BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4769_g2_i1 len=767 path=[793:0-766]

Length=767
                                                                      Score     E

sp|Q96471.1|DCAM_IPONI  RecName: Full=S-adenosylmethionine decarb...    279   1e-88   Ipomoea nil [qian niu]
sp|Q9M6K1.1|DCAM_IPOBA  RecName: Full=S-adenosylmethionine decarb...    277   5e-88   Ipomoea batatas [batate]
ref|XP_011099087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    263   1e-81   
emb|CDP02379.1|  unnamed protein product                                259   6e-81   
ref|XP_009764781.1|  PREDICTED: S-adenosylmethionine decarboxylas...    251   7e-78   
ref|XP_009622584.1|  PREDICTED: S-adenosylmethionine decarboxylas...    250   3e-77   
ref|XP_006338297.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   4e-77   
gb|EYU44271.1|  hypothetical protein MIMGU_mgv1a008754mg                248   8e-77   
ref|XP_004233654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   2e-76   
ref|XP_011008131.1|  PREDICTED: S-adenosylmethionine decarboxylas...    247   3e-76   
ref|XP_007033429.1|  S-adenosylmethionine decarboxylase proenzyme...    247   3e-76   
ref|XP_010032594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    246   4e-76   
ref|XP_002305295.2|  S-adenosylmethionine decarboxylase family pr...    246   5e-76   Populus trichocarpa [western balsam poplar]
gb|ABK95104.1|  unknown                                                 246   5e-76   Populus trichocarpa [western balsam poplar]
ref|XP_011021158.1|  PREDICTED: S-adenosylmethionine decarboxylas...    246   6e-76   
ref|XP_007033428.1|  S-adenosylmethionine decarboxylase proenzyme...    247   1e-75   
gb|ABY55855.1|  S-adenosylmethionine decarboxylase 2                    245   1e-75   Solanum lycopersicum
ref|XP_006373494.1|  hypothetical protein POPTR_0017s14280g             244   5e-75   
gb|AAM44307.1|AF512545_1  S-adenosylmethionine decarboxylase            243   6e-75   Citrus x microcarpa [golden lime]
gb|KDO58885.1|  hypothetical protein CISIN_1g039582mg                   241   3e-74   
ref|XP_006430871.1|  hypothetical protein CICLE_v10013866mg             241   4e-74   
gb|KDP24344.1|  hypothetical protein JCGZ_25640                         241   7e-74   
gb|AGT80621.1|  S-adenosylmethionine decarboxylase                      241   8e-74   
emb|CAJ43718.1|  S-adenosine decarboxylase                              236   8e-74   Plantago major [cart-track plant]
gb|AFV67665.1|  S-adenosylmethionine decarboxylase                      239   6e-73   
gb|AFJ04521.1|  s-adenosylmethionine decarboxylase                      234   3e-72   
ref|XP_010257836.1|  PREDICTED: S-adenosylmethionine decarboxylas...    237   8e-72   
ref|XP_002282704.1|  PREDICTED: S-adenosylmethionine decarboxylas...    235   8e-72   Vitis vinifera
sp|O65354.1|DCAM_HELAN  RecName: Full=S-adenosylmethionine decarb...    235   2e-71   Helianthus annuus
gb|AEI98604.1|  S-adenosylmethionine decarboxylase                      234   2e-71   
ref|XP_010660529.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   3e-71   
sp|Q42679.1|DCAM_CATRO  RecName: Full=S-adenosylmethionine decarb...    234   3e-71   Catharanthus roseus [chatas]
ref|XP_007045669.1|  S-adenosylmethionine decarboxylase proenzyme       234   3e-71   
gb|KDP31452.1|  hypothetical protein JCGZ_11828                         234   3e-71   
ref|XP_007225621.1|  hypothetical protein PRUPE_ppa007732mg             234   4e-71   
gb|KHG07410.1|  S-adenosylmethionine decarboxylase proenzyme            233   5e-71   
ref|XP_008243751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   5e-71   
gb|AIS20829.1|  SAMDC3                                                  233   7e-71   
ref|XP_002525956.1|  s-adenosylmethionine decarboxylase, putative       233   1e-70   Ricinus communis
ref|NP_001236931.1|  S-adenosylmethionine decarboxylase                 232   2e-70   
gb|ACU18873.1|  unknown                                                 226   2e-70   Glycine max [soybeans]
ref|XP_006573201.1|  PREDICTED: S-adenosylmethionine decarboxylas...    231   5e-70   
ref|XP_002314904.2|  S-adenosylmethionine decarboxylase family pr...    231   5e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004297173.1|  PREDICTED: S-adenosylmethionine decarboxylas...    231   6e-70   
ref|XP_006585825.1|  PREDICTED: S-adenosylmethionine decarboxylas...    230   8e-70   
ref|XP_010100905.1|  S-adenosylmethionine decarboxylase proenzyme       229   2e-69   
ref|XP_004297172.1|  PREDICTED: S-adenosylmethionine decarboxylas...    231   2e-69   
gb|ACJ83461.1|  unknown                                                 224   3e-69   Medicago truncatula
ref|XP_009356498.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   3e-69   
gb|AAB88854.1|  S-adenosylmethionine decarboxylase                      229   3e-69   Nicotiana tabacum [American tobacco]
gb|KHG30390.1|  S-adenosylmethionine decarboxylase proenzyme            229   4e-69   
ref|XP_011070874.1|  PREDICTED: S-adenosylmethionine decarboxylas...    228   5e-69   
ref|XP_009765510.1|  PREDICTED: S-adenosylmethionine decarboxylas...    227   6e-69   
gb|KHN13794.1|  S-adenosylmethionine decarboxylase proenzyme            228   6e-69   
ref|XP_011008996.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   7e-69   
gb|EYU28926.1|  hypothetical protein MIMGU_mgv1a008898mg                228   8e-69   
ref|XP_006602987.1|  PREDICTED: S-adenosylmethionine decarboxylas...    227   1e-68   
gb|KGN57743.1|  hypothetical protein Csa_3G271360                       227   1e-68   
ref|XP_009625495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    228   1e-68   
sp|O04009.1|DCAM_TOBAC  RecName: Full=S-adenosylmethionine decarb...    227   2e-68   Nicotiana tabacum [American tobacco]
sp|O80402.1|DCAM_NICSY  RecName: Full=S-adenosylmethionine decarb...    227   2e-68   Nicotiana sylvestris
gb|KEH16884.1|  S-adenosylmethionine decarboxylase proenzyme            225   6e-68   
ref|XP_002514534.1|  s-adenosylmethionine decarboxylase, putative       225   7e-68   Ricinus communis
sp|Q96555.1|DCAM_DATST  RecName: Full=S-adenosylmethionine decarb...    225   1e-67   Datura stramonium [common thornapple]
pdb|1MHM|A  Chain A, Crystal Structure Of S-Adenosylmethionine De...    223   1e-67   
gb|AGV68760.1|  S-adenosylmethionine decarboxylase                      224   2e-67   
ref|XP_008461582.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    226   2e-67   
ref|XP_008353081.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   2e-67   
gb|ABO77440.1|  S-adenosylmethionine decarboxylase                      224   2e-67   Medicago falcata [sickle alfalfa]
dbj|BAC55114.1|  S-adenosylmethionine decarboxylase                     224   3e-67   Malus domestica [apple tree]
ref|XP_004491770.1|  PREDICTED: S-adenosylmethionine decarboxylas...    224   3e-67   
gb|AGI02585.1|  S-adenosylmethionine decarboxylase                      224   3e-67   
gb|KHG10311.1|  S-adenosylmethionine decarboxylase proenzyme            223   3e-67   
ref|XP_006348617.1|  PREDICTED: S-adenosylmethionine decarboxylas...    223   4e-67   
ref|XP_007215554.1|  hypothetical protein PRUPE_ppa007294mg             224   4e-67   
ref|NP_001280825.1|  uncharacterized protein LOC103451713               223   5e-67   
ref|XP_008360070.1|  PREDICTED: S-adenosylmethionine decarboxylas...    223   6e-67   
gb|AFY06653.1|  s-adenosyl methionine decarboxylase                     220   6e-67   
gb|AFV92895.1|  S-adenosylmethionine decarboxylase                      223   8e-67   
sp|Q04694.1|DCAM_SOLTU  RecName: Full=S-adenosylmethionine decarb...    223   8e-67   Solanum tuberosum [potatoes]
gb|AAB32507.1|  S-adenosylmethionine decarboxylase                      221   2e-66   Solanum tuberosum [potatoes]
ref|XP_008353516.1|  PREDICTED: S-adenosylmethionine decarboxylas...    222   2e-66   
ref|XP_008230354.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    223   2e-66   
ref|XP_004490299.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   3e-66   
gb|AGL95795.1|  S-adenosylmenthionine decarboxylase                     221   3e-66   
ref|XP_008362232.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   4e-66   
ref|NP_001234699.1|  S-adenosylmethionine decarboxylase                 221   4e-66   
gb|KEH17677.1|  S-adenosylmethionine decarboxylase proenzyme            222   5e-66   
ref|XP_010654269.1|  PREDICTED: S-adenosylmethionine decarboxylas...    220   7e-66   
gb|ABY81906.1|  S-adenosylmethionine decarboxylase                      219   8e-66   Vigna radiata [mung bean]
ref|XP_009373729.1|  PREDICTED: S-adenosylmethionine decarboxylas...    220   1e-65   
ref|XP_007139351.1|  hypothetical protein PHAVU_008G022100g             219   1e-65   
ref|XP_004490298.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   1e-65   
ref|XP_008811197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   1e-65   
ref|XP_010320542.1|  PREDICTED: S-adenosylmethionine decarboxylas...    221   1e-65   
sp|Q38IY3.1|DCAM_SOLCI  RecName: Full=S-adenosylmethionine decarb...    219   2e-65   Solanum chilense
ref|XP_003631339.1|  PREDICTED: S-adenosylmethionine decarboxylas...    220   2e-65   
ref|NP_001275865.1|  S-adenosylmethionine decarboxylase                 219   2e-65   
gb|KEH21805.1|  S-adenosylmethionine decarboxylase proenzyme            219   2e-65   
ref|XP_004304166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   2e-65   
ref|XP_008339774.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   2e-65   
ref|XP_011077597.1|  PREDICTED: S-adenosylmethionine decarboxylas...    218   3e-65   
dbj|BAC81653.1|  S-adenosylmethionine decarboxylase                     216   4e-65   Pisum sativum [garden pea]
sp|Q9M4D8.1|DCAM_VICFA  RecName: Full=S-adenosylmethionine decarb...    218   4e-65   Vicia faba [broad bean]
emb|CAD98785.2|  S-adenosylmethionine decarboxylase proenzyme           218   5e-65   Vitis vinifera
ref|XP_006367530.1|  PREDICTED: S-adenosylmethionine decarboxylas...    218   5e-65   
ref|XP_006437789.1|  hypothetical protein CICLE_v10033607mg             221   8e-65   
ref|XP_009588870.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   8e-65   
emb|CDP00521.1|  unnamed protein product                                217   1e-64   
gb|ADH95190.1|  S-adenosylmethionine decarboxylase                      217   1e-64   
ref|XP_010325052.1|  PREDICTED: S-adenosylmethionine decarboxylas...    217   2e-64   
gb|ABY55856.1|  S-adenosylmethionine decarboxylase 3                    217   2e-64   Solanum lycopersicum
ref|XP_010091687.1|  S-adenosylmethionine decarboxylase proenzyme       216   2e-64   
ref|XP_009801145.1|  PREDICTED: S-adenosylmethionine decarboxylas...    218   3e-64   
emb|CAN66014.1|  hypothetical protein VITISV_041154                     216   3e-64   Vitis vinifera
gb|ACZ73828.1|  S-adenosylmethionine decarboxylase                      216   3e-64   Olea europaea
gb|ABW21900.1|  putative S-adenosylmethionine decarboxylase proen...    214   8e-64   Solanum chilense
gb|AEO52839.1|  putative S-adenosylmethionine decarboxylase proen...    214   1e-63   
gb|ADV29170.1|  S-adenosylmethionine decarboxylase proenzyme            214   1e-63   
gb|ADV29125.1|  S-adenosylmethionine decarboxylase proenzyme            214   1e-63   
gb|AAR84406.1|  S-adenosylmethionine decarboxylase                      214   1e-63   Daucus carota [carrots]
gb|ABW21925.1|  putative S-adenosylmethionine decarboxylase proen...    214   1e-63   Solanum chilense
gb|ABW21898.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   Solanum chilense
gb|ABW21863.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   Solanum peruvianum [Peruvian tomato]
ref|XP_006288009.1|  hypothetical protein CARUB_v10001243mg             214   2e-63   
gb|AAX56882.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   Solanum peruvianum [Peruvian tomato]
gb|AAX56886.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   Solanum peruvianum [Peruvian tomato]
gb|AEO52842.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   
gb|ABW21873.1|  putative S-adenosylmethionine decarboxylase proen...    213   2e-63   Solanum peruvianum [Peruvian tomato]
gb|AEO52841.1|  putative S-adenosylmethionine decarboxylase proen...    213   3e-63   
gb|ABW21915.1|  putative S-adenosylmethionine decarboxylase proen...    213   3e-63   Solanum chilense
gb|ABW21878.1|  putative S-adenosylmethionine decarboxylase proen...    213   3e-63   Solanum peruvianum [Peruvian tomato]
gb|AAR15894.1|  S-adenosyl-L-methionine decarboxylase                   214   3e-63   Brassica juncea [brown mustard]
gb|ADV29140.1|  S-adenosylmethionine decarboxylase proenzyme            213   3e-63   
gb|ABW21887.1|  putative S-adenosylmethionine decarboxylase proen...    213   3e-63   Solanum peruvianum [Peruvian tomato]
gb|ABW21917.1|  putative S-adenosylmethionine decarboxylase proen...    213   3e-63   Solanum chilense
sp|Q43820.1|DCAM_PEA  RecName: Full=S-adenosylmethionine decarbox...    213   4e-63   Pisum sativum [garden pea]
sp|O49972.1|DCAM2_BRAJU  RecName: Full=S-adenosylmethionine decar...    213   6e-63   Brassica juncea [brown mustard]
gb|ABW21919.1|  putative S-adenosylmethionine decarboxylase proen...    212   6e-63   Solanum chilense
emb|CDY26478.1|  BnaC09g41900D                                          213   7e-63   
gb|AAZ85232.1|  putative S-adenosylmethionine decarboxylase proen...    212   8e-63   Solanum chmielewskii
ref|NP_197099.1|  S-adenosylmethionine decarboxylase proenzyme 2        212   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|ADV29203.1|  S-adenosylmethionine decarboxylase proenzyme            211   1e-62   
gb|EPS62258.1|  s-adenosylmethionine decarboxylase proenzyme            212   1e-62   
gb|AAX56905.1|  putative S-adenosylmethionine decarboxylase proen...    211   1e-62   Solanum habrochaites
gb|AEO52758.1|  putative S-adenosylmethionine decarboxylase proen...    211   1e-62   
gb|ADV29171.1|  S-adenosylmethionine decarboxylase proenzyme            211   1e-62   
gb|AAX56884.1|  putative S-adenosylmethionine decarboxylase proen...    211   1e-62   Solanum peruvianum [Peruvian tomato]
gb|ADV29165.1|  S-adenosylmethionine decarboxylase proenzyme            211   1e-62   
gb|ABW21895.1|  putative S-adenosylmethionine decarboxylase proen...    211   1e-62   Solanum peruvianum [Peruvian tomato]
gb|AGV54395.1|  S-adenosylmethionine decarboxylase                      211   1e-62   
gb|ADV29193.1|  S-adenosylmethionine decarboxylase proenzyme            211   1e-62   
gb|ABW21885.1|  putative S-adenosylmethionine decarboxylase proen...    211   1e-62   Solanum peruvianum [Peruvian tomato]
ref|XP_007153542.1|  hypothetical protein PHAVU_003G044200g             211   2e-62   
gb|ABW21889.1|  putative S-adenosylmethionine decarboxylase proen...    211   2e-62   Solanum peruvianum [Peruvian tomato]
gb|ABW21890.1|  putative S-adenosylmethionine decarboxylase proen...    211   2e-62   Solanum peruvianum [Peruvian tomato]
sp|Q9AXE3.1|DCAM_DAUCA  RecName: Full=S-adenosylmethionine decarb...    211   2e-62   Daucus carota [carrots]
gb|AAZ85231.1|  putative S-adenosylmethionine decarboxylase proen...    211   2e-62   Solanum lycopersicoides
