGD  D
Sbjct  54   TIFLLVFALCLLISIFFSSLFTIEGKPFQNPLVTVNITNALTHKDQL--TVHCKSGDD-D  110

Query  304  IGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWL  125
            +G   LQ    ++++ +P+     LF CT ++      F  +   RD +RC+    C W+
Sbjct  111  LGVHQLQPLGGYAFTFRPNFIGTTLFYCTFQWPGWSHNFDIYKDSRDRDRCN--GLCLWI  168

Query  124  VKEDG  110
            V E G
Sbjct  169  VGEQG  173



>ref|XP_007163968.1| hypothetical protein PHAVU_L001500g, partial [Phaseolus vulgaris]
 gb|ESW35962.1| hypothetical protein PHAVU_L001500g, partial [Phaseolus vulgaris]
Length=94

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 43/83 (52%), Gaps = 4/83 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L + CNS D  D+G + L    +FSWS K + +   LF C+ +++    +F  +   RD 
Sbjct  9    LFLHCNSAD-EDLGVQHLHPLGNFSWSFKINFFRTTLFHCSFQWEFVMHRFDIYTTKRDS  67

Query  160  NRCSPTRRCFWLVKEDGFYFSVD  92
             RC     C W+V+EDG   S D
Sbjct  68   YRCFI---CTWVVREDGPCLSFD  87



>ref|XP_010040377.1| PREDICTED: uncharacterized protein LOC104429177 [Eucalyptus grandis]
Length=147

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+       S   + + C S D  D+G + + +  +F W    ++W   LF C M ++ 
Sbjct  29   VHVSVKNRLGSGKNMTLHCQSED-DDLGEQNVADGSEFGWDFNVNVWGTTLFYCDMGWES  87

Query  202  -QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
             Q  +F A++  RD+ RC    +C WLV E+G Y
Sbjct  88   VQDYQFDAYSFARDLVRCDA--QCLWLVSEEGMY  119



>ref|XP_004156927.1| PREDICTED: pumilio homolog 15-like [Cucumis sativus]
Length=144

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 49/113 (43%), Gaps = 11/113 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL-QERDDFSWSVKPSLWTNILFSCTMK  212
            + V IING    S L L V C S +  D+G   L +  D + WS K + W   LF CT++
Sbjct  29   WSVSIINGL---SHLDLNVHCQSKND-DLGNHHLVKHGDTYKWSFKENFWGTTLFWCTLE  84

Query  211  FDQQRRKFAAFAQGRDVN-----RCSPTRRCFWLVKEDGFYFSVDGINWRKDF  68
                   F  F      N     RC P   C W+ K+ G Y   +  N R +F
Sbjct  85   KSDAYVSFEVFWPESWSNTWLRDRCGPEATCIWVAKDGGIYLKNNPAN-RDEF  136



>ref|XP_008460739.1| PREDICTED: uncharacterized protein LOC103499501 [Cucumis melo]
Length=111

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 46/94 (49%), Gaps = 3/94 (3%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L V C SGD  D+G   L     ++++ +P+ W + LF C  ++      F  +   RD 
Sbjct  16   LTVHCKSGDD-DLGVHKLPHLVSYTFTFRPNFWGSTLFYCKFQWSSWLHYFDIYKDSRDN  74

Query  160  NRCSPTRRCFWLVKEDGF-YFSVDGINWRKDFSW  62
             RC+ T  C W++ E G   F+ D  N+   ++W
Sbjct  75   LRCNQT-LCLWIISEKGICMFNYDTKNYDYCYAW  107



>ref|XP_002521147.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41298.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + VH++NG + N  L   + C S D  D+G  +L +  +FSWS + +     L+ C M  
Sbjct  33   FHVHVVNGLSRNKILQ--IHCKSADN-DLGAHSLAKGREFSWSFRINFILTTLYWCHMAP  89

Query  208  DQQRR-KFAAFAQGRDV-NRCSPTRRCFWLVKEDGFY  104
            D         F   + +  RC   ++C W  K+DG Y
Sbjct  90   DDHSHVDLKVFWDSQYLFERCGGAQQCIWTAKDDGVY  126



>ref|XP_010321601.1| PREDICTED: uncharacterized protein LOC104647675 [Solanum lycopersicum]
Length=134

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 7/97 (7%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+++   NN  +PL + C S D  D+G    +  DDF +   P L+ + LF C   + +
Sbjct  26   VHVVDALPNND-IPLSLHCASKDD-DLGYHYPKVGDDFHFHFYPKLFGHTLFFCHFWWGK  83

Query  202  QRRKFAAFAQGRDVNRCSPTRR----CFWLVKEDGFY  104
            +   F  +      N CS   R    C+W V+EDGFY
Sbjct  84   KDAAFDVYTYELSPN-CSWDDRSISYCYWKVQEDGFY  119



>ref|XP_002518161.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44294.1| conserved hypothetical protein [Ricinus communis]
Length=238

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 45/98 (46%), Gaps = 4/98 (4%)
 Frame = -2

Query  403  YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFS  224
            +F     V + NG      L L V C S D  D+G + L     FS+   P+     L+ 
Sbjct  26   FFPKKRTVKVTNGI--GPGLDLTVHCKSKDD-DLGTKVLPYNGYFSFRFHPNFMDTTLYF  82

Query  223  CTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            C+M +  Q  KF  + + RD N+C P   C WLV+  G
Sbjct  83   CSMSWHGQSHKFDIYTEDRDKNKC-PHDYCGWLVRPSG  119



>ref|XP_002518174.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44307.1| conserved hypothetical protein [Ricinus communis]
Length=172

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (45%), Gaps = 18/146 (12%)
 Frame = -2

Query  466  LLLIVGMATYI--ALIVSTQ---PDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            LL IV ++ +I  A+ VS Q     T++   Y V+I+NG  +   +P+      G    +
Sbjct  11   LLAIVVVSLFITQAVAVSVQDKGKHTHYK--YTVYILNGCESGIEMPI-----HGQCFHV  63

Query  301  GGRALQER-DDFSWSVKPSLWTNILFSCTMK---FDQQRRKFAAFAQGRDVN--RCSPTR  140
            G   L      + WS   S   ++ + C +       QR+   AF   RD +  RC  T 
Sbjct  64   GNFTLIRLWQQYHWSFSVSYTKDVTYQCNLSRGYSRSQRQSIVAFNLDRDSDERRCGGTG  123

Query  139  RCFWLVKEDGFYFSVDGINWRKDFSW  62
             C+W + E G YF  +   W K ++W
Sbjct  124  ECYWKITEVGIYFGNNNSTWTKAYNW  149



>ref|XP_009759835.1| PREDICTED: uncharacterized protein LOC104212313 [Nicotiana sylvestris]
Length=248

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 13/114 (11%)
 Frame = -2

Query  421  STQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW  242
            ST    +F   Y VHIIN   +N+  PL + C SGD  D G       +D++WS   +L+
Sbjct  123  STARKCFFTPKYEVHIINNLPSNTP-PLKIHCASGDD-DFGDYFPSINEDYNWSFCGNLF  180

Query  241  TNILFSCTMKFDQQRRKFAAFAQGRDVNRCSP-------TRRCFWLVKEDGFYF  101
               L+ C   +++ +     F    + N C         +R+C W+VK DGFY 
Sbjct  181  GRSLYFCHFWWEKDK----VFDVFNNTNTCVSGGQIPYFSRQCVWVVKSDGFYL  230



>ref|XP_008462122.1| PREDICTED: uncharacterized protein LOC103500551 [Cucumis melo]
Length=151

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 45/101 (45%), Gaps = 9/101 (9%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VH++NG + +S   L V C S D  D+G   +   DDF W+   +L+   LF C ++ 
Sbjct  38   YYVHVLNGLSYHS---LDVHCQSKDD-DLGHHLVNHGDDFQWNFIENLFRTTLFWCRLEK  93

Query  208  DQQRRKFAAFAQGRDVN-----RCSPTRRCFWLVKEDGFYF  101
                  F +F      N     RC     C W  K+DG Y 
Sbjct  94   SDAYVSFESFWPESLKNPWLRRRCGTQLTCLWTAKDDGIYL  134



>ref|XP_002892233.1| hypothetical protein ARALYDRAFT_470450 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68492.1| hypothetical protein ARALYDRAFT_470450 [Arabidopsis lyrata subsp. 
lyrata]
Length=128

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 41/78 (53%), Gaps = 4/78 (5%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD  164
            PL + C S    D+G   +  R ++ +  +P+LW + LF C+ ++  Q ++F  F   RD
Sbjct  41   PLTIHCKSKQD-DLGPHVVPFRQEYHFKFQPNLWKSTLFFCSFQWANQFKRFDIFDAQRD  99

Query  163  VNRCSPTRRCFWLVKEDG  110
             + C    +C W +K DG
Sbjct  100  QDVCD---QCHWEIKPDG  114



>ref|XP_009800927.1| PREDICTED: uncharacterized protein LOC104246751 [Nicotiana sylvestris]
Length=143

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 53/116 (46%), Gaps = 14/116 (12%)
 Frame = -2

Query  397  GNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPS--LWTNILFS  224
            G  Y V I N F  N + PL   C SGD  D+G  +L     FSWS +P+  LW   +F 
Sbjct  29   GKKYTVAIHN-FLPNDNPPLYFHCASGDD-DLGYHSLAALGQFSWSFRPNMWLWARTIFF  86

Query  223  CTMKFDQQRRKFAAFAQGRDVNRC------SPTRRCFWLVKEDGFYFSV-DGINWR  77
            C   +  + + F  +    D + C        T  C W V+ DG Y S  +G+ +R
Sbjct  87   CHFWWGSKNKAFVVY---NDFDYCVHSANVPKTTYCQWTVETDGIYLSNGEGVGYR  139