gb|ABW21876.1|  putative S-adenosylmethionine decarboxylase proen...    210   3e-62   Solanum peruvianum [Peruvian tomato]
ref|XP_010904619.1|  PREDICTED: S-adenosylmethionine decarboxylas...    211   3e-62   
gb|ABW21931.1|  putative S-adenosylmethionine decarboxylase proen...    210   3e-62   Solanum chilense
gb|ADV29194.1|  S-adenosylmethionine decarboxylase proenzyme            210   3e-62   
gb|AEO52817.1|  putative S-adenosylmethionine decarboxylase proen...    210   3e-62   
gb|ABW21912.1|  putative S-adenosylmethionine decarboxylase proen...    210   3e-62   Solanum chilense
gb|ADV29198.1|  S-adenosylmethionine decarboxylase proenzyme            210   3e-62   
sp|P46255.1|DCAM_SPIOL  RecName: Full=S-adenosylmethionine decarb...    210   4e-62   Spinacia oleracea
gb|ABW21886.1|  putative S-adenosylmethionine decarboxylase proen...    210   4e-62   Solanum peruvianum [Peruvian tomato]
gb|ADV29185.1|  S-adenosylmethionine decarboxylase proenzyme            209   5e-62   
dbj|BAB83763.1|  S-adenosylmethionine decarboxylase                     210   5e-62   Phaseolus lunatus
gb|AAZ85242.1|  putative S-adenosylmethionine decarboxylase proen...    209   6e-62   Solanum pimpinellifolium [currant tomato]
gb|AAZ85237.1|  putative S-adenosylmethionine decarboxylase proen...    209   6e-62   Solanum chmielewskii
ref|XP_010692003.1|  PREDICTED: S-adenosylmethionine decarboxylas...    210   6e-62   
ref|XP_002871694.1|  adenosylmethionine decarboxylase family protein    210   8e-62   
gb|ADV29181.1|  S-adenosylmethionine decarboxylase proenzyme            209   9e-62   
ref|XP_006395646.1|  hypothetical protein EUTSA_v10004463mg             209   2e-61   
ref|XP_006400122.1|  hypothetical protein EUTSA_v10015260mg             208   3e-61   
gb|AGZ90156.1|  S-adenosylmethionine decarboxylase                      207   4e-61   
ref|XP_010492454.1|  PREDICTED: S-adenosylmethionine decarboxylas...    207   5e-61   
emb|CAA69073.1|  S-adenosylmethionine decarboxylase                     207   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186896.1|  conserved peptide upstream open reading frame 9       207   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06846.1|  AT3g02470/F16B3_10                                      207   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAS45435.1|  S-adenosylmethionine decarboxylase                      206   1e-60   Brassica juncea [brown mustard]
ref|XP_010420276.1|  PREDICTED: S-adenosylmethionine decarboxylas...    206   2e-60   
ref|XP_006291363.1|  hypothetical protein CARUB_v10017502mg             206   2e-60   
ref|XP_010681340.1|  PREDICTED: S-adenosylmethionine decarboxylas...    206   2e-60   
ref|XP_002882231.1|  S-adenosylmethionine decarboxylase                 206   3e-60   
gb|ADD91751.1|  S-adenosylmethionine decarboxylase proenzyme            205   3e-60   
ref|XP_006408415.1|  hypothetical protein EUTSA_v10022357mg             206   4e-60   
ref|NP_189184.1|  S-adenosylmethionine decarboxylase                    205   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132246.1|  PREDICTED: S-adenosylmethionine decarboxylas...    202   5e-60   
gb|ADF81049.1|  S-adenosylmethionine decarboxylase                      204   7e-60   
emb|CDX78666.1|  BnaA03g05780D                                          202   9e-60   
sp|Q39677.1|DCAM2_DIACA  RecName: Full=S-adenosylmethionine decar...    204   1e-59   Dianthus caryophyllus [carnation]
emb|CDX69487.1|  BnaA10g18360D                                          204   1e-59   
ref|XP_010549939.1|  PREDICTED: S-adenosylmethionine decarboxylas...    204   2e-59   
gb|ADG57793.1|  S-adenosyl-l-methionine decarboxylase 3-2               204   2e-59   
gb|EPS67756.1|  hypothetical protein M569_07018                         205   2e-59   
ref|XP_010463654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    203   2e-59   
dbj|BAP47514.1|  S-adenosylmethionine decarboxylase                     203   3e-59   
gb|ADD91750.1|  S-adenosylmethionine decarboxylase proenzyme            203   3e-59   
gb|ADF81048.1|  S-adenosylmethionine decarboxylase                      202   5e-59   
ref|XP_006299023.1|  hypothetical protein CARUB_v10015160mg             204   5e-59   
ref|XP_010528023.1|  PREDICTED: S-adenosylmethionine decarboxylas...    202   8e-59   
ref|XP_010453744.1|  PREDICTED: S-adenosylmethionine decarboxylas...    202   8e-59   
emb|CDX74257.1|  BnaA03g27900D                                          202   8e-59   
emb|CDY71278.1|  BnaAnng36830D                                          202   9e-59   
sp|Q9SDM8.1|DCAM3_BRAJU  RecName: Full=S-adenosylmethionine decar...    201   1e-58   Brassica juncea [brown mustard]
gb|AAB17665.1|  S-adenosylmethionine decarboxylase                      201   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134671.1|  PREDICTED: S-adenosylmethionine decarboxylas...    201   2e-58   
ref|XP_009118044.1|  PREDICTED: S-adenosylmethionine decarboxylas...    201   2e-58   
emb|CDX91992.1|  BnaC03g32940D                                          200   4e-58   
gb|KEH21806.1|  S-adenosylmethionine decarboxylase proenzyme            201   5e-58   
emb|CDY71710.1|  BnaAnng38530D                                          201   6e-58   
gb|ADG57791.1|  S-adenosyl-l-methionine decarboxylase 3-1               199   8e-58   
ref|XP_010525150.1|  PREDICTED: S-adenosylmethionine decarboxylas...    197   5e-57   
ref|XP_009147351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    197   7e-57   
emb|CDY57536.1|  BnaA05g33510D                                          197   8e-57   
gb|KEH20218.1|  S-adenosylmethionine decarboxylase proenzyme            196   2e-56   
ref|XP_010044331.1|  PREDICTED: S-adenosylmethionine decarboxylas...    195   2e-56   
ref|XP_010430714.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    193   7e-56   
emb|CDX70666.1|  BnaC03g07500D                                          193   2e-55   
emb|CDY43235.1|  BnaC05g48280D                                          194   1e-54   
gb|AAR00210.1|  S-adenosylmethionine decarboxylase                      189   1e-54   Phaseolus vulgaris [French bean]
sp|Q39676.1|DCAM1_DIACA  RecName: Full=S-adenosylmethionine decar...    191   2e-54   Dianthus caryophyllus [carnation]
gb|ABK25576.1|  unknown                                                 190   3e-54   Picea sitchensis
ref|XP_009418028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    190   5e-54   
gb|ABR17745.1|  unknown                                                 190   5e-54   Picea sitchensis
ref|XP_010261810.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    189   6e-54   
emb|CAJ42877.1|  S-adenosyl methionine decarboxylase                    186   7e-54   Plantago major [cart-track plant]
dbj|BAF91878.1|  S-adenosylmethionine decarboxylase                     185   5e-53   Nicotiana benthamiana
ref|XP_009401295.1|  PREDICTED: S-adenosylmethionine decarboxylas...    185   4e-52   
gb|ABU55003.1|  S-adenosylmethionine decarboxylase                      183   4e-52   Phaseolus vulgaris [French bean]
ref|XP_009403328.1|  PREDICTED: S-adenosylmethionine decarboxylas...    184   7e-52   
gb|ADQ37302.1|  putative S-adenosyl methionine decarboxylase            184   8e-52   
ref|XP_009401296.1|  PREDICTED: S-adenosylmethionine decarboxylas...    185   1e-51   
ref|NP_001047404.1|  Os02g0611200                                       182   8e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KDO70175.1|  hypothetical protein CISIN_1g0194112mg                  180   8e-51   
gb|AGR89928.1|  S-adenosyl-L-methionine decarboxylase                   181   1e-50   
gb|EMS62883.1|  S-adenosylmethionine decarboxylase proenzyme            181   2e-50   
gb|EEE57355.1|  hypothetical protein OsJ_07492                          182   3e-50   Oryza sativa Japonica Group [Japonica rice]
gb|AEN81738.1|  AT3G02470-like protein                                  175   3e-50   
gb|ADG38371.1|  AT3G02470-like protein                                  175   3e-50   
gb|ADG38370.1|  AT3G02470-like protein                                  175   3e-50   
dbj|BAK00199.1|  predicted protein                                      179   5e-50   
gb|ADE92938.1|  S-adenosylmethionine decarboxylase                      179   5e-50   
gb|ADG38369.1|  AT3G02470-like protein                                  174   6e-50   
gb|ADG38368.1|  AT3G02470-like protein                                  174   6e-50   
gb|ADG38367.1|  AT3G02470-like protein                                  174   6e-50   
gb|AAO43186.1|  S-adenosylmethionine decarboxylase                      179   7e-50   Narcissus pseudonarcissus
gb|AHJ14567.1|  S-adenosyl methionine decarboxylase 1                   179   9e-50   
ref|XP_009121534.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    178   9e-50   
gb|ABJ15728.1|  S-adenosylmethionine decarboxylase                      179   1e-49   Triticum monococcum [einkorn wheat]
ref|XP_008793521.1|  PREDICTED: S-adenosylmethionine decarboxylas...    178   1e-49   
gb|EMT11715.1|  S-adenosylmethionine decarboxylase proenzyme            178   2e-49   
gb|EMS45151.1|  S-adenosylmethionine decarboxylase proenzyme            178   2e-49   
gb|AHJ14568.1|  S-adenosyl methionine decarboxylase 1                   178   2e-49   
ref|XP_010929198.1|  PREDICTED: S-adenosylmethionine decarboxylas...    178   3e-49   
gb|EAY86651.1|  hypothetical protein OsI_08032                          182   3e-49   Oryza sativa Indica Group [Indian rice]
gb|ADG38373.1|  AT3G02470-like protein                                  172   5e-49   
ref|XP_004953064.1|  PREDICTED: S-adenosylmethionine decarboxylas...    177   5e-49   
gb|KEH21807.1|  S-adenosylmethionine decarboxylase proenzyme            176   7e-49   
gb|AHJ14566.1|  S-adenosyl methionine decarboxylase 1                   176   7e-49   
gb|ADC45379.1|  S-adenosylmethionine decarboxylase                      177   8e-49   
gb|ADG38372.1|  AT3G02470-like protein                                  171   9e-49   
ref|NP_001053213.1|  Os04g0498600                                       176   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    176   1e-48   
gb|EMT10641.1|  S-adenosylmethionine decarboxylase proenzyme            176   2e-48   
sp|A2XV58.2|DCAM_ORYSI  RecName: Full=S-adenosylmethionine decarb...    176   2e-48   Oryza sativa Indica Group [Indian rice]
gb|AHJ14569.1|  S-adenosyl methionine decarboxylase 2                   175   2e-48   
gb|AAD17232.1|  S-adenosylmethionine decarboxylase precursor            175   2e-48   Triticum aestivum [Canadian hard winter wheat]
gb|ADD70015.1|  S-adenosyl-L-methionine decarboxylase 2                 175   3e-48   Leymus chinensis
emb|CAD41510.3|  OSJNBa0029H02.4                                        176   3e-48   
gb|AEL33693.1|  S-adenosyl methionine decarboxylase                     175   3e-48   
sp|Q42613.1|DCAM1_BRAJU  RecName: Full=S-adenosylmethionine decar...    174   3e-48   Brassica juncea [brown mustard]
gb|EAY94718.1|  hypothetical protein OsI_16495                          176   6e-48   Oryza sativa Indica Group [Indian rice]
gb|ABO32298.1|  S-adenosylmethionine decarboxylase                      174   6e-48   Saccharum officinarum [noble cane]
ref|XP_006845442.1|  hypothetical protein AMTR_s00019p00109640          174   7e-48   
ref|XP_010235689.1|  PREDICTED: S-adenosylmethionine decarboxylas...    174   9e-48   
ref|XP_010904594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    173   1e-47   
gb|AAX76987.1|  S-adenosylmethionine decarboxylase                      173   2e-47   
ref|XP_010268432.1|  PREDICTED: S-adenosylmethionine decarboxylas...    172   2e-47   
gb|AAL16065.1|AF420239_1  S-adenosyl-L-methionine decarboxylase         172   3e-47   
ref|XP_002452433.1|  hypothetical protein SORBIDRAFT_04g025720          172   3e-47   
gb|AGZ61932.1|  S-adenosylmethionine decarboxylase                      172   4e-47   
dbj|BAJ96795.1|  predicted protein                                      172   5e-47   
ref|NP_001149694.1|  S-adenosylmethionine decarboxylase proenzyme       172   5e-47   
gb|ADU02193.1|  S-adenosylmethionine decarboxylase                      171   7e-47   
ref|XP_004976106.1|  PREDICTED: S-adenosylmethionine decarboxylas...    172   1e-46   
sp|Q42829.1|DCAM_HORCH  RecName: Full=S-adenosylmethionine decarb...    171   1e-46   
ref|XP_010914049.1|  PREDICTED: S-adenosylmethionine decarboxylas...    171   1e-46   
gb|EAZ09149.1|  hypothetical protein OsI_31419                          171   1e-46   
ref|XP_002324514.2|  hypothetical protein POPTR_0018s11040g             171   1e-46   
ref|XP_009390538.1|  PREDICTED: S-adenosylmethionine decarboxylas...    170   1e-46   
gb|EMS50405.1|  S-adenosylmethionine decarboxylase proenzyme            171   2e-46   
ref|NP_001063217.1|  Os09g0424300                                       170   2e-46   
gb|ACT53876.1|  S-adenosylmethionine decarboxylase                      170   2e-46   
ref|NP_001148939.1|  S-adenosylmethionine decarboxylase proenzyme       170   3e-46   
ref|XP_011018087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    170   3e-46   
ref|XP_006878657.1|  hypothetical protein AMTR_s00011p00266060          169   3e-46   
ref|XP_008808772.1|  PREDICTED: S-adenosylmethionine decarboxylas...    171   3e-46   
ref|XP_007013911.1|  S-adenosylmethionine decarboxylase proenzyme...    169   4e-46   
ref|XP_010240071.1|  PREDICTED: S-adenosylmethionine decarboxylas...    170   4e-46   
gb|AGT16271.1|  S-adenosylmethionine decarboxylase                      169   9e-46   
gb|ADC45378.1|  S-adenosylmethionine decarboxylase 2                    168   1e-45   
ref|XP_010238180.1|  PREDICTED: S-adenosylmethionine decarboxylas...    169   1e-45   
ref|XP_002446740.1|  hypothetical protein SORBIDRAFT_06g021540          168   1e-45   
gb|ADD70012.1|  S-adenosyl-L-methionine decarboxylase 1                 168   1e-45   
gb|ACV52081.1|  S-adenosylmethionine decarboxylase 3                    168   1e-45   
ref|XP_010277986.1|  PREDICTED: S-adenosylmethionine decarboxylas...    168   1e-45   
ref|XP_008794388.1|  PREDICTED: S-adenosylmethionine decarboxylas...    167   2e-45   
ref|XP_004956866.1|  PREDICTED: S-adenosylmethionine decarboxylas...    167   3e-45   
ref|XP_006453539.1|  hypothetical protein CICLE_v10010502mg             167   3e-45   
gb|KDO62315.1|  hypothetical protein CISIN_1g035670mg                   166   5e-45   
gb|AGL46977.1|  S-adenosylmethionine decarboxylase                      166   6e-45   
ref|XP_006660640.1|  PREDICTED: S-adenosylmethionine decarboxylas...    166   8e-45   
gb|ACE97495.1|  S-adenosylmethionine decarboxylase                      162   9e-45   
gb|ACE97499.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97513.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97496.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97514.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97515.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97512.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
gb|ACE97501.1|  S-adenosylmethionine decarboxylase                      162   1e-44   