>ref|XP_003618906.1| Self-incompatibility protein [Medicago truncatula]
 gb|AES75124.1| leguminosin group486 secreted peptide [Medicago truncatula]
Length=127

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 16/110 (15%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGF-TNNSSLPLVVWCNSGDGADI  302
            TQ++LLL V       L  S Q      NV GVH +N   T   +L + + C SGD  D+
Sbjct  5    TQSLLLLCV-------LTFSKQ------NVLGVHQVNVHNTLEGNLDMTLHCQSGDD-DL  50

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAF-AQGRDVNR  155
            G   L   + F W    SL+   LF C++K++ +   F AF A  RD +R
Sbjct  51   GVHLLDPYEHFGWHFNISLFYTTLFYCSVKWNDELHHFDAFIANYRDRHR  100



>ref|XP_006388234.1| hypothetical protein POPTR_0271s00210g [Populus trichocarpa]
 gb|ERP47148.1| hypothetical protein POPTR_0271s00210g [Populus trichocarpa]
Length=135

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 4/80 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRR-KFAAFAQGRD  164
            L + C S D  D+G + + +  +F W    + W   LF C M+++  RR  F A++  RD
Sbjct  42   LSIHCQSKDD-DLGQQDIADGSEFGWDFSVNAWGTTLFYCDMEWENARRSHFDAYSFSRD  100

Query  163  VNRCSPTRRCFWLVKEDGFY  104
              RC    +C WL+ ++G Y
Sbjct  101  HTRCET--QCSWLISKEGMY  118



>ref|XP_007224861.1| hypothetical protein PRUPE_ppa022801mg [Prunus persica]
 gb|EMJ26060.1| hypothetical protein PRUPE_ppa022801mg [Prunus persica]
Length=135

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 55/123 (45%), Gaps = 15/123 (12%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTY-FGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            QTI+LL+       AL ++T  + Y F     V IIN     + L   V C S +  DIG
Sbjct  3    QTIILLV------FALSITTICEAYSFFVSTDVKIINALGPQTDLN--VHCRSKND-DIG  53

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVK  119
               L   D+F +  +P+ W +  F C+ K+  Q   F  F   RD       + C W++K
Sbjct  54   LHNLHHEDNFQFHFRPNYWRSTKFYCSFKWSDQFHWFDIFIHNRD-----DCKHCTWMIK  108

Query  118  EDG  110
              G
Sbjct  109  SGG  111



>ref|XP_010665289.1| PREDICTED: uncharacterized protein LOC104882727 [Vitis vinifera]
Length=130

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (45%), Gaps = 10/109 (9%)
 Frame = -2

Query  382  VHIINGF-TNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFD  206
            + + NG    ++++PL +   S   A +  R ++  + F WSV P     +      KF 
Sbjct  29   IELTNGLPAKHAAVPLHILIKSQTKA-VDERVVKLGESFKWSVTPDSIYYVRAILGHKF-  86

Query  205  QQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSWM  59
                   A   G D +R +     FWLVKEDGFY S D  +W K   W+
Sbjct  87   -------ASVHGFDPSRDAGHATVFWLVKEDGFYLSYDNASWNKVAPWV  128



>ref|XP_008462119.1| PREDICTED: uncharacterized protein LOC103500549 [Cucumis melo]
Length=148

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 21/137 (15%)
 Frame = -2

Query  475  QTILLLIVGMATYIA-------LIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSG  317
            + +++L + MAT++A       +++   P  YF     +H+ N  TN     + V C S 
Sbjct  4    RNVVVLWLLMATWVAEAQISKDVVIRVPPVRYF-----IHVANDLTNQD---MFVHCQSK  55

Query  316  DGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN----RC  152
            D  D+  + L  R D+F W+ K + W   LF C ++       F  F      +    RC
Sbjct  56   DD-DLRIQHLVHRGDEFRWNFKENFWKTTLFWCRLEKSDAHVSFNVFWPESKHHWLRDRC  114

Query  151  SPTRRCFWLVKEDGFYF  101
                 C W  K+DG Y 
Sbjct  115  GSQGVCIWSAKDDGIYL  131



>ref|XP_009623137.1| PREDICTED: uncharacterized protein LOC104114396 [Nicotiana tomentosiformis]
Length=152

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 52/107 (49%), Gaps = 10/107 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+IN   N +  P+ + C S +  D+G   +Q+ D+ +WS + + W   LF C ++ D 
Sbjct  44   VHVINRLVNGN--PIFLHCQSHNN-DLGTSIVQDGDEVNWSFRVNFWGTTLFYCDVQLDI  100

Query  202  QRR---KFAAFAQGRDVNRCSPTRRCFWLVKEDG--FYFSVDGINWR  77
                   F A+   RD  RC     C W++  +G  F ++ +  NW 
Sbjct  101  DSPIWFHFNAYDADRDHRRCRS--ECRWMISREGLLFGYNQESKNWE  145



>gb|EYU31414.1| hypothetical protein MIMGU_mgv1a020336mg, partial [Erythranthe 
guttata]
Length=114

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 6/110 (5%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + + I N   N S  P++ +  +    D G + L +   FSWS + ++W+  L+ C  ++
Sbjct  7    HDIFIYNDLLNMS--PVLSFHCASKNDDFGNKTLHQFQHFSWSFRTNIWSTTLYFCRFQW  64

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDFSWM  59
              + + F AF    D  R        ++ + DGFY S D  N+  + + M
Sbjct  65   GSKHKGFDAF----DAERSKTLHTYNYVARGDGFYVSNDETNYEVNLALM  110



>ref|XP_010245689.1| PREDICTED: pumilio homolog 15-like [Nelumbo nucifera]
Length=116

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
            +Y V++ N    N +L   V C+S D  D+G   +  + DF W    +++   LFSC + 
Sbjct  8    MYHVYVYNMLGENENL--WVHCSSKDD-DLGIHLVPYQGDFHWKFNINIFRTTLFSCDLA  64

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
                   F  F   RD        +C W VK+DG YF
Sbjct  65   KKTVSGHFVIFDAKRDGGHKCKDHQCIWHVKKDGIYF  101



>ref|XP_010273172.1| PREDICTED: pumilio homolog 15-like [Nelumbo nucifera]
Length=135

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
            +Y V++ N    N +L   V C+S D  D+G   +  + DF W    +++   LFSC + 
Sbjct  28   MYHVYVYNMLGENENLW--VHCSSKDD-DLGIHLVPYQSDFHWKFNVNIFRTTLFSCDLA  84

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
                   F  F   RD   C    +C W VK+DG YF
Sbjct  85   KKTVSGHFVIFNAKRDDGNCKDD-QCIWHVKKDGIYF  120



>ref|XP_011024805.1| PREDICTED: uncharacterized protein LOC105125855 [Populus euphratica]
Length=157

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (44%), Gaps = 4/126 (3%)
 Frame = -2

Query  478  TQTILLLIVG-MATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            T  +L L +  +  Y  +    +   Y    + V+++NG +NN  L   V C S D  D+
Sbjct  14   TALVLALAINFIHQYCFVAAKKERILYEFTTWHVYVVNGLSNNRELS--VHCKSKDD-DL  70

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            G   L   D+F+WS +   +   +F C +  D  +  F  F     +      + C W +
Sbjct  71   GFHYLSAGDNFTWSFREDFFLRTVFWCDVNRDDAQAVFKVFWHDVLLFYKCMWKNCVWTL  130

Query  121  KEDGFY  104
            K+DG Y
Sbjct  131  KDDGIY  136



>ref|XP_008445791.1| PREDICTED: uncharacterized protein LOC103488715 [Cucumis melo]
Length=140

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 44/91 (48%), Gaps = 5/91 (5%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V+I N  T+   L   V C SGD  D+G   LQ    ++++ +P+     LF CT ++  
Sbjct  35   VNITNALTSKDQL--TVHCKSGDD-DLGVHQLQPLGGYAFTFRPNFIGTTLFYCTFQWPG  91

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
                F  +   RD NRC+    C W+V E G
Sbjct  92   WSHSFDIYKDSRDRNRCN--GLCLWIVGEQG  120



>ref|XP_004244677.2| PREDICTED: uncharacterized protein LOC101247144 [Solanum lycopersicum]
Length=128

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (49%), Gaps = 5/96 (5%)
 Frame = -2

Query  376  IINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQR  197
             ING  +N+ L L V C S D  D+G   L+  + F +S   + W N  F C   +  + 
Sbjct  16   FINGLPDNTVL-LDVACKSKDD-DLGVHTLKVDERFDFSFHQNFWGNTHFVCNFTWGPKH  73

Query  196  RKFAAFAQGRDVNRCSPTRR---CFWLVKEDGFYFS  98
              F  F +G+   R +  +    C+WL+K+ G YF+
Sbjct  74   NDFDVFYKGKSPCRFTFVKSDIYCYWLMKDSGIYFA  109



>gb|EYU39687.1| hypothetical protein MIMGU_mgv1a024801mg, partial [Erythranthe 
guttata]
Length=111

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 46/101 (46%), Gaps = 8/101 (8%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH++N    NS+L L   C SGD  D+G   +    DF+W      W N LF C + +  
Sbjct  2    VHVVNNLPPNSNLRLH--CASGD-DDLGFHNITVNTDFNWKFCNGFWGNTLFFCNLWWGN  58

Query  202  QRRKFAAFAQGRDVNRCSPTRRC----FWLVKEDGFYFSVD  92
            +   F A+  G   N C    +     +W VK DG Y S D
Sbjct  59   KSVGFDAYKNGGKPN-CFHDLKVGGIYYWAVKSDGIYSSCD  98



>gb|KCW45273.1| hypothetical protein EUGRSUZ_L01080 [Eucalyptus grandis]
Length=173