ref|XP_010687660.1|  PREDICTED: S-adenosylmethionine decarboxylas...    166   1e-44   
gb|ACG40518.1|  S-adenosylmethionine decarboxylase proenzyme            165   2e-44   
gb|ACE97505.1|  S-adenosylmethionine decarboxylase                      160   3e-44   
gb|ACE97492.1|  S-adenosylmethionine decarboxylase                      160   3e-44   
gb|ACE97491.1|  S-adenosylmethionine decarboxylase                      160   3e-44   
gb|ACE97508.1|  S-adenosylmethionine decarboxylase                      160   3e-44   
gb|ACE97507.1|  S-adenosylmethionine decarboxylase                      160   3e-44   
ref|NP_001105713.1|  S-adenosylmethionine decarboxylase proenzyme       164   3e-44   
gb|EYU37130.1|  hypothetical protein MIMGU_mgv1a008734mg                164   4e-44   
gb|ACE97522.1|  S-adenosylmethionine decarboxylase                      160   5e-44   
gb|ACE97520.1|  S-adenosylmethionine decarboxylase                      160   5e-44   
emb|CBI16893.3|  unnamed protein product                                156   6e-44   
emb|CAC09496.2|  H0711G06.2                                             162   9e-44   
gb|EMT07332.1|  S-adenosylmethionine decarboxylase proenzyme            164   2e-43   
ref|XP_011079446.1|  PREDICTED: S-adenosylmethionine decarboxylas...    162   2e-43   
gb|ADW83721.1|  S-adenosylmethionine decarboxylase 1                    160   2e-43   
ref|XP_009796351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    160   7e-43   
ref|XP_002462403.1|  hypothetical protein SORBIDRAFT_02g025110          161   7e-43   
gb|ACV52078.1|  S-adenosylmethionine decarboxylase 1                    160   2e-42   
dbj|BAF75727.1|  S-adenosylmethionine decarboxylase                     159   3e-42   
ref|XP_009410197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   3e-42   
gb|KCW78797.1|  hypothetical protein EUGRSUZ_C00232                     159   4e-42   
emb|CAN76946.1|  hypothetical protein VITISV_017165                     160   5e-42   
ref|XP_010047048.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   9e-42   
gb|AEV40469.1|  S-adenosylmethionine decarboxylase                      155   1e-41   
ref|NP_001149266.1|  LOC100282888                                       157   1e-41   
gb|ACL53872.1|  unknown                                                 157   2e-41   
gb|AEW43295.1|  putative S-adenosylmethionine decarboxylase             154   2e-41   
ref|XP_008652738.1|  PREDICTED: S-adenosylmethionine decarboxylas...    158   2e-41   
ref|XP_002534009.1|  s-adenosylmethionine decarboxylase, putative       155   2e-41   
ref|XP_010656641.1|  PREDICTED: S-adenosylmethionine decarboxylas...    155   5e-41   
ref|XP_002977119.1|  hypothetical protein SELMODRAFT_106449             154   5e-41   
ref|XP_002876918.1|  adenosylmethionine decarboxylase family protein    153   1e-40   
ref|XP_010105415.1|  S-adenosylmethionine decarboxylase proenzyme       154   2e-40   
gb|ADW83722.1|  S-adenosylmethionine decarboxylase 2                    154   2e-40   
gb|ABR25878.1|  s-adenosylmethionine decarboxclic proenzyme             148   2e-40   
ref|XP_002992114.1|  hypothetical protein SELMODRAFT_134821             153   2e-40   
ref|XP_010687659.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   1e-39   
emb|CDP02875.1|  unnamed protein product                                151   3e-39   
ref|XP_002977805.1|  hypothetical protein SELMODRAFT_14131              149   4e-39   
gb|ABR25592.1|  s-adenosylmethionine decarboxylase proenzyme            144   1e-38   
gb|KGN61070.1|  hypothetical protein Csa_2G036680                       149   1e-38   
ref|XP_009618361.1|  PREDICTED: S-adenosylmethionine decarboxylas...    149   2e-38   
ref|XP_004144715.1|  PREDICTED: S-adenosylmethionine decarboxylas...    149   2e-38   
ref|XP_003550675.1|  PREDICTED: S-adenosylmethionine decarboxylas...    148   2e-38   
gb|KCW78796.1|  hypothetical protein EUGRSUZ_C00232                     148   3e-38   
ref|XP_004163988.1|  PREDICTED: S-adenosylmethionine decarboxylas...    149   4e-38   
ref|XP_002979516.1|  hypothetical protein SELMODRAFT_14106              145   7e-38   
ref|XP_001757739.1|  predicted protein                                  145   1e-36   
ref|XP_001776462.1|  predicted protein                                  144   1e-36   
ref|XP_001776491.1|  predicted protein                                  144   1e-36   
dbj|BAE72687.1|  S-adenosylmethionine decarboxylase                     139   2e-36   
ref|XP_001775168.1|  predicted protein                                  143   2e-36   
ref|XP_008452459.1|  PREDICTED: S-adenosylmethionine decarboxylas...    143   5e-36   
ref|XP_002973835.1|  hypothetical protein SELMODRAFT_100475             142   5e-36   
gb|KDP38736.1|  hypothetical protein JCGZ_04089                         142   6e-36   
gb|AID66751.1|  S-adenosylmethionine decarboxylase protein              137   8e-36   
ref|XP_002983556.1|  hypothetical protein SELMODRAFT_118443             141   1e-35   
gb|AAT67246.1|  S-adenosylmethionine decarboxylase                      130   2e-33   
gb|AER27717.1|  S-adenosylmethionine decarboxylase                      132   3e-33   
dbj|BAD97831.1|  S-adenosylmethionine decarboxylase                     130   4e-33   
ref|XP_002891408.1|  hypothetical protein ARALYDRAFT_314242             131   1e-32   
ref|XP_001782581.1|  predicted protein                                  131   6e-32   
gb|AER27716.1|  S-adenosylmethionine decarboxylase                      127   2e-31   
ref|XP_002882990.1|  hypothetical protein ARALYDRAFT_897930             125   2e-30   
gb|KFM24458.1|  S-adenosylmethionine decarboxylase proenzyme            129   3e-30   
gb|ABO32297.1|  S-adenosylmethionine decarboxylase                      122   3e-29   
emb|CDY49835.1|  BnaC01g34670D                                          122   5e-29   
ref|XP_009115932.1|  PREDICTED: S-adenosylmethionine decarboxylas...    122   7e-29   
emb|CAG28949.1|  S-adenosylmethionine decarboxylase                     120   2e-28   
gb|ABA03221.1|  S-adenosylmethionine decarboxylase 1                    115   5e-28   
gb|ABA03224.1|  S-adenosylmethionine decarboxylase 4                    117   6e-28   
ref|XP_009602655.1|  PREDICTED: S-adenosylmethionine decarboxylas...    114   7e-26   
gb|ABA03222.1|  S-adenosylmethionine decarboxylase 2                    109   2e-25   
gb|AAQ14850.1|AF321142_1  S-adenosylmethionine decarboxylase            107   2e-25   
emb|CDO98960.1|  unnamed protein product                                108   7e-24   
ref|XP_006356688.1|  PREDICTED: S-adenosylmethionine decarboxylas...    107   2e-23   
ref|XP_002516818.1|  s-adenosylmethionine decarboxylase, putative       106   4e-23   
ref|XP_003542902.1|  PREDICTED: S-adenosylmethionine decarboxylas...    105   5e-23   
ref|XP_007035369.1|  Adenosylmethionine decarboxylase family protein    105   9e-23   
ref|XP_004241063.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   1e-22   
ref|XP_004297028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   1e-22   
ref|XP_004229470.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   1e-22   
ref|XP_002430323.1|  S-adenosylmethionine decarboxylase, putative       104   1e-22   
ref|XP_011006075.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   2e-22   
ref|XP_009781838.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   2e-22   
ref|XP_010024449.1|  PREDICTED: S-adenosylmethionine decarboxylas...    104   2e-22   
ref|XP_002312726.1|  hypothetical protein POPTR_0008s20330g             103   2e-22   
ref|XP_011071531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    103   3e-22   
gb|KHN03415.1|  S-adenosylmethionine decarboxylase proenzyme            103   4e-22   
dbj|GAM22020.1|  hypothetical protein SAMD00019534_051950               103   4e-22   
ref|XP_006365286.1|  PREDICTED: S-adenosylmethionine decarboxylas...    103   4e-22   
ref|XP_003550518.1|  PREDICTED: S-adenosylmethionine decarboxylas...    103   4e-22   
ref|XP_011011751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    103   4e-22   
ref|XP_010255822.1|  PREDICTED: S-adenosylmethionine decarboxylas...    103   4e-22   
ref|XP_011090841.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   5e-22   
ref|XP_004167626.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    102   5e-22   
ref|XP_007222179.1|  hypothetical protein PRUPE_ppa007795mg             102   5e-22   
ref|XP_010524778.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   6e-22   
ref|XP_008223049.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    102   6e-22   
ref|XP_002314430.2|  hypothetical protein POPTR_0010s02930g             102   7e-22   
ref|XP_010036128.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   8e-22   
ref|XP_003547228.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   9e-22   
ref|XP_004134166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   1e-21   
ref|XP_003528663.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   1e-21   
ref|XP_008438742.1|  PREDICTED: S-adenosylmethionine decarboxylas...    102   1e-21   
ref|XP_004145040.1|  PREDICTED: S-adenosylmethionine decarboxylas...    101   1e-21   
ref|XP_003609535.1|  S-adenosylmethionine decarboxylase proenzyme       101   2e-21   
ref|XP_004153549.1|  PREDICTED: S-adenosylmethionine decarboxylas...    101   2e-21   
ref|XP_006489274.1|  PREDICTED: S-adenosylmethionine decarboxylas...    101   2e-21   
gb|KDP40067.1|  hypothetical protein JCGZ_02065                         101   2e-21   
ref|XP_008553419.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   2e-21   
ref|XP_008458531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   2e-21   
ref|XP_010105688.1|  S-adenosylmethionine decarboxylase proenzyme 3     100   3e-21   
ref|XP_006850850.1|  hypothetical protein AMTR_s00025p00139140          100   3e-21   
ref|XP_008553411.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   3e-21   
ref|XP_008340886.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   4e-21   
ref|XP_010279141.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   4e-21   
ref|NP_197394.1|  S-adenosylmethionine decarboxylase                    100   4e-21   
ref|XP_006419758.1|  hypothetical protein CICLE_v10005303mg             100   4e-21   
ref|XP_009339941.1|  PREDICTED: S-adenosylmethionine decarboxylas...    100   4e-21   
ref|XP_002057185.1|  GJ16493                                            100   5e-21   
gb|EPS69535.1|  s-adenosylmethionine decarboxylase proenzyme          99.8    7e-21   
ref|XP_007154193.1|  hypothetical protein PHAVU_003G097900g           99.8    7e-21   
ref|XP_004486095.1|  PREDICTED: S-adenosylmethionine decarboxylas...  99.8    7e-21   
gb|EYU45598.1|  hypothetical protein MIMGU_mgv1a019750mg              99.4    7e-21   
ref|XP_010546901.1|  PREDICTED: S-adenosylmethionine decarboxylas...  99.4    9e-21   
ref|XP_004508338.1|  PREDICTED: S-adenosylmethionine decarboxylas...  99.0    1e-20   
ref|XP_009621214.1|  PREDICTED: S-adenosylmethionine decarboxylas...  99.0    1e-20   
ref|XP_009782050.1|  PREDICTED: S-adenosylmethionine decarboxylas...  99.0    1e-20   
gb|KDO74922.1|  hypothetical protein CISIN_1g041801mg                 99.0    1e-20   
ref|XP_008811998.1|  PREDICTED: S-adenosylmethionine decarboxylas...  98.6    1e-20   
ref|XP_007147821.1|  hypothetical protein PHAVU_006G157800g           99.0    2e-20   
ref|XP_006290030.1|  hypothetical protein CARUB_v10003664mg           98.2    2e-20   
ref|XP_004537907.1|  PREDICTED: S-adenosylmethionine decarboxylas...  97.8    2e-20   
ref|XP_003706887.1|  PREDICTED: S-adenosylmethionine decarboxylas...  97.8    3e-20   
gb|KDR24068.1|  S-adenosylmethionine decarboxylase proenzyme          97.1    3e-20   
ref|XP_003594071.1|  S-adenosylmethionine decarboxylase proenzyme     97.4    4e-20   
ref|XP_010454143.1|  PREDICTED: S-adenosylmethionine decarboxylas...  97.1    5e-20   
ref|XP_010420666.1|  PREDICTED: S-adenosylmethionine decarboxylas...  97.1    6e-20   
ref|XP_006625051.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.9    7e-20   
ref|XP_001604272.1|  PREDICTED: S-adenosylmethionine decarboxylas...  94.4    8e-20   
ref|XP_009352148.1|  PREDICTED: S-adenosylmethionine decarboxylas...  96.3    8e-20   
ref|XP_002873919.1|  BUD2/SAMDC4                                      96.3    8e-20   
ref|XP_010492932.1|  PREDICTED: S-adenosylmethionine decarboxylas...  96.3    9e-20   
ref|XP_002014395.1|  GL18975                                          96.3    1e-19   
gb|EFN61772.1|  S-adenosylmethionine decarboxylase proenzyme          95.9    1e-19   
ref|XP_006572360.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.5    1e-19   
ref|XP_008390797.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.9    1e-19   
emb|CBJ32442.1|  S-Adenosylmethionine decarboxylase                   96.3    1e-19   
ref|XP_011051888.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.9    1e-19   
gb|EFA85685.1|  S-adenosylmethionine decarboxylase                    95.9    1e-19   
ref|XP_003692892.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.5    2e-19   
ref|XP_003057072.1|  adenosylmethionine/pyridoxal dependant decar...  98.6    2e-19   
ref|XP_001969454.1|  GG10109                                          95.1    2e-19   
ref|XP_003403355.1|  PREDICTED: s-adenosylmethionine decarboxylas...  95.1    2e-19   
ref|XP_003484405.1|  PREDICTED: S-adenosylmethionine decarboxylas...  95.1    2e-19   
gb|EZA54604.1|  S-adenosylmethionine decarboxylase proenzyme          95.1    2e-19   
ref|XP_011169158.1|  PREDICTED: S-adenosylmethionine decarboxylas...  94.7    3e-19   
ref|XP_001992742.1|  GH24050                                          94.0    6e-19   
ref|XP_002089086.1|  SamDC                                            94.0    6e-19   
ref|XP_002010868.1|  GI21472                                          94.0    7e-19   
gb|KCW60900.1|  hypothetical protein EUGRSUZ_H03638                   93.6    7e-19   
emb|CAN76568.1|  hypothetical protein VITISV_030214                   93.6    7e-19   
ref|XP_010921966.1|  PREDICTED: S-adenosylmethionine decarboxylas...  93.6    7e-19   
ref|XP_002078924.1|  GD23679                                          93.6    7e-19   
ref|XP_002277316.1|  PREDICTED: S-adenosylmethionine decarboxylas...  93.6    8e-19   
gb|KFK34011.1|  hypothetical protein AALP_AA5G090500                  93.6    8e-19   
ref|NP_477223.2|  S-adenosylmethionine decarboxylase                  93.6    8e-19   
ref|XP_002036484.1|  GM18181                                          93.6    9e-19   
sp|P91931.1|DCAM_DROME  RecName: Full=S-adenosylmethionine decarb...  93.2    9e-19   
emb|CAA72505.1|  S-adenosylmethionine decarboxylase                   93.2    9e-19   
ref|XP_001963095.1|  GF15768                                          93.2    1e-18   
ref|XP_004990813.1|  adenosylmethionine decarboxylase 1 isoform 2     93.2    1e-18   
ref|XP_004337902.1|  adenosylmethionine decarboxylase                 92.8    2e-18   
ref|XP_008793650.1|  PREDICTED: S-adenosylmethionine decarboxylas...  92.4    2e-18   
gb|EWM21312.1|  s-adenosylmethionine decarboxylase                    94.4    2e-18   