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+       S   + + C S D  D+G + + +  +F W    ++W   LF C M ++ 
Sbjct  55   VHVSVKNRLGSGKNMTLHCQSED-DDLGEQNVADGSEFGWDFNVNVWGTTLFYCDMGWES  113

Query  202  -QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
             Q  +F A++  RD+ RC    +C WLV E+G Y
Sbjct  114  VQDYQFDAYSFARDLVRCDA--QCLWLVSEEGMY  145



>ref|XP_009766249.1| PREDICTED: uncharacterized protein LOC104217648 [Nicotiana sylvestris]
Length=145

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + VHII+    NS L  ++ C S D  D+G + L   ++FS+S    L+   L+ C   +
Sbjct  32   FQVHIIDALPPNSKL--ILHCQSKDD-DLGYKVLHPNEEFSFSFNEKLFGVTLYFCHFWW  88

Query  208  DQQRRKFAAFAQGRDVNRC----SPTRRCFWLVKEDGFYF  101
            + +   F  F   +   +C      T  C+W V+EDGFYF
Sbjct  89   NGKDIPFDVF-NSKIAGQCGVIDPDTLECYWKVQEDGFYF  127



>ref|XP_010319896.1| PREDICTED: uncharacterized protein LOC104647034 [Solanum lycopersicum]
Length=144

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 10/125 (8%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
             L I+ ++  +A   +  P T     Y + I++   N ++ PL V C S D  D+G   L
Sbjct  12   FLFILSLSGIVATPSTEGPLT----RYQIWIVSDLPNGTN-PLFVHCWSKDN-DLGTHFL  65

Query  286  QE-RDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRR-CFWLVKED  113
                + + W  + + W    F C   +  + + F  F    D ++C      C+WLV+ED
Sbjct  66   NPGPEGYHWHFRENFWQTTRFKCEFVWVTKTKTFYVFES--DSDKCKGRGNICYWLVRED  123

Query  112  GFYFS  98
            GFYF+
Sbjct  124  GFYFA  128



>ref|XP_010321411.1| PREDICTED: uncharacterized protein LOC104647567 [Solanum lycopersicum]
Length=118

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 53/113 (47%), Gaps = 10/113 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW--TNILFSCTMKF  209
            VHI++   NN  +PL   C S D  D+G    +  DDF +   P  W     LF C   +
Sbjct  9    VHIVDALPNND-IPLTFHCASKDN-DLGFHHPKVGDDFHFQFVPRSWPFARTLFFCHFWW  66

Query  208  DQQRRKFAAFAQGRDVNRCS---PTRRCFWLVKEDGFYF--SVDGINWRKDFS  65
              ++ +F  +    DV  CS       C+W V+ DGFY   S+D +  R D+S
Sbjct  67   GNKQNRFDVYNHHLDV-YCSWNVNVISCYWKVQGDGFYMGPSLDDVEKRHDWS  118



>gb|EYU39659.1| hypothetical protein MIMGU_mgv1a021533mg, partial [Erythranthe 
guttata]
Length=94

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L + C S D  D+G   + E +DF+W    S  +N LF CT+++  +R  F AF + +  
Sbjct  1    LRLHCASKDD-DLGYHNMNENEDFTWHFCDSFVSNTLFYCTVQWKNKRASFDAF-RSKKS  58

Query  160  NRCSPTRRCFWLVKEDGFYFS  98
            + C+    C++ + EDG YF+
Sbjct  59   DECADA-TCYYEIWEDGIYFA  78



>ref|XP_009800634.1| PREDICTED: uncharacterized protein LOC104246521 [Nicotiana sylvestris]
Length=152

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (48%), Gaps = 10/107 (9%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+IN   N +  P+ + C S D  D+G   +Q+ D+ +WS + + W   LF C ++ + 
Sbjct  44   VHVINRLVNGN--PIFLHCQSHDN-DLGTSIVQDGDEVNWSFRVNFWGTTLFYCDVQLEI  100

Query  202  QRR---KFAAFAQGRDVNRCSPTRRCFWLVKEDG--FYFSVDGINWR  77
                   F  +   RD  RC     C W++  +G  F ++ +  NW 
Sbjct  101  DSPIWFHFNVYDANRDHRRCRS--ECRWMISREGLLFGYNQESKNWE  145



>ref|XP_002892231.1| hypothetical protein ARALYDRAFT_887637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68490.1| hypothetical protein ARALYDRAFT_887637 [Arabidopsis lyrata subsp. 
lyrata]
Length=135

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 50/108 (46%), Gaps = 15/108 (14%)
 Frame = -2

Query  400  FGNVYGVH---------IINGFTN--NSSLPLVVWCNSGDGADIGGRALQERDDFSWSVK  254
            FG+ YGV          + N   N   S  PL V C S    D+G   +  + ++ +  +
Sbjct  18   FGSGYGVQPFWPDTVVTMTNLIENQEKSGPPLTVHCKSKQD-DLGSHVVPFKQEYHFKFQ  76

Query  253  PSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
             +LW   LF CT ++D+Q ++F  F   RD + C     C W +K DG
Sbjct  77   TNLWKTTLFFCTFQWDKQLKQFDIFDALRDQDVC---YLCNWTIKADG  121



>ref|XP_006361275.1| PREDICTED: uncharacterized protein LOC102587663 [Solanum tuberosum]
Length=127

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (48%), Gaps = 5/96 (5%)
 Frame = -2

Query  376  IINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQR  197
             ING  N++ L L V C S D  D+G   L+  + F +S   + W N  F C   +  + 
Sbjct  15   FINGLPNDTPL-LDVGCKSKDD-DLGVHTLKVGERFDFSFHQNFWGNTHFYCNFTWGPKH  72

Query  196  RKFAAFAQGRDVNRCSPTRR---CFWLVKEDGFYFS  98
              F  F +G+   R    +    C+WL+K+ G YF+
Sbjct  73   NDFDVFYKGKSPCRFKFVKSNIFCYWLMKDSGIYFA  108



>ref|XP_011004341.1| PREDICTED: uncharacterized protein LOC105110858 [Populus euphratica]
Length=150

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 16/134 (12%)
 Frame = -2

Query  445  ATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFS  266
            A ++ L ++  P T     + V I N  ++   L     C SGD  D+G + ++ RD+F 
Sbjct  8    AIFLLLAIAITPST----AWTVRIANRLSHKKVL--FAHCKSGDD-DLGPQYIKPRDEFK  60

Query  265  WSVKPSLWTNILFSCTMKFDQQRRK----FAAFAQ-----GRDVNRCSPTRRCFWLVKED  113
            +S + + +   LF C M  D++       F +F+      G D++  +      W+V++D
Sbjct  61   FSFRVNFFRTTLFWCNMSKDKKSHASLDVFWSFSNAGKHGGLDLSAWAVNEEALWIVRDD  120

Query  112  GFYFSVDGINWRKD  71
            G Y  +    W +D
Sbjct  121  GIYLWMKAPGWPED  134



>ref|XP_004486317.1| PREDICTED: uncharacterized protein LOC101504627 [Cicer arietinum]
Length=125

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 49/97 (51%), Gaps = 10/97 (10%)
 Frame = -2

Query  394  NVYGVH--IINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSC  221
            NV G H  I N   NN  + L V C SGD  D+G R L   D+F+W  + +++    F C
Sbjct  21   NVLGTHVSITNKLENN--MVLTVHCKSGDD-DLGVRVLPFDDEFNWDFRKNIFGTTQFYC  77

Query  220  TMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            + K++ +  +F  +   RD   CS    C W++ + G
Sbjct  78   SFKWEGEFHRFDIYVSRRD--SCS---ECNWVISKKG  109



>ref|XP_004149973.1| PREDICTED: uncharacterized protein LOC101222271 [Cucumis sativus]
Length=135

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 10/102 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG ++NS   L V C S D  D+G   L  R D+F W+ + ++W   LF C + 
Sbjct  21   YFVHVVNGLSSNS---LDVHCQSKDD-DLGYHHLANRGDEFQWNFQINIWGTTLFWCRLD  76

Query  211  FDQQRRKFAAFAQGRD----VNRCS-PTRRCFWLVKEDGFYF  101
                   F +F   R      +RC      C W  K+DG Y 
Sbjct  77   KSDAYVSFESFWSERRHRWLYDRCGIELGTCIWTAKDDGIYL  118



>gb|EYU31435.1| hypothetical protein MIMGU_mgv1a020461mg [Erythranthe guttata]
Length=100

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 38/86 (44%), Gaps = 3/86 (3%)
 Frame = -2

Query  349  SLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQG  170
            S P+ V C SGD  D+G   L  R DF+W  K + W   LF C   +  + + F  F   
Sbjct  5    SKPVTVHCASGD-YDVGNHTLYYRQDFNWQFKTNFWGTTLFFCRFWWGPKTKAFDVFKAK  63

Query  169  RDVNRCSPTRRCFWLVKEDGFYFSVD  92
             D +    T    + V E GFY   D
Sbjct  64   WDRDEYHHTYT--YEVNEQGFYVGYD  87



>ref|XP_007200064.1| hypothetical protein PRUPE_ppa022213mg, partial [Prunus persica]
 gb|EMJ01263.1| hypothetical protein PRUPE_ppa022213mg, partial [Prunus persica]
Length=130

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 53/114 (46%), Gaps = 9/114 (8%)
 Frame = -2

Query  394  NVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTM  215
            N + VH++N      +L     C S D  D+G R L    +F+WS K + +   L+ C M
Sbjct  17   NKWHVHVVNNLGAGKTL--FAHCKSKDD-DLGERNLAPGTEFNWSFKENFFGTTLYWCYM  73