>sp|Q96471.1|DCAM_IPONI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea nil]
 gb|AAC04611.1| S-adenosylmethionine decarboxylase [Ipomoea nil]
Length=362

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD KSASVF+KT SSSAAVMT  SGIR ILP S+ICDFDFEPCGYSMNA+E 
Sbjct  181  TLEMCMTGLDKKSASVFFKTQSSSAAVMTDASGIRKILPGSDICDFDFEPCGYSMNAVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
              ISTIHVTPEDGFSYASFEA+GYDFK ++L+AL++RVL+CF+PA+FSVALH +S G +L
Sbjct  241  GTISTIHVTPEDGFSYASFEAMGYDFKDVNLDALIQRVLSCFQPAEFSVALHCDSIGEKL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEG  534
             SVF LDV+GY   + S +ALG GGSIMYC FT ST SCGSPRSTL CCWSE+ED+EG
Sbjct  301  DSVFELDVKGYACGERSYEALGKGGSIMYCGFT-STGSCGSPRSTLLCCWSENEDQEG  357



>sp|Q9M6K1.1|DCAM_IPOBA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea batatas]
 gb|AAF71199.1|AF188998_1 S-adenosylmethionine decarboxylase [Ipomoea batatas]
 gb|AAN03494.1|AF291761_2 S-adenosylmethionine decarboxylase [Ipomoea batatas]
Length=362

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD KSASVF+KT SSSAAVMT  SGIR ILP SEICDFDFEPCGYSMNA+E 
Sbjct  181  TLEMCMTGLDKKSASVFFKTQSSSAAVMTDASGIRKILPGSEICDFDFEPCGYSMNAVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AIS IHVTPEDGFSYASFEA+GYDFK ++L+AL++RVL+CF+PA+FSVALH +S G +L
Sbjct  241  GAISPIHVTPEDGFSYASFEAMGYDFKDVNLDALIQRVLSCFQPAEFSVALHCDSIGEKL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEG  534
             SVF LDV+GY   + S + L  GGSIMYC FT ST SCGSPRSTL CCWSE+EDEEG
Sbjct  301  DSVFKLDVKGYACGERSYEGLNKGGSIMYCGFT-STGSCGSPRSTLLCCWSENEDEEG  357



>ref|XP_011099087.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=410

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+K+ S SAAVMT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  231  TLEMCMTNLDQKKASVFFKSQSDSAAVMTEVSGIRKILPDSEICDFDFDPCGYSMNAIEG  290

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIH+TPEDGFSYASFEA+GYDFK L L  L+ERVLACFKPA FSVALH++    EL
Sbjct  291  AAISTIHITPEDGFSYASFEAVGYDFKQLDLTLLLERVLACFKPATFSVALHASVAEKEL  350

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             S F LDV+GY     S K LG+GG++MY SFTS   SCGSP+S L+CCWSE+EDEE
Sbjct  351  DSEFTLDVKGYTCGGRSYKVLGDGGAMMYNSFTSQ-GSCGSPKSILHCCWSENEDEE  406



>emb|CDP02379.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   A+VFYKT S SAAVMT+TSGIR ILP+SEICDFDF+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDKNRAAVFYKTRSRSAAVMTETSGIRKILPQSEICDFDFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGF+YASFEA+GYD K L L  L+ERVLACF+P +F  ALHS S+G EL
Sbjct  241  DAISTIHVTPEDGFNYASFEAVGYDLKVLDLTKLLERVLACFQPTEFCFALHSGSSGEEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
               FNL+++GY  ++ SC+ LG GGSI+Y SFT +   CGSPRS L CCWSESEDE
Sbjct  301  DFDFNLNLKGYTCEERSCEMLGKGGSIIYQSFTGA-GCCGSPRSILKCCWSESEDE  355



>ref|XP_009764781.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=362

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+KTHSS+AA MT+ SGIR ILPES ICDFDF+PCGYSMNAIE 
Sbjct  182  TLEMCMTNLDKKKASVFFKTHSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDFK ++L A++ERVL+CF PA+FSV+LH ++ G EL
Sbjct  242  PAISTIHVTPEDGFSYASFEAVGYDFKDVNLTAMIERVLSCFGPAEFSVSLHCDTPGKEL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             +   LD+ GY S + + + LG GGS+ Y +F SS  SCGSPRS  +C WSESEDEE
Sbjct  302  YTESGLDIIGYASGEKTTEVLGEGGSLTYLTF-SSNGSCGSPRSIFHCSWSESEDEE  357



>ref|XP_009622584.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=384

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+KTHSS+AA MT+ SGIR ILPES ICDFDF+PCGYSMNAIE 
Sbjct  204  TLEMCMTNLDKKKASVFFKTHSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAIEG  263

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIH+TPEDGFSYASFEA+GYDFK ++L A++ERVL+CF PA+FSV++H ++ G EL
Sbjct  264  PAISTIHITPEDGFSYASFEAVGYDFKAVNLTAMIERVLSCFGPAEFSVSVHCDTPGKEL  323

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             +   LD+ GY S + + + LG GGS+ Y +F SS  SCGSPRS  +C WSESEDEE
Sbjct  324  YTESGLDIIGYASGEKTTEVLGEGGSLTYLTF-SSNGSCGSPRSIFHCSWSESEDEE  379



>ref|XP_006338297.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=362

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+KT SS+AA MT+ SGIR ILPES ICDFDF+PCGYSMNA+E 
Sbjct  182  TLEMCMTNLDKKKASVFFKTQSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAVEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIH+TPEDGFSYASFEA+GYDF+ + L+A++ERVL+CF+PA+FSVALH +  G EL
Sbjct  242  PAISTIHITPEDGFSYASFEAVGYDFRAVDLSAMIERVLSCFRPAEFSVALHCDIPGKEL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             +   LDV GYVS + + + LG GGS+ Y +F SS  SCGSPRS L+ CWSE+EDEE
Sbjct  302  YTESGLDVIGYVSGEKTTEVLGKGGSLTYLTF-SSGGSCGSPRSILSNCWSENEDEE  357



>gb|EYU44271.1| hypothetical protein MIMGU_mgv1a008754mg [Erythranthe guttata]
Length=363

 Score =   248 bits (634),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+K  SSSAAVMT+ SGIR ILPES+ICDFDFEPCGYSMNAIE 
Sbjct  182  TLEMCMTNLDQKKASVFFKNQSSSAAVMTEVSGIRKILPESDICDFDFEPCGYSMNAIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIH+TPEDGFSYASFEA+GY+F+   L+ LVERVL CFKPA FSV+LHS+ +G E+
Sbjct  242  GAISTIHITPEDGFSYASFEAVGYEFERDDLSQLVERVLDCFKPAKFSVSLHSSVSGDEV  301

Query  361  GSVFN-LDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             + F  LD+ GY   + S + LG+GG+++Y SFTS+   CGSP+STL CCWSE+EDEE
Sbjct  302  DTEFGALDIEGYRCGEKSFEELGDGGAMVYSSFTSN-GGCGSPKSTLQCCWSENEDEE  358



>ref|XP_004233654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicum]
Length=417

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+KT SS+AA MT+ SGIR ILPES ICDFDF+PCGYSMNA+E 
Sbjct  237  TLEMCMTNLDKKKASVFFKTQSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAVEG  296

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIH+TPEDGFSYASFEA+GYDF+ + L+A++ERVL+CF PA+FSVALH +  G EL
Sbjct  297  SAISTIHITPEDGFSYASFEAVGYDFRAVDLSAMIERVLSCFGPAEFSVALHCDILGKEL  356

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             +   LD+ GYVS + + + LG GGS+ Y +F SS  SCGSPRS LN CWSE+EDEE
Sbjct  357  YTESGLDIIGYVSGEKTTEMLGKGGSLTYLTF-SSGGSCGSPRSILNNCWSENEDEE  412



>ref|XP_011008131.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
 ref|XP_011008132.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKTH+SSA VMT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPE+GFSYASFEA+GYDF+ L+L  L+ RVL CF+P +FS+ALHSN    EL
Sbjct  241  SAISTIHVTPEEGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIALHSNVECDEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            G++F+LDV+GY S   + + LG GGSI+Y SF ++T  C SPRS L CCWS
Sbjct  301  GAMFSLDVKGYSSGGGNYEMLGKGGSIVYHSF-AATGGCSSPRSILKCCWS  350



>ref|XP_007033429.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
 gb|EOY04355.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
Length=370

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKTH SSA +MT+ SGIR+ILP+S+ICDF+F+PCGYSMN+IE+
Sbjct  181  TLEMCMTGLDKKKASVFYKTHVSSAVLMTEHSGIREILPQSQICDFEFDPCGYSMNSIEK  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA GYDF+T++LN L+ERVLACF+P +FSV+LH++  G  L
Sbjct  241  DAISTIHVTPEDGFSYASFEAAGYDFETVNLNQLMERVLACFRPTEFSVSLHADVNGDVL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESE-DEEGG  537
                +LDV GY  ++     LGNG S++Y SF  +   C SPRS L CCWSE E DEE G
Sbjct  301  DHRIHLDVNGYCCEERRFDVLGNGSSVIYYSFIGADV-CVSPRSILKCCWSEDEKDEEVG  359

Query  538  IR  543
             R
Sbjct  360  FR  361



>ref|XP_010032594.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Eucalyptus grandis]
 gb|KCW52007.1| hypothetical protein EUGRSUZ_J01447 [Eucalyptus grandis]
Length=361

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL  + ASVF+K +S SAA MT+ SGIR ILP+S+ICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLGKQRASVFFKENSPSAAAMTEESGIRKILPKSDICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            + ISTIHVTPEDGFSYASFEA+GYDFK   L+ L++RVL CF+P +FSVALHS+  G +L
Sbjct  241  SGISTIHVTPEDGFSYASFEAVGYDFKAADLSQLIQRVLVCFEPTEFSVALHSDLAGEDL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
             S F LD++GY + + SC+ALG GGSIMY SF + T SCGSPRS L CCWS
Sbjct  301  VSRFPLDLKGYSAGETSCEALGKGGSIMYMSF-AGTGSCGSPRSILKCCWS  350



>ref|XP_002305295.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEE85806.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=361

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKTH+SSA VMT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPEDGFSYASFEA+GYDF+ L+L  L+ RVL CF+P +FS+ALHSN    EL
Sbjct  241  SAISTIHVTPEDGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIALHSNVECDEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            G++F+LDV+GY     + + LG GGSI+Y SF ++T  C SPRS L CCWS
Sbjct  301  GAMFSLDVKGYSCGGGNYEMLGKGGSIVYHSF-AATGGCSSPRSILKCCWS  350



>gb|ABK95104.1| unknown [Populus trichocarpa]
Length=361

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKTH+SSA VMT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTHASSATVMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPEDGFSYASFEA+GYDF+ L+L  L+ RVL CF+P +FS+ALHSN    EL
Sbjct  241  SAISTIHVTPEDGFSYASFEAVGYDFQDLNLRQLLYRVLVCFEPTEFSIALHSNVECDEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            G++F+LDV+GY     + + LG GGSI+Y SF ++T  C SPRS L CCWS
Sbjct  301  GAMFSLDVKGYSCGGGNYEMLGKGGSIVYHSF-AATGGCSSPRSILKCCWS  350



>ref|XP_011021158.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL  K ASVFYKTHSSSAA MT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLSRKQASVFYKTHSSSAAAMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPEDGFSYASFEA+GYD + L+L+ L+ERVLACF+P +FSVALHSN  GAEL
Sbjct  241  SAISTIHVTPEDGFSYASFEAVGYDLQDLNLSQLLERVLACFEPTEFSVALHSNIKGAEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
             + F LDV GY     + + LG GGSI+Y SF + T    SPRS L CCWS
Sbjct  301  QAKFPLDVEGYSGGGGNYEMLGKGGSIIYHSF-ARTGGSASPRSILKCCWS  350



>ref|XP_007033428.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
 gb|EOY04354.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
Length=417

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 2/182 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKTH SSA +MT+ SGIR+ILP+S+ICDF+F+PCGYSMN+IE+
Sbjct  228  TLEMCMTGLDKKKASVFYKTHVSSAVLMTEHSGIREILPQSQICDFEFDPCGYSMNSIEK  287

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA GYDF+T++LN L+ERVLACF+P +FSV+LH++  G  L
Sbjct  288  DAISTIHVTPEDGFSYASFEAAGYDFETVNLNQLMERVLACFRPTEFSVSLHADVNGDVL  347

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESE-DEEGG  537
                +LDV GY  ++     LGNG S++Y SF  +   C SPRS L CCWSE E DEE G
Sbjct  348  DHRIHLDVNGYCCEERRFDVLGNGSSVIYYSFIGADV-CVSPRSILKCCWSEDEKDEEVG  406

Query  538  IR  543
             R
Sbjct  407  FR  408



>gb|ABY55855.1| S-adenosylmethionine decarboxylase 2 [Solanum lycopersicum]
Length=362

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEM MT LD K ASVF+KT SS+AA MT+ SGIR ILPES ICDFDF+PCGYSMNA+E 
Sbjct  182  TLEMRMTNLDKKKASVFFKTQSSTAAEMTEVSGIRKILPESNICDFDFDPCGYSMNAVEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIH+TPEDGFSYASFEA+GYDF+ + L+A++ERVL+CF PA+FSVALH +  G EL
Sbjct  242  SAISTIHITPEDGFSYASFEAVGYDFRAVDLSAMIERVLSCFGPAEFSVALHCDILGKEL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             +   LD+ GYVS + + + LG GGS+ Y +F SS  SCGSPRS LN CWSE+EDEE
Sbjct  302  YTESGLDIIGYVSGEKTTEMLGKGGSLTYLTF-SSGGSCGSPRSILNNCWSENEDEE  357



>ref|XP_006373494.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373495.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 ref|XP_006373496.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373497.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ABK95786.1| unknown [Populus trichocarpa]
 gb|ERP51291.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51292.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|ERP51293.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51294.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
Length=361

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL  K ASVFYKTHSSSAA MT+ SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLGRKQASVFYKTHSSSAAAMTEDSGIRKILPQSEICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPEDGFSYASFEA+GYD + L+L+ L+ERVLACF+P  FSVALHSN  GAEL
Sbjct  241  SAISTIHVTPEDGFSYASFEAVGYDLQDLNLSRLLERVLACFEPTMFSVALHSNIKGAEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
             + F LDV GY     + + LG GGSI+Y SF + T    SPRS L CCWS
Sbjct  301  RAKFPLDVEGYSGGGGNYEMLGKGGSIIYHSF-ARTGGSASPRSILKCCWS  350



>gb|AAM44307.1|AF512545_1 S-adenosylmethionine decarboxylase [Citrus x microcarpa]
Length=361

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT+ SSAA+MT+ SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFEA+GYDF+ + L +L+ERVLACFKPA+FSVALHS+  G E 
Sbjct  241  DAVSTIHVTPEDGFSYASFEAVGYDFEVVKLTSLLERVLACFKPAEFSVALHSDIVGDEH  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
            G  F LD +GY   +   + LGN GS++Y SF+ +  S  SPRS L CCWSE E +E
Sbjct  301  GDTFTLDFKGYSCGEKIYEELGNNGSLIYYSFSRTDCST-SPRSILKCCWSEDEKDE  356



>gb|KDO58885.1| hypothetical protein CISIN_1g039582mg [Citrus sinensis]
Length=361

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT+ SS A+MT+ SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTNESSVALMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFEA+GYDF+ + L  L+ERVLACFKPA+FSVALHS+  G E 
Sbjct  241  DAVSTIHVTPEDGFSYASFEAVGYDFEVVKLTPLLERVLACFKPAEFSVALHSDIVGDEH  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
            G  F LD++GY   +   + LGN GS++Y SF+ +  S  SPRS L CCWSE E +E
Sbjct  301  GDTFMLDLKGYSCGEKIYEELGNNGSLIYYSFSRADCST-SPRSILKCCWSEDEKDE  356



>ref|XP_006430871.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
 gb|ESR44111.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
Length=361

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT+ SSAA+MT+ SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRKRASVFYKTNESSAAMMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFEA+GYDF+ + L  L+ERVL CFKPA+FSVALHS+  G E 
Sbjct  241  DAVSTIHVTPEDGFSYASFEAVGYDFEVVKLTPLLERVLTCFKPAEFSVALHSDIVGDEH  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
            G  F LD++GY   +   + LGN GS++Y SF+ +  S  SPRS L CCWSE E +E
Sbjct  301  GDTFMLDLKGYSCGEKIYEELGNNGSLIYYSFSRTDCST-SPRSILKCCWSEDEKDE  356



>gb|KDP24344.1| hypothetical protein JCGZ_25640 [Jatropha curcas]
Length=359

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT +SSAA MT+ SGIR ILP+SEICDFDFEPCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRDRASVFYKTPASSAAGMTEESGIRKILPQSEICDFDFEPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GY+ + + L  L+ERVLACF+PA+FS+ALHS+    EL
Sbjct  241  GAISTIHVTPEDGFSYASFEAVGYNLEQVKLTLLLERVLACFEPAEFSIALHSDFVHDEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
            G + +LDV+GY     + + LG GGSI+Y SF   T  C SPRS L CCWSE E +E
Sbjct  301  GLMSSLDVKGYSCGGSNYEVLGKGGSIIYQSFV-KTKGCSSPRSILKCCWSEDEKDE  356