Query  214  KFDQQRRKFAAFAQGRDVN----RCSPTRRCFWLVKEDGFYFSVDGINWRKDFS  65
              DQ+      F    D +    RC+  + C W+ K+DG Y  +   N R +FS
Sbjct  74   STDQKHAALDVFWVEGDHSWLQYRCN-WKDCIWIAKDDGIYIKIIPEN-RDEFS  125



>ref|XP_007225045.1| hypothetical protein PRUPE_ppa019850mg [Prunus persica]
 gb|EMJ26244.1| hypothetical protein PRUPE_ppa019850mg [Prunus persica]
Length=137

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 5/79 (6%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW-TNILFSCTMKFDQQRRKFAAFAQGR  167
            PL V C S D  D+G   LQ +  + +S KP+++ T+ LF C+ ++      F  +   R
Sbjct  45   PLTVHCKSKDD-DLGVHVLQPKGSYEFSFKPNIFITSTLFFCSFQWPGAFHWFDIYVDAR  103

Query  166  DVNRCSPTRRCFWLVKEDG  110
            D   CS   +C W+V EDG
Sbjct  104  DNKICS---KCHWVVYEDG  119



>ref|XP_002322770.2| hypothetical protein POPTR_0016s06720g [Populus trichocarpa]
 gb|EEF04531.2| hypothetical protein POPTR_0016s06720g [Populus trichocarpa]
Length=162

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 5/98 (5%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y +HI+NG + +  L  +V C S +  D+G   +    +F WS + + W   LF C +  
Sbjct  49   YHLHILNGLSPDKIL--LVHCQSKNN-DLGVHNIPVNSEFDWSFRTNAWGTTLFWCYLAP  105

Query  208  DQQRR-KFAAFAQGRDV-NRCSPTRRCFWLVKEDGFYF  101
            D      F AF     + + C     C W+ K+DG Y 
Sbjct  106  DDHSHADFNAFQDKEKITDSCDGNGNCCWIAKDDGVYL  143



>gb|EYU39656.1| hypothetical protein MIMGU_mgv1a018626mg [Erythranthe guttata]
Length=142

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (47%), Gaps = 13/128 (10%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLP-LVVWCNSGDGADIG  299
            + I+  +V +A  ++ + S+     F + Y VH++N       LP L + C SGD  D+G
Sbjct  2    KNIITCLVLLANILSTVTSS---CLFSDQYEVHVVNKM----PLPKLKLHCASGDN-DLG  53

Query  298  GRALQERD-DFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            G      + DF W    ++  N L+ C + +  +   F AF   +    C P   C++  
Sbjct  54   GNHFNTPNFDFHWKFCENVLRNTLYFCHLSWGNKEVAFDAFKSKK--TEC-PNGVCYYEA  110

Query  121  KEDGFYFS  98
            + DG YF+
Sbjct  111  RSDGIYFA  118



>ref|XP_011084392.1| PREDICTED: uncharacterized protein LOC105166650 [Sesamum indicum]
Length=136

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 56/124 (45%), Gaps = 11/124 (9%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRA  290
             L ++V + T++        D  F   Y ++++N   +NS+ PL + C S +  D+G   
Sbjct  8    FLFILVNIQTFV------WSDCLFTWKYDLYVVNYLPSNSA-PLKLHCASKND-DLGYHT  59

Query  289  LQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            L   +DF WS   + + N LF C + +  +++ F  F               +W+ K DG
Sbjct  60   LANGEDFHWSFCENFFPNTLFFCHLWWGSKQKSFVVFKSKWGAQH---LHLYYWVAKSDG  116

Query  109  FYFS  98
             Y S
Sbjct  117  IYLS  120



>ref|XP_008462115.1| PREDICTED: uncharacterized protein LOC103500543 [Cucumis melo]
Length=134

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 58/126 (46%), Gaps = 14/126 (11%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQ  284
            +++V       L    +P  YF     VH++NG +  S   L V C S +  D+G   L 
Sbjct  1    MVLVEGEVSKWLKPPPKPSRYF-----VHVVNGLSYQS---LDVHCQSKND-DLGYHHLV  51

Query  283  ER-DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAF-AQGRDV---NRCSPTRRCFWLVK  119
             R D++ W+ + +LW   LF C ++       F +F  + ++V   +RC     C W  K
Sbjct  52   NRGDEYQWNFEENLWGTTLFWCRLEKPDAYVAFESFWPETKNVWLRDRCGNQGTCIWTAK  111

Query  118  EDGFYF  101
            +DG Y 
Sbjct  112  DDGIYL  117



>ref|XP_008462118.1| PREDICTED: pumilio homolog 15-like [Cucumis melo]
Length=144

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 62/138 (45%), Gaps = 18/138 (13%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQ  284
            ++++ +AT  AL+ +  P       + V I+N     S L L V C S +  D+G   L 
Sbjct  11   VVVLWLAT-AALVGAQVPS------WSVSIVNEL---SHLDLNVHCRSKND-DLGNHHLV  59

Query  283  ERDD-FSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN-----RCSPTRRCFWLV  122
            +R D + WS K + W   LF CT++       F +F      N     RC P   C W+ 
Sbjct  60   KRGDIYKWSFKENFWGTTLFWCTLEKSDAYVSFESFWPESWTNTWLRDRCGPEGTCIWVA  119

Query  121  KEDGFYFSVDGINWRKDF  68
            K+ G Y   +  N R +F
Sbjct  120  KDGGIYLKNNPAN-RDEF  136



>ref|XP_008462113.1| PREDICTED: pumilio homolog 15-like [Cucumis melo]
Length=146

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 18/134 (13%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQ  284
            ++++ +AT +A++ +  P       + V ++NG    S L L V C SG+  D+G   L 
Sbjct  13   MIVLWLAT-VAMVGAQLPR------WSVRMVNGL---SYLGLDVHCQSGND-DLGYHYLV  61

Query  283  ER-DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN-----RCSPTR-RCFWL  125
             R DDF WS + + W   LF C ++       F +F      N     RC  T+  C W+
Sbjct  62   NRGDDFKWSFQENFWGTTLFWCRLEKADAYVSFESFWPESLENTWLRDRCGTTQLTCIWI  121

Query  124  VKEDGFYFSVDGIN  83
             K+DG Y   +  N
Sbjct  122  AKDDGIYLRNNPTN  135



>ref|XP_004160477.1| PREDICTED: uncharacterized LOC101222271 [Cucumis sativus]
Length=135

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 10/102 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER-DDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG ++NS   L V C S D  D+G   L  R D+F W+ + ++W   LF C + 
Sbjct  21   YFVHVVNGLSSNS---LDVHCQSKDD-DLGYHHLANRGDEFQWNFQINVWGTTLFWCRLD  76

Query  211  FDQQRRKFAAFAQGRD----VNRCS-PTRRCFWLVKEDGFYF  101
                   F +F   R      +RC      C W  K+DG Y 
Sbjct  77   KSDAYVSFESFWSERRHRWLYDRCGIELGTCIWTAKDDGIYL  118



>gb|KHN40154.1| hypothetical protein glysoja_028775, partial [Glycine soja]
Length=147

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 11/142 (8%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVSTQP----DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGAD  305
            ++L  +V +  ++ +IVS Q     D +FG    V + NG   N S+ + + C S D  D
Sbjct  9    SMLKALVTIIVFL-MIVSVQDGLSDDGFFGGKNTVRVYNGM--NDSILVHLHCQSKDD-D  64

Query  304  IGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWL  125
            +G   L   +   WS +  ++ N LF CTM      + F  +    +V +CS   +C  +
Sbjct  65   LGQHVLAVGEHQEWSFEDRVFGNTLFWCTMDAGNVHQSFEVYNAKIEVTKCSA--QCNRI  122

Query  124  VKE-DGFYFSVDGINWRKDFSW  62
            +    G++F+    +W K  SW
Sbjct  123  LNNYGGYFFNEFSSSWEKRLSW  144



>ref|XP_007224663.1| hypothetical protein PRUPE_ppa026119mg [Prunus persica]
 gb|EMJ25862.1| hypothetical protein PRUPE_ppa026119mg [Prunus persica]
Length=122

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 50/109 (46%), Gaps = 8/109 (7%)
 Frame = -2

Query  436  IALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSV  257
            + LI +T+ D  F     V + N     S + + V C SG   D+G + +   + + +S 
Sbjct  6    VLLITTTEADIQFPTTKTVRLTNSLA--SYVDMKVHCKSG-AHDLGEQIVHPTESYEFSF  62

Query  256  KPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            K +     LF C+ ++  +   F  +  GRD   CS   +CFW + E G
Sbjct  63   KTNFLGTTLFFCSFQWGNEFHYFDVYKNGRD--ECS---KCFWTIVEAG  106



>gb|KDP44437.1| hypothetical protein JCGZ_16270 [Jatropha curcas]
Length=134

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 42/91 (46%), Gaps = 6/91 (7%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V+I N    N+ L   V C S D  D+G + L  R  F++   P+ W   LF C MK+  
Sbjct  14   VNITNDLGPNTDL--RVHCKSKDD-DLGEKLLHFRGYFTFQFHPNFWGTTLFYCLMKWQN  70

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
                F  +   RD  RC+    C WL++  G
Sbjct  71   VYHYFDIYIDDRDDKRCTV---CLWLIRASG  98



>ref|XP_008372609.1| PREDICTED: uncharacterized protein LOC103435958 [Malus domestica]
Length=107

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 45/94 (48%), Gaps = 6/94 (6%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VH+ING TN +   L V C S D  D+G   +   +++SW  + + W   LF C + +  
Sbjct  3    VHVINGLTNET---LNVHCQSKDD-DLGSHDVSVNEEYSWKFRLNFWDTTLFFCNLSWTG  58

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
              + F A++     + C  +  C W   +DG Y 
Sbjct  59   GHKSFDAYSSAI-TDECEES-DCRWRGTDDGIYL  90