>gb|AGT80621.1| S-adenosylmethionine decarboxylase [Camellia sinensis]
Length=359

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K  SVFYKT +SSAA MT  SGIR ILP+S+ICDF+F+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDRKKVSVFYKTSASSAAAMTDLSGIRMILPDSDICDFEFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIHVTPEDGFSYASFEA+GYDFK+++L  L+ERVLACF+P++FS+ALHS++   +L
Sbjct  241  SAISTIHVTPEDGFSYASFEAVGYDFKSMNLTHLLERVLACFQPSEFSIALHSDAVANKL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGN-GGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             S  +LDV+GY   + S + LG  GGS++Y +F  +   CGSPRS L+CCWSES+++E
Sbjct  301  SSDMSLDVQGYYCGERSFEVLGKEGGSVVYHNFMKA-GGCGSPRSILHCCWSESDEDE  357



>emb|CAJ43718.1| S-adenosine decarboxylase [Plantago major]
Length=217

 Score =   236 bits (601),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD + ASVF+KTHSSSAAVMT  SGI  ILPESEICDFDF+PCGYSMNA+E 
Sbjct  33   TLEMCMTNLDQRKASVFFKTHSSSAAVMTAASGITKILPESEICDFDFDPCGYSMNALEG  92

Query  181  AAISTIHVTPEDGFSYASFEALGYDF-KTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
             A+STIHVTPEDGFSYASFEA+GYDF K + L  LVERVLACF PA FSVALHS+  G E
Sbjct  93   GAVSTIHVTPEDGFSYASFEAVGYDFNKVVDLGYLVERVLACFGPAKFSVALHSSVAGKE  152

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW--SESEDEE  531
            LGSVFN+ V+GY   ++  ++ G+G S++Y SF   T  CGSP S L+  W  SESEDEE
Sbjct  153  LGSVFNVGVKGYSCGELCRESFGDGSSVIYSSFI-RTCGCGSPTSILH-SWSGSESEDEE  210



>gb|AFV67665.1| S-adenosylmethionine decarboxylase [Capsicum annuum]
Length=364

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+KT  S+AA MT+ SGIR ILPES ICDFDFEPCGYSMNA+E 
Sbjct  182  TLEMCMTNLDKKKASVFFKTQCSTAAEMTELSGIRKILPESNICDFDFEPCGYSMNAVEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIH+TPEDGFSYASFEA+GYDF+ ++L A++ERVL+CF PA+FSVALHS++ G EL
Sbjct  242  SAISTIHITPEDGFSYASFEAVGYDFREVNLTAMIERVLSCFGPAEFSVALHSDTPGKEL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTL-NCCWSESEDEE  531
             +   L++ GYVS + + + LG GGS+ Y +F+S  +  GSPRS L N CWSE+EDEE
Sbjct  302  YTDSGLNIIGYVSGEKTTEVLGEGGSLTYLTFSSGGSCGGSPRSILNNSCWSENEDEE  359



>gb|AFJ04521.1| s-adenosylmethionine decarboxylase, partial [Vernicia fordii]
Length=293

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD K ASVF+KT SSSAA MT  SGIR ILP+S+ICDFDF+PCGYSMNAIE 
Sbjct  116  TIEMCMTGLDRKKASVFFKTQSSSAAAMTIGSGIRKILPDSKICDFDFDPCGYSMNAIEG  175

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIH+TPEDGFSYASFE++GYD + ++LN LV RVLACF+P  FS+A+H++  G +L
Sbjct  176  AAISTIHITPEDGFSYASFESVGYDPEKVNLNLLVGRVLACFQPNQFSIAVHADVAGKQL  235

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                ++DV+GY   + S + LG GGSI+Y  F   T   GSPRSTL CCW E E+ E
Sbjct  236  VQTCSVDVKGYCRGERSFEELGMGGSIVYQKF-ERTGDSGSPRSTLKCCWKEEEEGE  291



>ref|XP_010257836.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nelumbo 
nucifera]
Length=405

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK  SSSA++MT  SGIR ILP SEICDF+F+PCGYSMNAIE 
Sbjct  225  TLEMCMTGLDKKMASVFYKAESSSASLMTDVSGIRKILPGSEICDFEFDPCGYSMNAIEG  284

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA+GYD KT++L+ LV RVL CF+P +FSVA+H  + G ++
Sbjct  285  AAISTIHVTPEDGFSYASFEAVGYDLKTVNLSKLVGRVLECFQPREFSVAIHGEAAG-KV  343

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESED  525
            G  F LDV GY   + S + LG  G+I+Y SF  +  +CGSP+S L CCW E ED
Sbjct  344  GWYFPLDVPGYSPGERSYQTLGMNGAIVYQSFIEA-GNCGSPKSVLKCCWKEEED  397



>ref|XP_002282704.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282708.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282716.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_010660528.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 emb|CAN75613.1| hypothetical protein VITISV_022291 [Vitis vinifera]
Length=360

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT +SSAAVMT+ SGIR ILP SEICDF+F+PCGYSMNAIEE
Sbjct  181  TLEMCMTGLDRKKASVFYKTDTSSAAVMTENSGIRKILPNSEICDFEFDPCGYSMNAIEE  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GY+    SL  ++ERVL CF+PA FSVALH++  G +L
Sbjct  241  DAISTIHVTPEDGFSYASFEAMGYNLNDDSLTQMLERVLDCFQPAHFSVALHADVEGKKL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGGI  540
               F LDV GY  +  S + LG GGSI+Y SF  S   CGSPRS L   W E+E+EE  +
Sbjct  301  EYDFPLDVMGYYCEGRSYEGLGKGGSIIYHSFMKS-EECGSPRSILK--WRENEEEEQVL  357

Query  541  RN  546
            + 
Sbjct  358  KK  359



>sp|O65354.1|DCAM_HELAN RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Helianthus annuus]
 gb|AAC17449.1| S-adenosylmethionine decarboxylase [Helianthus annuus]
Length=361

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 144/180 (80%), Gaps = 3/180 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEM MTGL  ++ASVF+K+ SSSAAVMT+ SGIR ILPES+ICDFDF+PCGYSMNAIE 
Sbjct  181  TLEMSMTGLSKRNASVFFKSESSSAAVMTEDSGIRKILPESQICDFDFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDFK++ L  L+ERVLACF+P++FSVALH N    + 
Sbjct  241  DAISTIHVTPEDGFSYASFEAVGYDFKSMGLTVLIERVLACFEPSEFSVALHGNENVVKD  300

Query  361  GSVFN--LDVRGYVSDDMSCKAL-GNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
             ++ N  ++V+GY  ++   + L G GGS++Y  F    +SCGSPRSTL+ CWSE+E+EE
Sbjct  301  LNLENNDVNVKGYNVEETKFEVLGGEGGSMVYYGFARGGSSCGSPRSTLHRCWSETENEE  360



>gb|AEI98604.1| S-adenosylmethionine decarboxylase [Gossypium hirsutum]
Length=355

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMC+TGLD   ASVFYK  S SAAVMT  SGIR ILPESEICDF+F PCGYSMNAIE 
Sbjct  178  TLEMCLTGLDRDKASVFYKDQSGSAAVMTINSGIRKILPESEICDFEFGPCGYSMNAIEG  237

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
            AAISTIHVTPEDGFSYASFEA+GY+ K  +L  LV RVL CFKP DFSVA+H +  G + 
Sbjct  238  AAISTIHVTPEDGFSYASFEAVGYNLKDKNLKQLVGRVLKCFKPGDFSVAVHVDVGGDQS  297

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L     LDV+GY   +M  + LGNGGS+MY  F SST  CGSPRSTL CCW 
Sbjct  298  LEQSCLLDVKGYRCGEMGIEGLGNGGSMMYQKF-SSTGGCGSPRSTLKCCWK  348



>ref|XP_010660529.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=405

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT +SSAAVMT+ SGIR ILP SEICDF+F+PCGYSMNAIEE
Sbjct  226  TLEMCMTGLDRKKASVFYKTDTSSAAVMTENSGIRKILPNSEICDFEFDPCGYSMNAIEE  285

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GY+    SL  ++ERVL CF+PA FSVALH++  G +L
Sbjct  286  DAISTIHVTPEDGFSYASFEAMGYNLNDDSLTQMLERVLDCFQPAHFSVALHADVEGKKL  345

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGGI  540
               F LDV GY  +  S + LG GGSI+Y SF  S   CGSPRS L   W E+E+EE  +
Sbjct  346  EYDFPLDVMGYYCEGRSYEGLGKGGSIIYHSFMKS-EECGSPRSILK--WRENEEEEQVL  402

Query  541  RN  546
            + 
Sbjct  403  KK  404



>sp|Q42679.1|DCAM_CATRO RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Catharanthus roseus]
 gb|AAC48989.1| S-adenosyl-L-methionine decarboxylase proenzyme [Catharanthus 
roseus]
 prf||2106177A Met(S-adenosyl) decarboxylase [Catharanthus roseus]
Length=357

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK+ SSSAA+MT  SGIR ILP+SEICDF+F+PCGYSMN+IEE
Sbjct  181  TLEMCMTGLDREKASVFYKSESSSAALMTTRSGIRKILPDSEICDFEFDPCGYSMNSIEE  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA GYD K  +L  ++ERVLACF+P++FSVA+H + T   L
Sbjct  241  AAISTIHVTPEDGFSYASFEAAGYDLKAQNLGMMIERVLACFQPSEFSVAVHCDVTCKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              + +L+++ Y  D+   + LG GGSI+Y  F    A CGSPRS L CCW E E EE
Sbjct  301  EQICSLELKEYSLDEKINEELGLGGSIIYKKFLRIDA-CGSPRSILKCCWKEDESEE  356



>ref|XP_007045669.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
 gb|EOY01501.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
Length=359

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMC+TGLD + ASVFYK  S SAAVMT  SGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  183  TVEMCLTGLDREMASVFYKDQSGSAAVMTINSGIRKILPDSEICDFEFDPCGYSMNAIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA+GYD K L+L  LVERVL CFKP+DFSVA+H +  G  L
Sbjct  243  AAISTIHVTPEDGFSYASFEAVGYDPKDLNLKQLVERVLVCFKPSDFSVAVHVDVAGQSL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
                 LDV+GY   +   + LG GGS++Y  F +ST  CGSPRSTL CCW 
Sbjct  303  EQNCLLDVKGYCCGERGIEELGIGGSVIYQKF-NSTGGCGSPRSTLKCCWK  352



>gb|KDP31452.1| hypothetical protein JCGZ_11828 [Jatropha curcas]
Length=358

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD + A+VF+KT S+SAAVMT  SGIR ILP+S+ICDFDF+PCGYSMN+IE 
Sbjct  181  TVEMCMTGLDRQKAAVFFKTRSASAAVMTVDSGIRKILPDSKICDFDFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +AISTIH+TPEDGFSYASFE +GY  + ++LN LV+RVL+CF+P+ FS+A+H++  G +L
Sbjct  241  SAISTIHITPEDGFSYASFETVGYHPEEVNLNQLVDRVLSCFQPSQFSIAVHADVAGKQL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEG  534
                +LDV+GY   + S +  G GGS++Y  F   T   GSPRSTL CCW E EDEEG
Sbjct  301  MRTCSLDVKGYCRGESSFEEFGKGGSLVYQKFI-RTGDSGSPRSTLKCCWKEEEDEEG  357



>ref|XP_007225621.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
 gb|EMJ26820.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
Length=357

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK+ SSSAA MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDREKASVFYKSQSSSAAAMTNDSGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K +++N LVERVLACF+P +FS+A+H++     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNINQLVERVLACFQPREFSIAVHADVATKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              + ++D++GY   + S + LG GGSI+Y  F   T  CGSPRSTL  CW + E+EE
Sbjct  301  QQLSSVDLKGYCRKESSHEELGMGGSIVYNRFL-KTERCGSPRSTLKGCWRDEEEEE  356



>gb|KHG07410.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=355

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMC+TGLD   ASVFYK  S SAAVMT  SGIR ILPES ICDF+FEPCGYSMNAIE 
Sbjct  178  TLEMCLTGLDRDKASVFYKDQSGSAAVMTINSGIRKILPESGICDFEFEPCGYSMNAIEG  237

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
            AAISTIHVTPEDGFSYASFEA+GYD K  +L  LV RVL CFKP+DFSVA+H +  G + 
Sbjct  238  AAISTIHVTPEDGFSYASFEAVGYDLKEKNLKQLVGRVLQCFKPSDFSVAVHVDFGGDQS  297

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L     LDV+GY   +M  + LG+GGS+MY  F SST  CGSPRSTL CCW 
Sbjct  298  LEQSCLLDVKGYCCGEMGIEGLGSGGSMMYQKF-SSTGGCGSPRSTLKCCWK  348



>ref|XP_008243751.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Prunus 
mume]
Length=357

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK+ SSSAA MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDREKASVFYKSQSSSAAAMTNDSGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K +++N LVERVLACF+P +FS+A+H++     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNINQLVERVLACFQPREFSIAVHADVATKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              + ++D++GY  ++ + + LG GGSI+Y  F   T  CGSPRSTL  CW + E+EE
Sbjct  301  QQLSSVDLKGYCREESTHEELGMGGSIVYNRFL-KTERCGSPRSTLKGCWRDEEEEE  356



>gb|AIS20829.1| SAMDC3 [Pyrus x bretschneideri]
Length=358

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK+ SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K+++LN LVERVL CF+P +FS+A+H+N     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKSVNLNELVERVLVCFQPKEFSIAVHANVASKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 +D++GY  ++ S + LG GG+I+Y  F  +   CGSPRSTL  CW E E+E+
Sbjct  301  QQHSLVDLKGYCREESSHEELGLGGAIVYQRFLKTAERCGSPRSTLKGCWREEEEED  357



>ref|XP_002525956.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF36380.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=359

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 134/171 (78%), Gaps = 3/171 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKTH+SSAAVMT+ SGIR ILP+SEICDFDF+PCGYSMNA+E 
Sbjct  181  TLEMCMTGLDRERASVFYKTHTSSAAVMTEDSGIRKILPQSEICDFDFDPCGYSMNAVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIH+TPEDGFSYASFE++GY+F+ ++L  L+ERVLACF+P +FS+ALHSN    EL
Sbjct  241  DAISTIHITPEDGFSYASFESMGYNFEEVNLTQLLERVLACFEPTEFSIALHSNIVHDEL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
               F  DV+GY     + + LG GGSI+Y SF      C SPRS L CCWS
Sbjct  301  K--FFPDVKGYSCGGRNYEVLGKGGSIIYYSF-ERIKGCASPRSILKCCWS  348



>ref|NP_001236931.1| S-adenosylmethionine decarboxylase [Glycine max]
 gb|AAL89723.1|AF488307_1 S-adenosylmethionine decarboxylase [Glycine max]
 gb|KHN07743.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 136/177 (77%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VFYK  S+SAA+MT  SGIR ILP+SEICDFDFEPCGYSMN++E 
Sbjct  181  TLEMCMTGLDREKAQVFYKEQSASAAMMTVNSGIRKILPDSEICDFDFEPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE +GYDFK ++LN +V+RVLACF P +FSVA+H +      
Sbjct  241  AAVSTIHVTPEDGFSYASFETVGYDFKAVNLNEMVQRVLACFLPTEFSVAVHVDGASKSF  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG GGS++Y  F   T+ CGSPRSTL  CW+E ++EE
Sbjct  301  EQTCFLDVKGYCREERSHEGLGMGGSVVYQKF-GKTSDCGSPRSTLK-CWNEEDEEE  355



>gb|ACU18873.1| unknown [Glycine max]
Length=172

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +1

Query  10   MCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEAAI  189
            MCMTGLD + A VFYK  S+SAA+MT  SGIR ILP+SEICDFDFEPCGYSMN++E AA+
Sbjct  1    MCMTGLDREKAQVFYKEQSASAAMMTVNSGIRKILPDSEICDFDFEPCGYSMNSVEGAAV  60

Query  190  STIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELGSV  369
            STIHVTPEDGFSYASFE +GYDFK ++LN +V+RVLACF P +FSVA+H +         
Sbjct  61   STIHVTPEDGFSYASFETVGYDFKAVNLNEMVQRVLACFLPTEFSVAVHVDGASKSFEQT  120