>gb|KDP35223.1| hypothetical protein JCGZ_09382 [Jatropha curcas]
Length=119

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 4/102 (4%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y V+I+NG   N+ L +   C S DG D+G   L    +F WS   +++   +F C MK+
Sbjct  12   YHVYIVNGLNGNNLLEIH--CQS-DGDDLGHHVLPVSGNFGWSFSRNIFGTTVFWCEMKW  68

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGIN  83
                  F  F    ++ R S    C WL    G Y     +N
Sbjct  69   AHGHGIFKVFWNDEELRR-SCNMNCIWLATTYGLYLKDARLN  109



>ref|XP_011020981.1| PREDICTED: uncharacterized protein LOC105123170 [Populus euphratica]
Length=133

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (46%), Gaps = 12/135 (9%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            LL +V    +++   + + D +   +  VH+IN     SS  + V C S +  DIG ++L
Sbjct  8    LLFLVLQLCFLSAATTNEHDDH--PLPTVHVINALPK-SSKAMNVRC-SSNNIDIGEQSL  63

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
               + + W V        L  C   +++    + AF   RD +        FW+V+EDGF
Sbjct  64   VNGEVYKWRVS----QRKLHYCVAIWERFFASWHAFQPRRDGDH----ETLFWMVEEDGF  115

Query  106  YFSVDGINWRKDFSW  62
            + S D  NW + + W
Sbjct  116  FISWDKANWVRKYRW  130



>ref|XP_006574262.1| PREDICTED: uncharacterized protein LOC102664660 [Glycine max]
Length=143

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 59/128 (46%), Gaps = 10/128 (8%)
 Frame = -2

Query  430  LIVSTQP----DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSW  263
            +IVS Q     D +FG    V + NG   N S+ + + C S D  D+G   L   +   W
Sbjct  13   MIVSVQDGLSDDGFFGGKNTVRVYNGM--NDSILVHLHCQSKDD-DLGQHVLAVGEHQEW  69

Query  262  SVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE-DGFYFSVDGI  86
            S +  ++ N LF CTM      + F  +    +V +CS   +C  ++    G++F+    
Sbjct  70   SFEDRVFGNTLFWCTMDAGNVHQSFEVYNAKIEVTKCSA--QCNRILNNYGGYFFNEFSS  127

Query  85   NWRKDFSW  62
            +W K  SW
Sbjct  128  SWEKRLSW  135



>ref|XP_008342625.1| PREDICTED: uncharacterized protein LOC103405400 [Malus domestica]
Length=128

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 6/100 (6%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y V + N    N++L   V C +  G D    ++    DFSW++  +  TN + SC M +
Sbjct  23   YRVTVFNDLAQNTNLN--VHCQAA-GVDPSTHSILFLQDFSWTININ--TNPMLSCDMSW  77

Query  208  DQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDG  89
               +  F  F   RD  RC+    C W VK+DG Y  ++ 
Sbjct  78   ASVKGHFDIFDAKRDATRCA-RNWCAWRVKQDGLYLFIEA  116



>gb|KHN40158.1| hypothetical protein glysoja_028779, partial [Glycine soja]
Length=139

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (42%), Gaps = 10/142 (7%)
 Frame = -2

Query  472  TILLLIVGMATYIALIV---STQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            ++L  +V +  ++ ++        D +FG    V + NG   N S+P+ + C S D  D+
Sbjct  3    SMLKALVRIIVFLMMVCVQDGLSDDGFFGGKITVRVYNGM--NDSIPMYLHCRSKD-DDL  59

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            G   L   +   WS K   +   LF CTM        F  +    ++ +C    +C  ++
Sbjct  60   GQHVLAAGEHQEWSFKDRFFGFTLFWCTMDASNVHESFEIYNAKTELKKCGA--QCNRIL  117

Query  121  KEDGFYF--SVDGINWRKDFSW  62
               G YF     G  W K  SW
Sbjct  118  NNYGGYFFNEFSGGYWEKRLSW  139



>ref|XP_006573437.1| PREDICTED: pumilio homolog 15-like [Glycine max]
Length=156

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 6/117 (5%)
 Frame = -2

Query  409  DTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNIL  230
            D ++G    V + NG   N S+P+ + C S D  D+G   L   +   WS    ++ N L
Sbjct  37   DAFYGGTTHVRVYNGM--NDSIPVHLHCRSKDD-DLGQHVLAVGEHQEWSFGTRVFGNTL  93

Query  229  FSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKED-GFYFSVDGINWRKDFSW  62
            F CTM        F  +    +V  C+   +C  ++  D G++F+     W K  SW
Sbjct  94   FWCTMDAGNVHASFEIYNAKTEVATCNA--QCNRILNNDGGYFFNEYSGYWEKRLSW  148



>ref|XP_010326887.1| PREDICTED: uncharacterized protein LOC104649425 [Solanum lycopersicum]
Length=148

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 49/110 (45%), Gaps = 6/110 (5%)
 Frame = -2

Query  421  STQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLW  242
            ST    +    + VH+IN    NSS  L + C SGD  D+G   L    +F WS   +L 
Sbjct  22   STTKACFLTRRFEVHVINNLPFNSS-NLKIHCASGDD-DLGDHYLSVNQEFKWSFCQALA  79

Query  241  TNILFSCTMKFDQQRRKFAAFAQG----RDVNRCSPTRRCFWLVKEDGFY  104
               LF C   ++ + + F  F        D      T +C W+VK DGFY
Sbjct  80   WTTLFFCHFWWNSKTKSFNVFDDPVHCVEDGLLPKVTTQCAWVVKLDGFY  129



>ref|XP_009606986.1| PREDICTED: uncharacterized protein LOC104101243 [Nicotiana tomentosiformis]
Length=145

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 51/116 (44%), Gaps = 11/116 (9%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + VHIIN    NS L  +  C S D  D+G + L   + FS+S    L+   L+ C   +
Sbjct  32   FQVHIINALPPNSKL--IFHCQSKDD-DLGYKVLHPNEGFSFSFNEKLFGGTLYFCHFWW  88

Query  208  DQQRRKFAAFAQGRDVNRC----SPTRRCFWLVKEDGFYFSV---DGINWRKDFSW  62
            + +   F  F   +   +C      T  C+W V+ DGFYF        N+ K   W
Sbjct  89   NGKDIPFDVF-NNKIAGQCGVIDPDTLECYWKVQADGFYFGARRNPPPNYEKKHDW  143



>ref|XP_010243875.1| PREDICTED: pumilio homolog 15-like [Nelumbo nucifera]
Length=137

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = -2

Query  346  LPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGR  167
            L L + C S +  D+G + L     F W+   ++W + +F C M + Q    +  F   R
Sbjct  36   LNLTIHCRSHND-DLGLKELPYGFYFEWAFNSNIWGSTVFYCDMGWQQGSGHYDVFVARR  94

Query  166  DVNRCSPTRRCFWLVKEDGFY  104
            D +RC    RC+W+ ++DG Y
Sbjct  95   DNSRCH--YRCWWVARQDGLY  113



>ref|XP_006420553.1| hypothetical protein CICLE_v10007012mg [Citrus clementina]
 gb|ESR33793.1| hypothetical protein CICLE_v10007012mg [Citrus clementina]
Length=129

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD  164
             L V C + +  D+G   L+   +F W       T + + C +       +F  F + RD
Sbjct  37   KLTVHCKN-NAEDLGSHVLENDGEFKWDFSIGTGTPVNYYCDLASGSIGGQFNLFDENRD  95

Query  163  VNRCSPTRRCFWLVKEDGFYFSVDGIN-WRKDFSW  62
            V RC   + CFW V  DG Y  +   N + K F W
Sbjct  96   VARCGG-QTCFWRVLGDGIYLFIKANNDYEKQFHW  129



>gb|EYU39658.1| hypothetical protein MIMGU_mgv1a026733mg [Erythranthe guttata]
Length=136

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = -2

Query  457  IVGMATYIALIVSTQPDTYFGNV---YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            ++   T +A +  T   T  G +   + +H++N      S  L + C S +  D+G +  
Sbjct  4    LINFLTLLACVFLTMSRTTTGCITPKFTIHVVNKL---PSPQLKLHCASKND-DLGYKTT  59

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
             E  D++W+   S W+N LF C++ +     KF  F   +  +    T  C++ + +DG 
Sbjct  60   SENYDYNWTFCESFWSNTLFFCSLAWKNNHVKFDVFTSKKSDDCFDGT--CYYEIWDDGI  117

Query  106  YFS  98
            YF+
Sbjct  118  YFA  120



>ref|XP_009618539.1| PREDICTED: uncharacterized protein LOC104110703 [Nicotiana tomentosiformis]
Length=132

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 49/101 (49%), Gaps = 6/101 (6%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V I+N   NN  +PL V C S D  D+G   +     +SW    +L  + LF C   +  
Sbjct  31   VSILNSLPNND-IPLTVRCQSKDN-DLGYHNITIGQSYSWRFHENLKWSTLFFCHFWWYP  88

Query  202  QRRKFAAFAQGRDVNRCSP--TRRCFWLVKEDGFYFSVDGI  86
            ++  F  F  G    +  P  T+ C+W VK DG  FS++G+
Sbjct  89   KQTSFDVFNNGYKCIKKGPVDTQDCYWEVKSDG--FSLNGV  127



>ref|XP_006295524.1| hypothetical protein CARUB_v10024629mg, partial [Capsella rubella]
 gb|EOA28422.1| hypothetical protein CARUB_v10024629mg, partial [Capsella rubella]
Length=152

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 57/126 (45%), Gaps = 12/126 (10%)
 Frame = -2

Query  472  TILLLIVGMATYIALIVST--QPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            TI+ L+V     I+ I S   Q D    ++YG  +     N +   L V C SGD  DIG
Sbjct  18   TIIFLVV-----ISFISSQALQQDRELFSIYGKIMTVSIQNENDYSLGVHCKSGD-KDIG  71

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFAAFAQGRDVNRCSPTRRCFWLV  122
             R L++ + + W  + +L    L+ C     Q ++  F  +   RD  RC   + C W  
Sbjct  72   YRLLKKGELYEWRFRLNLKKTTLYFCGFHNGQIEKGVFDIYDATRDEERC---QICTWKA  128

Query  121  KEDGFY  104
             EDG Y
Sbjct  129  VEDGVY  134



>ref|XP_006573436.1| PREDICTED: uncharacterized protein LOC102666420 [Glycine max]
Length=159

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (42%), Gaps = 10/142 (7%)
 Frame = -2

Query  472  TILLLIVGMATYIALIV---STQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADI  302
            ++L  +V +  ++ ++        D +FG    V + NG   N S+P+ + C S D  D+
Sbjct  15   SMLKALVRIIVFLMMVCVQDGLSDDGFFGGKITVRVYNGM--NDSIPMYLHCRSKDD-DL  71

Query  301  GGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLV  122
            G   L   +   WS K   +   LF CTM        F  +    ++ +C    +C  ++
Sbjct  72   GQHVLAAGEHQEWSFKDRFFGFTLFWCTMDASNVHESFEIYNAKTELKKCGA--QCNRIL  129

Query  121  KEDGFYF--SVDGINWRKDFSW  62
               G YF     G  W K  SW
Sbjct  130  NNYGGYFFNEFSGGYWEKRLSW  151



>ref|XP_008465559.1| PREDICTED: uncharacterized protein LOC103503190, partial [Cucumis 
melo]
 ref|XP_008466858.1| PREDICTED: uncharacterized protein LOC103504167, partial [Cucumis 
melo]
Length=121

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 5/91 (5%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V+I N  T+   L   V C SGD  D+G   LQ    ++++ +P+     LF CT ++  
Sbjct  16   VNITNALTHKDQL--TVHCKSGDD-DLGIHQLQPLGGYAFTFRPNFIGTTLFYCTFQWPG  72

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
                F  +   RD +RC+    C W+V E G
Sbjct  73   WSHSFDIYKDSRDRDRCNGL--CLWIVGEQG  101



>ref|XP_004142571.1| PREDICTED: uncharacterized protein LOC101202846 [Cucumis sativus]
Length=138

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 6/85 (7%)
 Frame = -2

Query  358  NNSSLPLV-VWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFA  185
            N  + PL+ V C S D  D+G + L+    +S+  +P++W    F+C  +F Q + +KF 
Sbjct  39   NKLAGPLLGVHCRSKDD-DLGAQFLESGRSYSFHFRPNIWGTTEFTCAFQFVQGEMQKFT  97

Query  184  AFAQGRDVNRCSPTRRCFWLVKEDG  110
             +   RD NRC+    C W +  DG
Sbjct  98   IYNFHRDTNRCT---DCSWEIYRDG  119



>gb|KDP27635.1| hypothetical protein JCGZ_19640 [Jatropha curcas]
Length=134

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/135 (27%), Positives = 65/135 (48%), Gaps = 10/135 (7%)
 Frame = -2

Query  466  LLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRAL  287
            + L + ++++     ++  D +      V+IING    SS  + V C+S   +    R+L
Sbjct  7    IFLGLAISSFFFATSTSIIDNHRDEATTVYIINGLPK-SSETMQVRCSSKSTSP-DPRSL  64

Query  286  QERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGF  107
               ++++W+VK       ++ C   + +  + + AF   RD N     R  FW+VKEDGF
Sbjct  65   DAGEEYNWTVK----EKGMYKCYSVWREFFQVWHAFQPRRDRN----YREVFWVVKEDGF  116

Query  106  YFSVDGINWRKDFSW  62
            Y S +  +W +   W
Sbjct  117  YLSWNNSSWVRKAIW  131



>ref|XP_007139846.1| hypothetical protein PHAVU_008G062800g [Phaseolus vulgaris]
 gb|ESW11840.1| hypothetical protein PHAVU_008G062800g [Phaseolus vulgaris]
Length=133

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 4/79 (5%)
 Frame = -2

Query  346  LPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGR  167
            + L + C S D  D+G + L     F WS   + +++ LF C  +++    KFA +   R
Sbjct  42   VDLALHCKSADD-DLGVQILSPNSSFVWSFTVNFFSSTLFHCAFQWNDVIHKFAIYEASR  100

Query  166  DVNRCSPTRRCFWLVKEDG  110
            D  RC     C W +KEDG
Sbjct  101  DELRC---LTCDWTIKEDG  116



>ref|XP_010313486.1| PREDICTED: uncharacterized protein LOC104644783, partial [Solanum 
lycopersicum]
Length=125

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (47%), Gaps = 7/92 (8%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            VHIIN   +   L + + C S D  D+G   L   D+ SW+   + W   +F C  ++D 
Sbjct  18   VHIINKLPDG--LAMTLHCQSHDN-DLGQLRLTGGDEASWTFSVNFWGTTMFYCDAQWDD  74

Query  202  QRR--KFAAFAQGRDVNRCSPTRRCFWLVKED  113
                 +F  +   RD  RC     C+W++ E+
Sbjct  75   SSTTYRFVTYDAARDARRCQT--ECWWMISEE  104



>ref|XP_006480253.1| PREDICTED: uncharacterized protein LOC102617969 [Citrus sinensis]
Length=153

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 58/119 (49%), Gaps = 8/119 (7%)
 Frame = -2

Query  448  MATYIALIVST--QPDT-YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            M +Y+ L+V+    P T    N++  HIIN   NNS+L     C S D  D+G R L  +
Sbjct  21   MVSYLVLLVAVCQVPMTNSLLNLFTEHIINNL-NNSTLE--AHCKSKDD-DLGLRRLAAQ  76

Query  277  DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD-VNRCSPTRRCFWLVKEDGFY  104
             +F+W+ + + W+  LF C +++    +    +      +N+      C W  ++DG Y
Sbjct  77   TEFNWTFRVNFWSTTLFFCDLRWASGHKACDVYCTDDQFLNKYCAYDFCRWSARDDGIY  135



>ref|XP_006487620.1| PREDICTED: uncharacterized protein LOC102623103 [Citrus sinensis]
Length=118

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD  164
             L V C + +  D+G   L+   +F W       T + + C +       +F  F + RD
Sbjct  26   KLTVHCKN-NAEDLGSHVLENDGEFKWDFSIGTGTPVNYYCDLASGSIGGQFNLFDENRD  84

Query  163  VNRCSPTRRCFWLVKEDGFYFSVDGIN-WRKDFSW  62
            V RC   + CFW V  DG Y  +   N + K F W
Sbjct  85   VARCGG-QTCFWRVLGDGIYLFIKANNDYEKQFHW  118



>ref|XP_002509911.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51298.1| conserved hypothetical protein [Ricinus communis]
Length=135

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 52/104 (50%), Gaps = 10/104 (10%)
 Frame = -2

Query  376  IINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ-Q  200
            I+N   N  ++ L   C S D  D+G + + +  +F W    ++    LF C M+++  Q
Sbjct  32   IMNRLGNGKNMTLH--CQSKD-DDLGQQNIADGSEFGWDFSVNVGGTTLFFCNMEWENVQ  88

Query  199  RRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDGINWRKDF  68
            +  F A++ GRD  RC    +C WL+  +G Y    G+N +  F
Sbjct  89   QYHFDAYSFGRDYARCES--QCLWLISTEGVY----GLNGQTGF  126



>ref|XP_007133310.1| hypothetical protein PHAVU_011G168800g [Phaseolus vulgaris]
 gb|ESW05304.1| hypothetical protein PHAVU_011G168800g [Phaseolus vulgaris]
Length=147

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 4/77 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L + C S D  D+G + L     FSWS + + +   L+ C+ +++    +F  +   RD 
Sbjct  51   LFLHCKSAD-EDLGLQHLHPHGTFSWSFQINFFRTTLYHCSFQWESVVHRFDIYKASRDA  109

Query  160  NRCSPTRRCFWLVKEDG  110
            N+C     C W V+EDG
Sbjct  110  NKC---YLCSWEVREDG  123



>ref|XP_010326891.1| PREDICTED: uncharacterized protein LOC104649429 [Solanum lycopersicum]
Length=131

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 54/121 (45%), Gaps = 19/121 (16%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VH+++    NS+  L + C SGD  D+G + L+  DDF W      WT  L+ C   +
Sbjct  18   YSVHVLDNLPPNST-DLKIHCASGDD-DLGDKILKVGDDFRWGF--CAWTWTLYFCHFWW  73

Query  208  DQQRRKFAAFAQGRDVNRC---------SPTRRCFWLVKEDGF---YFSVDGINWRKDFS  65
            D +   F  F    D + C           T  C W VK DG    Y+  D +N +K  S
Sbjct  74   DNKILMFDVF---NDQHYCVHDGVNIIPKDTNECIWQVKNDGIYLGYYDGDKLNSQKYRS  130

Query  64   W  62
            W
Sbjct  131  W  131



>ref|XP_006443668.1| hypothetical protein CICLE_v10024107mg [Citrus clementina]
 gb|ESR56908.1| hypothetical protein CICLE_v10024107mg [Citrus clementina]
Length=137

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 58/119 (49%), Gaps = 8/119 (7%)
 Frame = -2

Query  448  MATYIALIVST--QPDT-YFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQER  278
            M +Y+ L+V+    P T    N++  HIIN   NNS+L     C S D  D+G R L  +
Sbjct  5    MVSYLVLLVAVCQVPMTNSLLNLFTEHIINNL-NNSTLE--AHCKSKDD-DLGLRRLAAQ  60