Query  370  FNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              LDV+GY  ++ S + LG GGS++Y  F   T+ CGSPRSTL  CW+E ++EE
Sbjct  121  CFLDVKGYCREERSHEGLGMGGSVVYQKF-GKTSDCGSPRSTLK-CWNEEDEEE  172



>ref|XP_006573201.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Glycine max]
 gb|KHN07170.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 135/177 (76%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VFYK  S+SAA+MT  SGIR ILP+SEICDFDFEPCGYSMN++E 
Sbjct  181  TLEMCMTGLDREKAQVFYKEQSASAAIMTVNSGIRKILPDSEICDFDFEPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE +GYDFK ++LN +V+RVLACF P +FSVA+H +      
Sbjct  241  AAVSTIHVTPEDGFSYASFETVGYDFKVVNLNEMVKRVLACFLPTEFSVAVHVDGASKLF  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG GGS++Y  F + T  CGSPRSTL  CW E ++EE
Sbjct  301  DQTCFLDVKGYCREERSHEGLGMGGSLVYQKF-AKTCDCGSPRSTLK-CWKEEDEEE  355



>ref|XP_002314904.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEF01075.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=355

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 131/175 (75%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD + ASVFYKT SSSAA MT  SGIR ILP S ICDF+FEPCGYSMN+IE 
Sbjct  181  TIEMCMTGLDREKASVFYKTQSSSAAAMTDDSGIRKILPASNICDFEFEPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA GYD K  SLN LV+RVLACF+  +FS+A+H++  G +L
Sbjct  241  AAISTIHVTPEDGFSYASFEAAGYDLKDASLNQLVDRVLACFQATEFSIAVHADVAGEQL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESED  525
              + +LDV+GY   +     LG GGSI+Y  F  S  +  SPRS L CCW E ED
Sbjct  301  ERICSLDVKGYCRGERIHGELGMGGSIIYQKFVRS-GNADSPRSILKCCWKEEED  354



>ref|XP_004297173.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 2 [Fragaria vesca subsp. vesca]
 ref|XP_004297174.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 3 [Fragaria vesca subsp. vesca]
Length=359

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT +SSAA MT  SGIR ILP S+ICDF+F+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDRAKASVFYKTVTSSAAAMTNDSGIRKILPGSDICDFEFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE+ GYDF  L+LN L ERVLACFKP++FS+A+H++     L
Sbjct  241  AAISTIHVTPEDGFSYASFESAGYDFNELNLNQLAERVLACFKPSEFSIAVHADVAVKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              + +LD++GY  ++ S + LG GGSI+   F   T +CGSPRSTL  CW E EDE+
Sbjct  301  QQICSLDLKGYCREESSHEELGMGGSIVQYRFL-KTEACGSPRSTLKGCWKE-EDED  355



>ref|XP_006585825.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006585826.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006585827.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 gb|KHN14467.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGL+ +SASVF+K ++SSAA+MT+ SGIR ILP+S+I DF+F+PCGYSMN IE  
Sbjct  180  LEMCMTGLEKESASVFFKENTSSAALMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGG  239

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYDF  ++L  LVERVLACF+PA+FSVALH +  G +L 
Sbjct  240  AISTIHVTPEDGFSYASFEAVGYDFDEMALGELVERVLACFRPAEFSVALHIDMHGEKLN  299

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              F LD++GY   + S + LG GG+++Y SF        SPRS L CCWSE E+E+
Sbjct  300  K-FPLDIKGYYCGERSYEELGVGGAVVYQSFVQGCDGSTSPRSILKCCWSEDENED  354



>ref|XP_010100905.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXB85829.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=369

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT+ SSAA MT+ SGIR ILP+SEICDF+FEPCGYSMN+IE+
Sbjct  187  TLEMCMTGLDRERASVFYKTNESSAAKMTEDSGIRKILPQSEICDFEFEPCGYSMNSIEK  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GY+F+ + L+ L++RVLACF+P++FSVALHS+    EL
Sbjct  247  DAISTIHVTPEDGFSYASFEAMGYNFEDVDLSQLLQRVLACFRPSEFSVALHSSVVREEL  306

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            GS F L ++GY   + + + LG GG+++Y SF     S GSPRSTL   WS
Sbjct  307  GSKFPLSLKGYSIAERNAEVLGMGGTLIYYSFVRGGDS-GSPRSTLKRFWS  356



>ref|XP_004297172.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=409

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT +SSAA MT  SGIR ILP S+ICDF+F+PCGYSMNAIE 
Sbjct  231  TLEMCMTGLDRAKASVFYKTVTSSAAAMTNDSGIRKILPGSDICDFEFDPCGYSMNAIEG  290

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE+ GYDF  L+LN L ERVLACFKP++FS+A+H++     L
Sbjct  291  AAISTIHVTPEDGFSYASFESAGYDFNELNLNQLAERVLACFKPSEFSIAVHADVAVKSL  350

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              + +LD++GY  ++ S + LG GGSI+   F   T +CGSPRSTL  CW E EDE+
Sbjct  351  QQICSLDLKGYCREESSHEELGMGGSIVQYRFL-KTEACGSPRSTLKGCWKE-EDED  405



>gb|ACJ83461.1| unknown [Medicago truncatula]
 gb|AFK33546.1| unknown [Medicago truncatula]
Length=202

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K    SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  28   TLEMCMTGLDREKASVFFKDQPDSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  87

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE  GYD K ++LN LV +VLACF+P +FSVA+H ++     
Sbjct  88   AAVSTIHVTPEDGFSYASFETAGYDLKAMNLNELVVKVLACFQPNEFSVAVHVDNASKSF  147

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                +LDV+GY  ++ S + LG GGS++Y  F   TA CGSPRSTL  CW + ++EE
Sbjct  148  EQGCSLDVKGYCREERSHEGLGMGGSVVYQKFV-KTADCGSPRSTLK-CWKDEDEEE  202



>ref|XP_009356498.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Pyrus 
x bretschneideri]
Length=357

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 133/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK+ SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+H+N     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKGVNLNELVERVLVCFQPKEFSIAVHANVASKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 +D++GY  ++ S + LG GG+I+Y  F   T  CGSPRSTL  CW E E+E+
Sbjct  301  QQHSLVDLKGYCREESSHEELGLGGAIVYQRFL-KTERCGSPRSTLKGCWREEEEED  356



>gb|AAB88854.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++     L
Sbjct  243  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFQPDEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V +LDV+GY   + S +  G GGSI+Y  FT  T  CGSP+S L  CW
Sbjct  303  ERVCSLDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPFCGSPKSVLKGCW  351



>gb|KHG30390.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
 gb|KHG30391.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=369

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K AS+FYKTH+SSAA MT+ SGIR ILP S+ICDF+F+PCGYSMN+IE+
Sbjct  181  TLEMCMTGLDRKKASIFYKTHASSAASMTEHSGIRKILPYSQICDFEFDPCGYSMNSIEK  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA GYDF+TL+ N L+ERVLACFKP +FSV+LH N T  +L
Sbjct  241  GAISTIHVTPEDGFSYASFEASGYDFETLNSNQLIERVLACFKPTEFSVSLHVNMTRDDL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLN-CCWSESEDEEGG  537
                   V GY  +  S + LGNGGS+MY SF      C SPRS L  C W+E +D+  G
Sbjct  301  RCRMPSYVNGYCCEKRSFEQLGNGGSVMYYSFGGGDM-CVSPRSILKSCSWNE-DDQSVG  358

Query  538  IR  543
            +R
Sbjct  359  VR  360



>ref|XP_011070874.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=358

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  SSSA++MT  SGIR+ILPES ICDF+FEPCGYSMN++E 
Sbjct  182  TLEMCMTGLDREKASVFYKNESSSASLMTNKSGIRNILPESCICDFEFEPCGYSMNSVEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFEA GYDFK ++L  L ERVLACF+P +F +A+H++     L
Sbjct  242  AALSTIHVTPEDGFSYASFEAAGYDFKVVNLGLLSERVLACFQPMEFCLAVHADFGAKLL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              +   D++GY  ++ SCK LG GGSIMY  F  +T +CGSP S L CC  E E E+
Sbjct  302  DDIHAFDMKGYSLNEKSCKELGMGGSIMYQKFVRTT-TCGSPSSILRCCREEDEVEK  357



>ref|XP_009765510.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme, partial 
[Nicotiana sylvestris]
Length=327

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  149  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  208

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++     L
Sbjct  209  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIALHADVATKLL  268

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  CGSP+S L  CW
Sbjct  269  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPFCGSPKSVLKGCW  317



>gb|KHN13794.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD +SASVF+K ++SSAA MT+ SGIR ILP+S+I DF+F+PCGYSMN IE +
Sbjct  180  LEMCMTGLDKESASVFFKENTSSAASMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGS  239

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYDF  ++L  LVERVLACF PA+FSVALH +  G +L 
Sbjct  240  AISTIHVTPEDGFSYASFEAVGYDFNDMALGELVERVLACFCPAEFSVALHIDMHGEKLN  299

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              F LD++GY   + S + LG GG+++Y +F        SPRS L CCWSE E+E+
Sbjct  300  K-FPLDIKGYYCGERSTEELGVGGAVVYQTFVQGCDGSASPRSILKCCWSEDENED  354



>ref|XP_011008996.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Populus euphratica]
Length=406

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD + ASVFYKT SSSA+ MT  SGIR ILP S ICDF+FEPCGYSMN+IE 
Sbjct  232  TIEMCMTGLDREKASVFYKTQSSSASAMTDDSGIRKILPASNICDFEFEPCGYSMNSIEG  291

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA GYD K +SLN LV+RVLACF+ ++FS+A+H++  G +L
Sbjct  292  AAISTIHVTPEDGFSYASFEAAGYDLKVVSLNQLVDRVLACFQSSEFSIAVHADVAGEQL  351

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESED  525
              + +LDV+GY   + S   LG GGSI+Y  F  S  +  SPRS L C W E ED
Sbjct  352  ERICSLDVKGYCLGERSHGELGTGGSIIYQKFVRS-GNADSPRSILKCRWKEEED  405



>gb|EYU28926.1| hypothetical protein MIMGU_mgv1a008898mg [Erythranthe guttata]
Length=359

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 132/168 (79%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K  SSSAA+MT+ SGIRDILPES+ICDFDFEPCGYSMN+IE 
Sbjct  181  TLEMCMTGLDREKASVFFKKQSSSAALMTEVSGIRDILPESDICDFDFEPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIH+TPEDGFSYASFEA GYDFK ++L  L++RVL CF+P++FSV++H+       
Sbjct  241  AAISTIHITPEDGFSYASFEAAGYDFKHVNLGELIDRVLYCFEPSEFSVSVHAQLGAKMF  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
              +  LDV+GY  ++ S K LG  GSI+Y  F +  A CGSPRSTL C
Sbjct  301  QHIQALDVKGYTHEERSIKELGMDGSIVYHKF-ARAAFCGSPRSTLKC  347



>ref|XP_006602987.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006602988.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006602989.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 ref|XP_006602990.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X4 [Glycine max]
Length=359

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD +SASVF+K ++SSAA MT+ SGIR ILP+S+I DF+F+PCGYSMN IE +
Sbjct  180  LEMCMTGLDKESASVFFKENTSSAASMTENSGIRKILPQSDISDFEFDPCGYSMNGIEGS  239

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYDF  ++L  LVER+LACF PA+FSVALH +  G +L 
Sbjct  240  AISTIHVTPEDGFSYASFEAVGYDFNDMALGELVERILACFCPAEFSVALHIDMHGEKLN  299

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              F LD++GY   + S + LG GG+++Y +F        SPRS L CCWSE E+E+
Sbjct  300  K-FPLDIKGYYCGERSTEELGVGGAVVYQTFVQGCDGSASPRSILKCCWSEDENED  354



>gb|KGN57743.1| hypothetical protein Csa_3G271360 [Cucumis sativus]
Length=364

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+KT +SSAA MT+ SGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  182  TLEMCMTGLDKEKASVFFKTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A STIHVTPEDGFSYASFEA GYDF  ++L+ L+ RVLACF+P+DFSVALHS+  G  L
Sbjct  242  DAESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTAS-CGSPRSTLNCCWSESE-DEEG  534
              +  L+++GY   + SC+ LG  G+++Y SF  +      SPRSTL  CWSE E DEE 
Sbjct  302  EDLLCLELKGYEGGEKSCEILGENGTVIYQSFMKTEGDYASSPRSTLLKCWSEDEKDEEV  361

Query  535  G  537
            G
Sbjct  362  G  362



>ref|XP_009625495.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nicotiana 
tomentosiformis]
Length=402

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  231  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  290

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++     L
Sbjct  291  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIALHADVATKLL  350

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSE  516
              V ++DV+GY   + S +  G GGSI+Y  FT  T  CGSP+S L  CW E
Sbjct  351  QRVCSVDVKGYSLAECSPEEFGKGGSIVYQKFT-RTPFCGSPKSVLKGCWKE  401



>sp|O04009.1|DCAM_TOBAC RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAB51301.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++     L
Sbjct  243  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  CGSP+S L  CW
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPFCGSPKSVLKGCW  351



>sp|O80402.1|DCAM_NICSY RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana sylvestris]
 dbj|BAA29040.1| S-adenosylmethionine decarboxylase [Nicotiana sylvestris]
Length=361

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++     L
Sbjct  243  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  CGSP+S L  CW
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPFCGSPKSVLKGCW  351



>gb|KEH16884.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=353

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K  S SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  179  TLEMCMTGLDREKASVFFKDQSDSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE  GYD K ++LN LV +VLACF+P +FSVA+H ++     
Sbjct  239  AAVSTIHVTPEDGFSYASFETAGYDLKAMNLNELVVKVLACFQPNEFSVAVHVDNASKSF  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                +LDV+GY  ++ S + LG GGS++Y  F   TA CGSPRSTL  CW + ++EE
Sbjct  299  EQGCSLDVKGYCREERSHEGLGMGGSVVYQKFV-KTADCGSPRSTLK-CWKDEDEEE  353



>ref|XP_002514534.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF47640.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=361

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGL+ + ASVF+K+ S+SAAVMT  SGIR ILP S+ICDFDF+PCGYSMNAIE 
Sbjct  184  TIEMCMTGLEREKASVFFKSQSASAAVMTVDSGIRRILPNSKICDFDFDPCGYSMNAIEG  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIH+TPEDGFSYASFE +GY+ + ++LN LVERVLACF+P+ FS+A+H+N    +L
Sbjct  244  AAISTIHITPEDGFSYASFETVGYNPEEVNLNQLVERVLACFQPSQFSIAVHANVADKQL  303

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 LDV+GY   + S + LG GGSI+Y  F   T   GSPRSTL CCW
Sbjct  304  VQTCALDVKGYCRGERSFEELGMGGSIVYQKFV-RTGDSGSPRSTLKCCW  352



>sp|Q96555.1|DCAM_DATST RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Datura stramonium]
 emb|CAA69076.1| S-adenosylmethionine decarboxylase [Datura stramonium]
Length=362

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEGSSAAHMTVRSGIRKILPNSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT+ L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDLKTMELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V  +DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  303  ERVCCVDVKGYSLAEWSPEEFGKGGSIVYQKFT-KTPYCASPKSVLKGCW  351



>pdb|1MHM|A Chain A, Crystal Structure Of S-Adenosylmethionine Decarboxylase 
From Potato
Length=288

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  111  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  170

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGF+YASFE++GY+ KT+ L  LVERVLACF+PA+FSVALH++     L
Sbjct  171  AAVSTIHITPEDGFTYASFESVGYNPKTMELGPLVERVLACFEPAEFSVALHADVATKLL  230

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              + ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  231  ERICSVDVKGYSLAEWSPEEFGEGGSIVYQKFT-RTPYCESPKSVLKGCW  279



>gb|AGV68760.1| S-adenosylmethionine decarboxylase [Cucumis melo]
Length=364

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLE+CMTGLD + ASVF++T +SSAA MT+ SGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  182  TLEICMTGLDKEKASVFFRTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A STIHVTPEDGFSYASFEA GYDF  ++L+ L+ RVLACF+P+DFSVALHS+  G  L
Sbjct  242  DAESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTAS-CGSPRSTLNCCWSESE-DEEG  534
              +  L+++GY   + SC+ LG  G+++Y SF  +      SPRSTL  CWSE E DEE 
Sbjct  302  EDLLCLELKGYEGGEKSCEMLGENGTVIYQSFMKTGGDYASSPRSTLLKCWSEDEKDEEV  361