Query  277  DDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRD-VNRCSPTRRCFWLVKEDGFY  104
             +F+W+ + + W+  LF C +++    +    +      +N+      C W  ++DG Y
Sbjct  61   TEFNWTFRVNFWSTTLFFCDLRWASGHKACDVYCTDDQFLNKYCAYDFCRWSARDDGIY  119



>ref|XP_007133445.1| hypothetical protein PHAVU_011G179400g [Phaseolus vulgaris]
 gb|ESW05439.1| hypothetical protein PHAVU_011G179400g [Phaseolus vulgaris]
Length=143

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 45/101 (45%), Gaps = 5/101 (5%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
            +  + I+N   +N  LPL + C S +  D+    +     F W  +P++W   LF C   
Sbjct  29   IVHMRIVNNLGDN--LPLCLHCKSKND-DLQNHVIYNNQSFRWRFRPNIWGTTLFFCHFS  85

Query  211  FDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFSVDG  89
            + +    +  +   RD +RC  T  C W V ++G     +G
Sbjct  86   WAEGEGSYVIYKNRRDNDRC--THHCDWYVTKEGVEGYTEG  124



>ref|XP_011020980.1| PREDICTED: uncharacterized protein LOC105123169 [Populus euphratica]
Length=134

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 61/138 (44%), Gaps = 13/138 (9%)
 Frame = -2

Query  475  QTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGG  296
             ++L     +    A     QP+    N+  V IIN    NS  PL V C+S +   +G 
Sbjct  7    HSLLFFSFALCVLSARPNEDQPEQ---NLPTVQIINSLPPNSP-PLNVSCSSKN-FKLGA  61

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
            R+    + + + VK       ++ C  ++++    +  F   RD N  +     +WLVK+
Sbjct  62   RSFSVGEAYEFKVK----EKDIYFCAAQWERYFESWHGFEPHRDENHGT----VYWLVKK  113

Query  115  DGFYFSVDGINWRKDFSW  62
            DGFY S D  +W  +  W
Sbjct  114  DGFYRSWDKASWVLEDPW  131



>gb|KDP44435.1| hypothetical protein JCGZ_16268 [Jatropha curcas]
Length=129

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 43/91 (47%), Gaps = 6/91 (7%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V++ N    N+ L   V C S D  D+G + L  +  F+++  P+ W +  F C MK+  
Sbjct  22   VNVTNDLGPNTDL--TVHCKSKD-TDLGEKLLHFQGYFTFTFHPNFWGSTQFYCLMKWQN  78

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
                F  +   RD  RC+    C WL++  G
Sbjct  79   VSHYFDIYIDDRDNKRCT---LCLWLIRSSG  106



>ref|XP_004139725.1| PREDICTED: uncharacterized protein LOC101205959 [Cucumis sativus]
Length=144

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 49/113 (43%), Gaps = 11/113 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDD-FSWSVKPSLWTNILFSCTMK  212
            + V I+NG    S L L V C S +  D+G   L +R D + W+ K + W   LF C ++
Sbjct  29   WSVSIVNGL---SHLDLNVHCQSKND-DLGNHHLVKRGDIYKWNFKENFWGTTLFWCKLE  84

Query  211  FDQQRRKFAAFAQGRDVN-----RCSPTRRCFWLVKEDGFYFSVDGINWRKDF  68
                   F  F      N     RC P   C W+ K+ G Y   +  N R +F
Sbjct  85   KSDAYVSFETFWPESWSNTWLRDRCGPEGTCIWVAKDGGIYLKNNPAN-RDEF  136



>ref|XP_004154486.1| PREDICTED: pumilio homolog 15-like [Cucumis sativus]
Length=144

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 61/138 (44%), Gaps = 18/138 (13%)
 Frame = -2

Query  463  LLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQ  284
            ++++ +AT  AL+ +  P       + V I+NG    S L L V C S +  D+G   L 
Sbjct  11   VVVLWLAT-AALVGAQVPS------WSVSIVNGL---SHLDLNVHCQSKND-DLGNHHLV  59

Query  283  ERDD-FSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVN-----RCSPTRRCFWLV  122
            +R D + W+ K + W   LF C ++       F  F      N     RC P   C W+ 
Sbjct  60   KRGDIYKWNFKENFWGTTLFWCKLEKSDAYVSFETFWPESWSNTWLRDRCGPEGTCIWVA  119

Query  121  KEDGFYFSVDGINWRKDF  68
            K+ G Y   +  N R +F
Sbjct  120  KDGGIYLKNNPAN-RDEF  136



>gb|EYU32666.1| hypothetical protein MIMGU_mgv11b022741mg, partial [Erythranthe 
guttata]
Length=142

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 7/87 (8%)
 Frame = -2

Query  346  LPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGR  167
            +PL+V C+SGD  D G   L     FSWS K + ++  L+SC   +  ++  F  F    
Sbjct  3    VPLLVHCHSGDD-DFGNHTLHPGQSFSWSFKSNFFSRTLYSCRFWWGPRQSGFDVFYA--  59

Query  166  DVNRCSPTRRCF-WLVKEDGFYFSVDG  89
               +   T   + ++VK DGFY + DG
Sbjct  60   ---KWKTTHNTYNYVVKGDGFYVNFDG  83



>ref|XP_004142537.1| PREDICTED: uncharacterized protein LOC101214402 [Cucumis sativus]
Length=138

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ-QRRKFAAFAQGRD  164
            L V C S D  D+G  +L+    +S+  KP++W    F+C  +F Q +   F  +   RD
Sbjct  46   LGVHCRSKDD-DLGVHSLESGRSYSFHFKPNIWGTTEFTCGFEFVQGEMHNFTIYNFHRD  104

Query  163  VNRCSPTRRCFWLVKEDG  110
            +NRC+    C W +  DG
Sbjct  105  MNRCT---NCSWEIYRDG  119



>ref|XP_006360979.1| PREDICTED: uncharacterized protein LOC102593305 [Solanum tuberosum]
Length=124

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 49/109 (45%), Gaps = 6/109 (6%)
 Frame = -2

Query  391  VYGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK  212
             Y V+I +    N S  L   C S D  D+G   L    ++S+    +   + LF C  +
Sbjct  9    TYHVYIASALPENPSAKLNFHCQSKDD-DLGNHELLPGQNWSFKFHENFIRSTLFYCDFE  67

Query  211  FDQQRRKFAAFAQGRDV---NRCSPTRRCFWLVKEDGFY--FSVDGINW  80
            +D +++ F  F          +   T  C+WLVK DGFY  + V+  +W
Sbjct  68   WDGKQKTFNVFDDSITCIKQAKGDQTDTCYWLVKSDGFYLAYKVNPPSW  116



>ref|XP_002517051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45214.1| conserved hypothetical protein [Ricinus communis]
Length=140

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            Y VHI+N      +  L + C SGD  D+G + ++ +D+F ++ + +LW   L+ C   +
Sbjct  30   YHVHIVNNLEGGITNDLYLQCKSGD-DDLGMQRVRAKDEFHFTFRKNLWGTTLYWCNFGW  88

Query  208  DQQR-RKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYF  101
             +     F  +  G++    +  R C W  + DG Y 
Sbjct  89   GKSHGGSFKVWWGGKNFT-STTGRNCVWSARNDGLYL  124



>ref|XP_008460741.1| PREDICTED: uncharacterized protein LOC103499504 [Cucumis melo]
Length=140

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 54/122 (44%), Gaps = 14/122 (11%)
 Frame = -2

Query  469  ILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGF--TNNSSLPLVVWCNSGDGADIGG  296
            I L+ V + T    +  +QP T       V+I N     NN    L + C SGD  D+G 
Sbjct  12   ISLIFVTIFTIDGKVFQSQPVT-------VNITNALKGVNNQ---LTIHCKSGDD-DLGV  60

Query  295  RALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKE  116
              L     ++++ +P+ W   LF C  ++      F  +   RD  +C+ T  C W+V E
Sbjct  61   HQLSHLASYAFNFRPNFWGTTLFYCNFQWTGFSHYFDIYKDIRDREKCNYT-LCLWIVGE  119

Query  115  DG  110
             G
Sbjct  120  QG  121



>ref|XP_008223933.1| PREDICTED: uncharacterized protein LOC103323706 [Prunus mume]
Length=135

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 52/127 (41%), Gaps = 23/127 (18%)
 Frame = -2

Query  475  QTILLLIVGMAT-----YIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDG  311
            QTI+LL+  + T       +  VST           V IIN     + L   V C S + 
Sbjct  3    QTIILLVFALGTTTICEAYSFFVSTD----------VKIINALGPQTDLD--VHCRSKND  50

Query  310  ADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCSPTRRCF  131
             DIG   L   D+F +  +P+ W +  F C+ K+  Q   F  F   RD       + C 
Sbjct  51   -DIGLHNLHHEDNFQFHFRPNYWRSTKFYCSFKWSDQFHWFDIFIHNRD-----DCKHCT  104

Query  130  WLVKEDG  110
            W++   G
Sbjct  105  WMINSGG  111



>ref|XP_006595359.1| PREDICTED: uncharacterized protein LOC102661112 [Glycine max]
 gb|KHN48965.1| hypothetical protein glysoja_025342 [Glycine soja]
Length=171

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKF  209
            + V+I+NG  NN +L  +  C S D  D+G R L +  +F+WS +     + LF C +K 
Sbjct  57   WHVYIVNGLRNNQNL--LAHCKSADD-DLGVRNLSQGSNFTWSFRTDFAHSTLFWCHVKK  113

Query  208  DQ----QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDGFYFS  98
            D     +   F  F     + +    ++C W  ++DG Y +
Sbjct  114  DNNNACESATFDVFWYDERLFQKCDWKKCIWSARDDGIYLT  154



>ref|XP_010248454.1| PREDICTED: uncharacterized protein LOC104591361 [Nelumbo nucifera]
Length=103

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (48%), Gaps = 4/82 (5%)
 Frame = -2

Query  343  PLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMK-FDQQRRKFAAFAQGR  167
             + V C SGD  D+G + L + D+F W+   +     LF C +  F      F A++  R
Sbjct  9    SMNVHCQSGD-DDLGNQVLADGDEFGWAFSTNTLGTTLFYCNVNWFKNDWFHFDAYSHER  67

Query  166  DVNRCSPTRRCFWLVKEDGFYF  101
            D +RC     C W V EDG Y 
Sbjct  68   DWSRCRS--ECRWRVSEDGLYL  87



>ref|XP_004491373.1| PREDICTED: uncharacterized protein LOC101494747 [Cicer arietinum]
Length=125

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 52/113 (46%), Gaps = 14/113 (12%)
 Frame = -2

Query  394  NVYGVH--IINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSC  221
            NV G+H  I N   N   L   V C SGD  D+G R L    +F+WS   +++    F C
Sbjct  21   NVLGIHVSITNKLENKKVL--TVHCKSGDD-DLGVRVLPFGGEFNWSFSDNIFGTTRFYC  77

Query  220  TMKFDQQRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG----FYFSVDGINWRK  74
            + K++ Q   F  +   RD   CS   +C W++ + G     Y  VD   W K
Sbjct  78   SFKWEGQFHWFDIYVSDRDF--CS---KCNWVISQTGPTKILYNGVDPFPWNK  125



>gb|ACU31824.1| self-incompatibility protein [Argemone munita]
Length=123

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 48/94 (51%), Gaps = 5/94 (5%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
              I+N   N  S+   V C S D  D+G + + + ++  W+ K S W N  F+C +K+++
Sbjct  33   ARIMNRRGNGKSIE--VHCKSLDN-DLGNQVVADDNELRWTFKESFWQNTRFTCDLKWNE  89

Query  202  QRR-KFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
                 F AF   RD +    + +C W V++DG Y
Sbjct  90   TINFHFNAFFSTRD-DWGRVSSKCLWKVQDDGLY  122



>gb|ACV41033.1| self-incompatibility protein [Argemone munita]
Length=108

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 48/94 (51%), Gaps = 5/94 (5%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V I+N   N  S+   V C S D  D+  + + + ++  W+ K S+W N LFSC +K++ 
Sbjct  1    VRIMNRRGNGKSIE--VHCKSLDN-DLENQVVVDGNELKWNFKESIWENTLFSCDLKWNG  57

Query  202  QRR-KFAAFAQGRDVNRCSPTRRCFWLVKEDGFY  104
                 F A+   RD +    +  C W V+EDG Y
Sbjct  58   TINFHFNAYWSDRD-HWGRVSTECLWKVQEDGLY  90



>ref|XP_006420549.1| hypothetical protein CICLE_v10006952mg, partial [Citrus clementina]
 gb|ESR33789.1| hypothetical protein CICLE_v10006952mg, partial [Citrus clementina]
Length=105

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (47%), Gaps = 3/79 (4%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
              + C S D  D+G   +  ++++SW  K + W   LF C + +      +  +   RD+
Sbjct  17   FTIHCKSKDD-DMGTHVISPQENYSWEFKVNFWHTTLFFCGVSWRDGSLVYDFYKASRDL  75

Query  160  NRCSPTRRCFWLVKEDGFY  104
            NRC     C W VK DG Y
Sbjct  76   NRC--LYYCNWYVKRDGVY  92



>ref|XP_010644707.1| PREDICTED: uncharacterized protein LOC104877643 [Vitis vinifera]
 emb|CBI39875.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 5/91 (5%)
 Frame = -2

Query  382  VHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQ  203
            V IIN   N S L L   C S D  D+G   L     F +S +P+ W   L+ C   +  
Sbjct  32   VRIINDLGNGSDLNLH--CKSKDD-DLGVHVLAPHQFFEFSFRPNFWVTTLYFCRFWWGD  88

Query  202  QRRKFAAFAQGRDVNRCSPTRRCFWLVKEDG  110
            +   F  + + RDV RC+  ++C+W V   G
Sbjct  89   ESHWFDIYVERRDVGRCN--KQCWWTVAAVG  117



>ref|XP_004139731.1| PREDICTED: pumilio homolog 15-like [Cucumis sativus]
 ref|XP_004164460.1| PREDICTED: pumilio homolog 15-like [Cucumis sativus]
Length=135

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 10/102 (10%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIG-GRALQERDDFSWSVKPSLWTNILFSCTMK  212
            Y VH++NG +++S   L V C S D  D+G    +   DDF W+ + + W   LF C ++
Sbjct  21   YFVHVVNGLSSHS---LDVHCKSKDD-DLGYHHMVNHGDDFQWNFEENFWGTTLFWCRLE  76

Query  211  FDQQRRKFAAF-AQGRDV---NRC-SPTRRCFWLVKEDGFYF  101
              +    F +F  + R++    RC +    C W  K+DG Y 
Sbjct  77   NPEAYADFESFWPESRNLWLRYRCGNQLGTCIWTAKDDGIYL  118



>ref|XP_006420538.1| hypothetical protein CICLE_v10006715mg, partial [Citrus clementina]
 gb|ESR33778.1| hypothetical protein CICLE_v10006715mg, partial [Citrus clementina]
Length=121

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 40/81 (49%), Gaps = 3/81 (4%)
 Frame = -2

Query  352  SSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQ  173
            S   + V C SGD  D+G   L+  ++F W+   +     L+ C +    +  +F AF  
Sbjct  27   SGEDITVHCKSGDD-DLGPHVLKTWENFHWNFHGNFGGTTLYFCHVTTQDKSTRFDAFKY  85

Query  172  GRDVNRCSPTRRCFWLVKEDG  110
             +D  RCSP  +C W V++ G
Sbjct  86   SKDRQRCSP--KCTWKVQKSG  104



>ref|XP_007141224.1| hypothetical protein PHAVU_008G177700g, partial [Phaseolus vulgaris]
 gb|ESW13218.1| hypothetical protein PHAVU_008G177700g, partial [Phaseolus vulgaris]
Length=112

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = -2

Query  340  LVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDV  161
            L++ C S D  D+G + L     F W  + +++   LF C+ ++D    KF  +   RD 
Sbjct  20   LLLHCESADD-DLGVQLLHPNTSFRWKFQINVFGTTLFHCSFQWDSVLHKFVIYKTRRDH  78

Query  160  NRCSPTRRCFWLVKEDGFYFSVDG  89
            + CS    C W+VKE+G    ++G
Sbjct  79   DTCSI---CNWIVKENGPCLILNG  99



>ref|XP_006384775.1| hypothetical protein POPTR_0004s20990g [Populus trichocarpa]
 gb|ERP62572.1| hypothetical protein POPTR_0004s20990g [Populus trichocarpa]
Length=163

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 17/108 (16%)
 Frame = -2

Query  388  YGVHIINGFTNNSSLPLVVWCNSGDGADIGGRALQERDDFSWS-VKPSLWTNILFSCTMK  212
            + V+I+N  ++N  L   V C S D  D+G   +Q +D F +  V+   W   LF C+M 
Sbjct  33   WKVNIVNQLSHNKRL--FVHCKSKDD-DLGPHHVQSKDRFVFRFVENFYWATTLFWCSMS  89

Query  211  FDQQRRKFAAF-----AQGRDVNR------CSPTRRCFWLVKEDGFYF  101
             D  R+ +A+F     A   + N+       + TR   WLV++DG YF
Sbjct  90   KD--RKSYASFDVFWSADNHEKNKNFNLQGLTGTREIIWLVRDDGIYF  135



>ref|XP_006406786.1| hypothetical protein EUTSA_v10022389mg [Eutrema salsugineum]
 gb|ESQ48239.1| hypothetical protein EUTSA_v10022389mg [Eutrema salsugineum]
Length=133

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -2

Query  352  SSLPLVVWCNSGDGADIGGRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQ  173
            S LPL   C S D  D+G R L     +S+  KPS++ N  FSC+  ++ Q   F  +  
Sbjct  34   SDLPLQYHCKSNDD-DLGDRVLASGGSWSFQFKPSVFGNTFFSCSFSWENQLHYFDIYKY  92

Query  172  GRD-VNRCSPTRRCFWLVKEDG  110
             RD +      R+C W ++++G
Sbjct  93   KRDRIFAKFGCRKCGWKIRKNG  114



>ref|XP_006341205.1| PREDICTED: uncharacterized protein LOC102579165 [Solanum tuberosum]
Length=149

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 61/132 (46%), Gaps = 12/132 (9%)
 Frame = -2

Query  478  TQTILLLIVGMATYIALIVSTQPDTYFGNVYGVHIINGFTNNSSLPLVVWCNSGDGADIG  299
            T+T+ + ++ +   IAL+ S      F + + V+II+    NS L   + C S D  D+G
Sbjct  10   TKTLFMSLLFLLN-IALVTSRHG---FTSRFHVYIIDNLPPNSKL--TMHCQSHDD-DLG  62

Query  298  GRALQERDDFSWSVKPSLWTNILFSCTMKFDQQRRKFAAFAQGRDVNRCS----PTRRCF  131
             +     D+F++S    L+   LF C   ++ Q   F  F      N C         C+
Sbjct  63   YKVFYPNDEFNFSFNMKLFGGTLFFCHFWWNDQSITFDIFNNSIAGN-CGVIDGDHLECY  121

Query  130  WLVKEDGFYFSV  95
            W V+EDGFYF  
Sbjct  122  WKVQEDGFYFGA  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512576545360