Query  535  G  537
            G
Sbjct  362  G  362



>ref|XP_008461582.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Cucumis melo]
Length=418

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF++T +SSAA MT+ SGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  236  TLEMCMTGLDKEKASVFFRTDASSAAAMTENSGIRKILPKSEICDFEFDPCGYSMNAIEG  295

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A STIHVTPEDGFSYASFEA GYDF  ++L+ L+ RVLACF+P+DFSVALHS+  G  L
Sbjct  296  DAESTIHVTPEDGFSYASFEAAGYDFDDMNLSKLIVRVLACFQPSDFSVALHSDVVGENL  355

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTAS-CGSPRSTLNCCWSESE-DEEG  534
              +  L+++GY   + SC+ LG  G+++Y SF  +      SPRSTL  CWSE E DEE 
Sbjct  356  EDLLCLELKGYEGGEKSCEMLGENGTVIYQSFMKTGGDYASSPRSTLLKCWSEDEKDEEV  415

Query  535  G  537
            G
Sbjct  416  G  416



>ref|XP_008353081.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like, 
partial [Malus domestica]
Length=253

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  76   TLEMCMTGLDRGKASVFYKTQSSSATAMTTESGIRQILPDSDICDFEFDPCGYSMNSIEG  135

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+HSN      
Sbjct  136  AAISTIHVTPEDGFSYASFETAGYDLKDVNLNQLVERVLVCFQPKEFSIAVHSNVASKSH  195

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++D++GY  ++ S + LG GG+I+Y  F   T  C SPRSTL  CW
Sbjct  196  QQHCSVDLKGYCREESSHEELGLGGAIVYQRFL-KTERCSSPRSTLKGCW  244



>gb|ABO77440.1| S-adenosylmethionine decarboxylase [Medicago falcata]
Length=353

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VF+K  S SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  179  TLEMCMTGLDREKALVFFKDQSDSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE  GYD K ++LN LV +VLACF+P +FSVA+H ++     
Sbjct  239  AAVSTIHVTPEDGFSYASFETAGYDLKAMNLNELVVKVLACFQPNEFSVAVHVDNASKSF  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                +LDV+GY  ++ S + LG GGS++Y  F   TA CGSPRSTL  CW + ++EE
Sbjct  299  EQGCSLDVKGYCREERSLEGLGMGGSVVYQKFV-KTADCGSPRSTLK-CWKDEDEEE  353



>dbj|BAC55114.1| S-adenosylmethionine decarboxylase [Malus domestica]
Length=374

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+ +SSAA MT  SGIR+ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSDICDFEFEPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             A+STIHVTPEDGFSYASFE +GYDFK ++L  L+ RVL CFKPA+FS+ALH+ ST G +
Sbjct  247  NAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAGED  306

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L +   LD++GY     S + LG GG++MY SF    +   SPRS L CCWS
Sbjct  307  LDAKCPLDLKGYCCGGSSYEGLGLGGAVMYHSFVKDDSGSQSPRSILKCCWS  358



>ref|XP_004491770.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491771.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
Length=360

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD + ASVF+KT +SSA++MT+ SGIR ILP+S ICDF+F+PCGYSMN IE  
Sbjct  182  LEMCMTGLDKEKASVFFKTDTSSASLMTKNSGIRKILPKSNICDFEFDPCGYSMNGIEGN  241

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYDF+ +SLN +V RVLACF PA+FSVALH +  G +L 
Sbjct  242  AISTIHVTPEDGFSYASFEAVGYDFEKMSLNEIVGRVLACFYPAEFSVALHIDMNGEKLD  301

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
              F LD++GY   +   + LG GG+++Y +F  +   C SPRSTL CCWS
Sbjct  302  K-FPLDIKGYCCGERINEVLGIGGAVVYRTFVRNDG-CSSPRSTLKCCWS  349



>gb|AGI02585.1| S-adenosylmethionine decarboxylase [Pyrus x bretschneideri]
Length=374

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+ +SSAA MT  SGIR+ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSNICDFEFEPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             A+STIHVTPEDGFSYASFE +GYDFK ++L  L+ RVL CFKPA+FS+ALH+ ST G +
Sbjct  247  NAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAGED  306

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L +   LD++GY     S + LG GG++MY SF    +   SPRS L CCWS
Sbjct  307  LNARCPLDLKGYCCGGSSYEGLGLGGAVMYHSFVKDDSGSQSPRSILKCCWS  358



>gb|KHG10311.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=355

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD++ A+VFYK  S+SAA MT  SGIR+ILP SEICDF+FEPCGYSMN+IE 
Sbjct  178  TLEMCMTGLDTEKATVFYKDESTSAASMTMKSGIRNILPNSEICDFEFEPCGYSMNSIET  237

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYD K L+L  LV+RVL CFKP++FSVA+H +      
Sbjct  238  DAISTIHVTPEDGFSYASFEAVGYDLKELNLEQLVQRVLVCFKPSNFSVAVHVDVDCHSF  297

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 LDV+GY   + S + LG+GGSI+Y SF +    CGSPRSTL+C W
Sbjct  298  EQTCLLDVKGYHCRESSIEELGSGGSIIYQSF-NGIGGCGSPRSTLSCLW  346



>ref|XP_006348617.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=360

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GY+ KT+ L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYNPKTMELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGEGGSIVYQKFT-RTPYCESPKSVLKGCW  351



>ref|XP_007215554.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
 gb|EMJ16753.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
Length=374

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 136/173 (79%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ K ASVFYK+ +SSAA MT+ SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  187  TLEMCMTGLNRKKASVFYKSKASSAAGMTEESGIRKILPQSEICDFEFDPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             AISTIHVTPEDGFSYASFE +GYDFK ++L  L++RVL CFKPA+FSVALH+ ST G +
Sbjct  247  NAISTIHVTPEDGFSYASFETMGYDFKNVNLTQLIDRVLDCFKPAEFSVALHTTSTAGEQ  306

Query  358  LGSVFNL-DVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L + F L D+RGY   + + + LG GG++++ SF    A C SPRS L  CWS
Sbjct  307  LNAKFPLDDLRGYCCGESNYERLGLGGAVIFHSFVKD-AGCQSPRSILKGCWS  358



>ref|NP_001280825.1| uncharacterized protein LOC103451713 [Malus domestica]
 dbj|BAC55113.1| S-adenosylmethionine decarboxylase [Malus domestica]
Length=358

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK+ SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+H+N     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNLNQLVERVLVCFQPKEFSIAVHANVVSKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 +D++GY  ++ S + LG GG+I+Y  F   T  CGSPRSTL  CW
Sbjct  301  QQHSLVDLKGYCREESSHEELGLGGAIVYQRFL-KTERCGSPRSTLKGCW  349



>ref|XP_008360070.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=361

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK+ SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRGKASVFYKSESSSATTMTNESGIRKILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+H+N     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNLNQLVERVLVCFQPKEFSIAVHANVVSKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 +D++GY  ++ S + LG GG+I+Y  F   T  CGSPRSTL  CW
Sbjct  301  QQHSLVDLKGYCREESSHEELGLGGAIVYQRFL-KTERCGSPRSTLKGCW  349



>gb|AFY06653.1| s-adenosyl methionine decarboxylase, partial [Carica papaya]
Length=267

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD  SASVFYK  S SAA+MT  SGIR ILP+S+ICDF+F+PCGYSMN++E 
Sbjct  91   TMEMCMTGLDRDSASVFYKDQSGSAALMTINSGIRKILPDSKICDFEFDPCGYSMNSVEG  150

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GYD + ++LN LV RVLACF P+ FS+A+H +     L
Sbjct  151  AAISTIHVTPEDGFSYASFETVGYDVENVNLNKLVGRVLACFNPSQFSIAIHGDVGVRSL  210

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG GGS++Y  F   T +C SPRSTL  CW +  +EE
Sbjct  211  EEKSLLDVKGYCCEERSLEELGKGGSMVYQKF-DRTGNCCSPRSTLKSCWKDGSEEE  266



>gb|AFV92895.1| S-adenosylmethionine decarboxylase [Pyrus betulifolia]
Length=358

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN++E 
Sbjct  181  TLEMCMTGLDRGKASVFYKTQSSSATAMTTESGIRKILPDSDICDFEFDPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+HSN     L
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNLNQLVERVLVCFQPKEFSIAVHSNVASKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++D++GY  ++ S + LG GG+I+Y  F   T  C SPRSTL  CW
Sbjct  301  QQHCSVDLKGYCREESSHEELGLGGAIVYHRFL-KTERCSSPRSTLKGCW  349



>sp|Q04694.1|DCAM_SOLTU RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; AltName: Full=Induced stolen tip 
protein TUB13; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA77742.1| induced stolon tip protein [Solanum tuberosum]
Length=360

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGF+YASFE++GY+ KT+ L  LVERVLACF+PA+FSVALH++     L
Sbjct  243  AAVSTIHITPEDGFTYASFESVGYNPKTMELGPLVERVLACFEPAEFSVALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              + ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  303  ERICSVDVKGYSLAEWSPEEFGEGGSIVYQKFT-RTPYCESPKSVLKGCW  351



>gb|AAB32507.1| S-adenosylmethionine decarboxylase [Solanum tuberosum]
Length=360

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GY+ KT+ L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYNPKTMELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  303  ERTCSVDVKGYSLAEWSPEEFGEGGSIVYQKFT-RTPYCESPKSVLKGCW  351



>ref|XP_008353516.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+ +SSAA MT  SGIR+ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKRASVFYKSDASSAAGMTVESGIRNILPQSDICDFEFEPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             A+STIHVTPEDGFSYASFE +GYDFK ++L  L+ RVL CFKPA+FS+ALH+ ST G +
Sbjct  247  NAVSTIHVTPEDGFSYASFETVGYDFKDVNLTQLLYRVLDCFKPAEFSIALHTTSTAGED  306

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L +   LD++GY     S + LG GG++ Y SF    +   SPRS L CCWS
Sbjct  307  LDAKCPLDLKGYCCGGSSYEGLGLGGAVTYRSFVKDDSGSQSPRSILKCCWS  358



>ref|XP_008230354.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Prunus mume]
Length=426

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 135/173 (78%), Gaps = 3/173 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+++SSAA MT+ SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  239  TLEMCMTGLDRKKASVFYKSNASSAAGMTEESGIRKILPQSEICDFEFEPCGYSMNSIEG  298

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             AISTIHVTPEDGFSYASFE +GYDFK ++L  L++RVL CFKPA+FSVALH+ ST G +
Sbjct  299  NAISTIHVTPEDGFSYASFETMGYDFKNVNLTQLIDRVLDCFKPAEFSVALHTTSTAGEQ  358

Query  358  LGSVFNL-DVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L   F L D+RGY   + + + LG GG++++ SF     S  SPRS L  CWS
Sbjct  359  LNVKFPLDDLRGYCCGESNYEMLGLGGAVIFHSFVKDAGS-QSPRSILKGCWS  410



>ref|XP_004490299.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
 gb|ACL14489.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
 gb|ACL14490.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
Length=353

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VF+K  S SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  179  TLEMCMTGLDREKALVFFKEQSGSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE +GY+ KT++LN LV RVL CF+P +FSVA+H ++     
Sbjct  239  AAVSTIHVTPEDGFSYASFETVGYNLKTMNLNELVVRVLDCFEPTEFSVAVHVDNASKSF  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG GGS++Y  F   T+ CGSPRSTL  CW + ++EE
Sbjct  299  EQGCLLDVKGYCREERSHEGLGMGGSVVYQKFV-KTSDCGSPRSTLK-CWKDEDEEE  353



>gb|AGL95795.1| S-adenosylmenthionine decarboxylase [Momordica charantia]
Length=358

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD +  SVF+KT +SSAA MT+ SGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  182  TLEMCMTGLDKEKTSVFFKTDASSAAAMTKNSGIRKILPKSEICDFEFDPCGYSMNAIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A STIH+TPEDGFSYASFEA GYDF  ++L+ L+ RVLACF+P+DFSVALHS+  G  L
Sbjct  242  DAESTIHITPEDGFSYASFEASGYDFNEVNLSQLIGRVLACFQPSDFSVALHSDDCGENL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRST-LNCCWSESEDE  528
              +  ++++GY   + SC+ LG  G+++Y SF  +     SPRS  L CCWS+ E +
Sbjct  302  EDLLCVELKGYEGGEKSCEMLGENGTVIYQSFMKTGDYASSPRSILLKCCWSDDEKD  358



>ref|XP_008362232.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+ +SSAA MT+ SGIR +LP+S+ICDF+FEPCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKRASVFYKSDASSAAGMTEESGIRKVLPQSDICDFEFEPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             A+STIHVTPEDGFSYASFE +GY+F  ++L  L+ RVL CFKPA+FSVALH+ ST G +
Sbjct  247  NAVSTIHVTPEDGFSYASFETVGYNFNDVNLTLLLYRVLDCFKPAEFSVALHTTSTAGED  306

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L +   LD+RGY     S + LG GG+I+Y SF    +   SPRS L CCWS
Sbjct  307  LDAKCPLDLRGYCCGGSSYEGLGLGGAIIYHSFVKDDSGSQSPRSILKCCWS  358



>ref|NP_001234699.1| S-adenosylmethionine decarboxylase [Solanum lycopersicum]
 gb|ABQ42184.1| S-adenosylmethionine decarboxylase [Solanum lycopersicum]
 gb|ABY55854.1| S-adenosylmethionine decarboxylase 1 [Solanum lycopersicum]
Length=360

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTNELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESPKSVLKGCW  351



>gb|KEH17677.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=406

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD + ASVF+K+ +SSA +MT+ SGIR ILP+S+ICDF+FEPCGYSMN IE +
Sbjct  228  LEMCMTGLDKEKASVFFKSDASSAGLMTKNSGIRKILPKSDICDFEFEPCGYSMNGIEGS  287

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYD++  SLN LV RVLACF PA+FSVALH ++ G +L 
Sbjct  288  AISTIHVTPEDGFSYASFEAVGYDYEEKSLNELVRRVLACFYPAEFSVALHIDTNGEKLD  347

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
              F L+V+GY   +   + LG  G+++Y +F  +   C SPRSTL CCWS
Sbjct  348  K-FPLEVKGYNCGERISEVLGEDGAVVYRTFVRNDG-CTSPRSTLKCCWS  395



>ref|XP_010654269.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
Length=360

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKTHSSSA  MT TSGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GY+ K ++L+ L+ERVL+CF+P +FSVA+H++ +G  L
Sbjct  241  AAISTIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAVHADISGKLL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 LDV+GY  ++ S + LG  GSI+Y  F   T    SPRS L CCW
Sbjct  301  ERNCLLDVKGYCCEERSNEELGMCGSIVYHRFM-KTEGLVSPRSILKCCW  349



>gb|ABY81906.1| S-adenosylmethionine decarboxylase [Vigna radiata]
Length=348

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A +FYK  S+SAA+MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  182  TLEMCMTGLDREKAQIFYKEQSASAAMMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE +GYDFK ++LN LV+RVL+CF P +FSVA+H++      
Sbjct  242  GAVSTIHITPEDGFSYASFETVGYDFKVVNLNELVDRVLSCFLPNEFSVAIHADGGSKPF  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
              +F +DV+GY  ++ S + LG GGS++Y  F    + C SPRSTL C
Sbjct  302  EHMFFVDVKGYCREEWSHEGLGMGGSVVYQRFV-KISDCVSPRSTLKC  348



>ref|XP_009373729.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
 ref|XP_009373730.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
Length=374

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK+ +SSAA MT+ SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKRASVFYKSDASSAAGMTEESGIRKILPQSDICDFEFEPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST-GAE  357
             A+STIHVTPEDGFSYASFE +GY+F  ++L  L+ RVL CFKPA+FS+ALH+ ST G +
Sbjct  247  NAVSTIHVTPEDGFSYASFETVGYNFNDVNLTQLLYRVLDCFKPAEFSIALHTTSTAGED  306

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            L +   LD++GY     S + LG GG+++Y SF    +   SPRS L CCWS
Sbjct  307  LDAKGPLDLKGYCCGGSSYEGLGLGGAVVYHSFVKDNSGSQSPRSILKCCWS  358



>ref|XP_007139351.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
 gb|ESW11345.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
Length=356

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD   ASVF+K ++SSAA MT+ SGIR ILP+S+ICDF+F+PCGYSMN IE  
Sbjct  178  LEMCMTGLDKDCASVFFKENTSSAASMTENSGIRYILPQSDICDFEFDPCGYSMNGIEGN  237

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYD+   +L  LV+RVLACF+PA+FSVALH +  G E+ 
Sbjct  238  AISTIHVTPEDGFSYASFEAVGYDYDDKTLCELVDRVLACFRPAEFSVALHIDMHG-EML  296

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              F LD++GY   + S + LG GG+++Y +F     S  SPRS L CCWSE E+E+
Sbjct  297  DKFPLDIKGYCCGERSFEELGVGGAVVYQTFVQGDGS-ASPRSILRCCWSEDENED  351



>ref|XP_004490298.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
Length=411

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VF+K  S SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  237  TLEMCMTGLDREKALVFFKEQSGSAAKMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  296

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE +GY+ KT++LN LV RVL CF+P +FSVA+H ++     
Sbjct  297  AAVSTIHVTPEDGFSYASFETVGYNLKTMNLNELVVRVLDCFEPTEFSVAVHVDNASKSF  356

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG GGS++Y  F   T+ CGSPRSTL  CW + ++EE
Sbjct  357  EQGCLLDVKGYCREERSHEGLGMGGSVVYQKFV-KTSDCGSPRSTLK-CWKDEDEEE  411



>ref|XP_008811197.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Phoenix 
dactylifera]
Length=354

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 134/176 (76%), Gaps = 4/176 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD K ASVFYK+  +SA+ MT  SGI +ILP SEICDF F+PCGYSMNAIE 
Sbjct  179  TVEMCMTGLDKKLASVFYKSQHNSASKMTIASGISNILPGSEICDFQFDPCGYSMNAIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFEA+GYD + ++++ L+ RVLACF+P + SVA+H++S G  L
Sbjct  239  PAMSTIHVTPEDGFSYASFEAMGYDPEAVNMSQLIARVLACFQPRELSVAIHADSEGYLL  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
            GS F  D+ GYVS   S + LGNGGS+++ SF  S   CGSPRS L  CW   E+E
Sbjct  299  GSGF--DIAGYVSGAKSYQELGNGGSLVFQSFRIS--DCGSPRSILKGCWEGGEEE  350



>ref|XP_010320542.1| PREDICTED: S-adenosylmethionine decarboxylase isoform X1 [Solanum 
lycopersicum]
Length=409

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  232  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  291

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  292  AAVSTIHITPEDGFSYASFESVGYDPKTNELGPLVERVLACFEPAEFSIALHADVATKLL  351

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  352  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESPKSVLKGCW  400



>sp|Q38IY3.1|DCAM_SOLCI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Solanum chilense]
 gb|ABB02530.1| S-adenosylmethionine decarboxylase [Solanum chilense]
Length=358

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCM GLD + ASVFYKT  SSAA MT  SGIR ILP+ EICDF+FEPCGYSMN+IE 
Sbjct  181  TLEMCMAGLDREKASVFYKTEESSAAHMTVRSGIRKILPKFEICDFEFEPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  241  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP+S L  CW
Sbjct  301  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESPKSVLKGCW  349



>ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=410

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKTHSSSA  MT TSGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  231  TLEMCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEG  290

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GY+ K ++L+ L+ERVL+CF+P +FSVA+H++ +G  L
Sbjct  291  AAISTIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAVHADISGKLL  350

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 LDV+GY  ++ S + LG  GSI+Y  F   T    SPRS L CCW
Sbjct  351  ERNCLLDVKGYCCEERSNEELGMCGSIVYHRFM-KTEGLVSPRSILKCCW  399



>ref|NP_001275865.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
 gb|ACQ91107.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
Length=364

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMC+TGLD + ASVFYKT S SA  MT  SGIR ILP S+ICDF+F+PCGYSMN++E 
Sbjct  186  TIEMCLTGLDREMASVFYKTQSGSAGAMTVNSGIRKILPGSKICDFEFDPCGYSMNSVEG  245

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GYD   ++LN LVERVLACF+P DFS+A+H+   G  +
Sbjct  246  AAISTIHVTPEDGFSYASFETVGYDPNDVNLNQLVERVLACFQPRDFSIAVHAEVAGKMI  305

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
                 L+V+GY  ++   + LG GGSI Y  F   T   GSPRSTL CCW 
Sbjct  306  EQECLLNVKGYSREERGLEELGMGGSIWYQKFV-KTEGNGSPRSTLKCCWK  355



>gb|KEH21805.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=360

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD + ASVF+KT  SSA +MT+ SGIR ILP+S+ICDF+FEPCGYSMN IE +
Sbjct  182  LEMCMTGLDKEKASVFFKTEGSSAGLMTKNSGIRKILPKSDICDFEFEPCGYSMNGIEGS  241

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTPEDGFSYASFEA+GYD+   SLN LV RVLACF PA+FS+ALH ++ G ++ 
Sbjct  242  AISTIHVTPEDGFSYASFEAVGYDYSEKSLNELVGRVLACFYPAEFSIALHIDTNGEKID  301

Query  364  SVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
              F L+V+GY   +   + LG  G+++Y +F      C SPRSTL CCWS
Sbjct  302  K-FPLEVKGYNCGERINEVLGEDGAVVYRTFV-RIDGCSSPRSTLKCCWS  349



>ref|XP_004304166.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 1 [Fragaria vesca subsp. vesca]
 ref|XP_004304167.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=371

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT++SSAA+MT+ SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  187  TLEMCMTGLDRKKASVFYKTNASSAAIMTEDSGIRKILPKSEICDFEFDPCGYSMNSIEG  246

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFE +GY+FK ++L  L+ERVL CFKPA+FSV+LHS    +E 
Sbjct  247  DAVSTIHVTPEDGFSYASFETVGYNFKDVNLTRLIERVLDCFKPAEFSVSLHSTIAASEE  306

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
               F L++ GY     S + LG GG+++Y SF     S  SPRS L CCWS
Sbjct  307  LE-FPLELSGYCCGSTSYEELGLGGAVIYHSFNKDGGS-QSPRSILKCCWS  355



>ref|XP_008339774.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
 ref|XP_008352943.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=358

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYKT SSSA  MT  SGIR ILP+S+ICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRGKASVFYKTQSSSATAMTTESGIRXILPDSDICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE  GYD K ++LN LVERVL CF+P +FS+A+H N      
Sbjct  241  AAISTIHVTPEDGFSYASFETAGYDLKDVNLNQLVERVLVCFQPKEFSIAVHXNVASKSH  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++D++GY  ++ S + LG GG+I+Y  F   T  C SPRSTL  CW
Sbjct  301  QQHCSVDLKGYCREESSHEELGLGGAIVYQRFL-KTERCSSPRSTLKGCW  349



>ref|XP_011077597.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Sesamum 
indicum]
Length=349

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYK  SSSA +MT++SGIR+ILPES+ICDF+FEPCGYSMN+IE 
Sbjct  181  TLEMCMTGLDRKKASVFYKNESSSATLMTKSSGIRNILPESDICDFEFEPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA GYD K +++  L+ERVLACF+P +FSV++H+       
Sbjct  241  DAVSTIHITPEDGFSYASFEAAGYDLKQVNMGQLIERVLACFEPKEFSVSVHAQFGAHLC  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
              +  L ++GY  ++   + LG GGSI+Y  F   TASCGSPRS L C
Sbjct  301  DDIHVLGMKGYTPEERCFEELGMGGSIIYQKFV-RTASCGSPRSILKC  347



>dbj|BAC81653.1| S-adenosylmethionine decarboxylase [Pisum sativum]
Length=279

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K  + SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  105  TLEMCMTGLDREKASVFFKEQTGSAAEMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  164

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE  GYD K ++LN +V RVLACF+P +FSVA+H ++     
Sbjct  165  PAVSTIHITPEDGFSYASFETAGYDLKAINLNEMVMRVLACFQPTEFSVAVHVDNASKSF  224

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG  GS++Y  F   T+ CGSPRSTL  CW + ++EE
Sbjct  225  EQGCLLDVKGYCCEEKSHQGLGMSGSVVYQKFL-KTSYCGSPRSTLK-CWKDEDEEE  279



>sp|Q9M4D8.1|DCAM_VICFA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Vicia faba]
 emb|CAB76966.1| S-adenosylmethionine decarboxylase [Vicia faba]
Length=353

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K  + SAA MT  SGIR ILP SEICDFDFEPCGYSMN++E 
Sbjct  179  TLEMCMTGLDREKASVFFKQQTGSAAEMTVNSGIRKILPNSEICDFDFEPCGYSMNSVEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE  GYD K ++LN +V RVLACF+P +FSVA+H ++     
Sbjct  239  PAVSTIHITPEDGFSYASFETAGYDLKAMNLNEMVMRVLACFQPTEFSVAVHVDNASKSF  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  D+ S + LG  GS++Y  F  ++  CGSPRSTL  CW + ++EE
Sbjct  299  EQGCLLDVKGYCCDEKSHQGLGMSGSVVYQKFVKAS-DCGSPRSTLK-CWKDEDEEE  353



>emb|CAD98785.2| S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera]
Length=358

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKTHSSSA  MT TSGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GY+ K ++L+ L+ERVL+CF+P +FSVA+H++ +G  L
Sbjct  241  AAISTIHVTPEDGFSYASFETVGYNPKDVNLSHLIERVLSCFQPNEFSVAVHADISGKLL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 LDV+GY  ++ S + LG  GS++Y  F   T    SPRS L CCW
Sbjct  301  ERNCLLDVKGYCCEERSNEELGMCGSMVYHRFM-KTEGLVSPRSILKCCW  349



>ref|XP_006367530.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=363

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVFYKT SSSAA MT  SGIR ILP+S ICDF+F+PCGYSMN+IE 
Sbjct  183  TLEMCMTNLDRKKASVFYKTESSSAAQMTIRSGIRKILPDSAICDFEFDPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
            AA+STIHVTPEDGFSYASFEA+GYD    SL +LV RVL CF+P +FSVALH++    E 
Sbjct  243  AALSTIHVTPEDGFSYASFEAVGYDLNCSSLGSLVRRVLTCFQPDEFSVALHADDVACEL  302

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
            L  + + DV+GY   + S + LG GGSI+Y  FT S+  CGSP+S L  CW
Sbjct  303  LERICSFDVKGYSHAEWSPEELGKGGSIVYQKFTRSSV-CGSPKSVLQDCW  352



>ref|XP_006437789.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
 gb|ESR51029.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
Length=476

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMC+TGLD + ASVFYKT S SA  MT +SGIR ILP+S+ICDF+F+PCGYSMN++E 
Sbjct  298  TIEMCLTGLDREMASVFYKTQSGSAGAMTVSSGIRKILPDSKICDFEFDPCGYSMNSVEG  357

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GYD   ++L  LVERVLACF+P DFS+A+H+   G  +
Sbjct  358  AAISTIHVTPEDGFSYASFETVGYDPNDVNLKQLVERVLACFQPRDFSIAVHAEVAGKMI  417

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 L+V+GY  ++   + LG GGSI+Y  F   T   GSPRSTL CCW
Sbjct  418  EQKCLLNVKGYSREERGLEELGMGGSILYQKFV-KTEGNGSPRSTLKCCW  466



>ref|XP_009588870.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=415

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD + AS+FYKT SSSAA MT  SGIR ILP S+ICDF+F+PCGYSMN+IE 
Sbjct  236  TLEMCMTSLDREKASIFYKTESSSAAQMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEG  295

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFEA+GYDFK+ SL +LV+RVLACF+P +FS+ALH++     L
Sbjct  296  AALSTIHVTPEDGFSYASFEAVGYDFKSSSLGSLVKRVLACFQPDEFSIALHADVALELL  355

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                +LDV+GY   + S + LG  GSI+Y  F  S+  CGSP+S L  CW
Sbjct  356  KHTCSLDVKGYSPAEWSPEELGKSGSIVYQKFARSSF-CGSPKSVLQNCW  404



>emb|CDP00521.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFY++ SSSAA+MT  SGIR ILPESEICDF+F+PCGYSMN+IE 
Sbjct  181  TLEMCMTGLDREMASVFYRSQSSSAALMTVQSGIRKILPESEICDFEFDPCGYSMNSIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA GYD K ++L  L+ RVLACF+P++FS+A+H++ +   L
Sbjct  241  DAISTIHVTPEDGFSYASFEAAGYDLKVVNLGLLIARVLACFEPSEFSIAVHADLSPKLL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                +LD++GY   +   + LG+  S++Y  F   T +CGSPRS L CCW
Sbjct  301  ELTCSLDLKGYHLGEKCREELGSDNSVVYQKFV-KTVACGSPRSILKCCW  349



>gb|ADH95190.1| S-adenosylmethionine decarboxylase [Arachis hypogaea]
Length=358

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VFYK  S SAA MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  184  TLEMCMTGLDREKALVFYKEPSGSAARMTANSGIRKILPDSDICDFEFEPCGYSMNSVEG  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE +GYD K ++LN LVE VLACF+P +FS+A+H + +    
Sbjct  244  AAVSTIHVTPEDGFSYASFETVGYDLKVVNLNDLVESVLACFQPTEFSMAVHVDCSSKSF  303

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
                 LDV+GY  ++ S + +G GGS++Y  F   T+ CGSPRSTL C   E E+E
Sbjct  304  EQSCLLDVKGYCREERSHEGIGMGGSVVYQKFV-KTSDCGSPRSTLKCWKDEVEEE  358



>ref|XP_010325052.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum lycopersicum]
Length=364

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT L  K ASVFYKT SSSAA MT  SGIR ILP S+ICDF+F+PCGYSMN+IE 
Sbjct  182  TLEMCMTNLLRKKASVFYKTESSSAAEMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
            AA+STIHVTPEDGFSYASFEA+GYD  + SL +LV RVL CF+P +FSVALH++    E 
Sbjct  242  AALSTIHVTPEDGFSYASFEAVGYDLNSSSLGSLVRRVLTCFQPDEFSVALHADYVACEL  301

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
            L  + + DV+GY   + S + LG GG I+Y  FT S+  CGSP+S L  CW+E E  
Sbjct  302  LERICSFDVKGYSHAEWSPEELGKGGLIVYRKFTRSSL-CGSPKSVLQDCWNEEEKR  357



>gb|ABY55856.1| S-adenosylmethionine decarboxylase 3 [Solanum lycopersicum]
Length=364

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 131/177 (74%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT L  K ASVFYKT SSSAA MT  SGIR ILP S+ICDF+F+PCGYSMN+IE 
Sbjct  182  TLEMCMTNLLRKKASVFYKTESSSAAEMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
            AA+STIHVTPEDGFSYASFEA+GYD  + SL +LV RVL CF+P +FSVALH++    E 
Sbjct  242  AALSTIHVTPEDGFSYASFEAVGYDLNSSSLGSLVRRVLTCFQPDEFSVALHADYVACEL  301

Query  358  LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
            L  + + DV+GY   + S + LG GG I+Y  FT S+  CGSP+S L  CW+E E  
Sbjct  302  LERICSFDVKGYSHAEWSPEELGKGGLIVYRKFTRSSL-CGSPKSVLQDCWNEEEKR  357



>ref|XP_010091687.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXB44953.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=360

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  SSSAA+MT  SGIR ILP+SEICDFDF+PCGYSMNAIE 
Sbjct  179  TLEMCMTGLDKEKASVFYKAQSSSAALMTINSGIRKILPDSEICDFDFDPCGYSMNAIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE +GYD K +    L+ RVLACF+P +FS+A+H++     L
Sbjct  239  AAVSTIHITPEDGFSYASFETVGYDLKDVKFEQLIVRVLACFQPREFSIAVHADVACGSL  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                + +V+GY   + S K LG  GSI+   F  +  S GSPRSTL+CCW
Sbjct  299  EENCSPNVKGYSCGESSYKELGMSGSIVCHKFVRTNDSYGSPRSTLSCCW  348



>ref|XP_009801145.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=416

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD + AS+FYKT SS AA MT  SGIR ILP S+ICDF+F+PCGYSMN+IE 
Sbjct  237  TLEMCMTSLDREKASIFYKTESSLAAQMTIRSGIRKILPNSDICDFEFDPCGYSMNSIEG  296

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFEA+GYDFK LSL ALV+RVLACF+P +FS+ALH++     L
Sbjct  297  AALSTIHVTPEDGFSYASFEAVGYDFKFLSLGALVKRVLACFQPDEFSIALHADVDLELL  356

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
             +  +LDV+GY   + S + LG G SI+Y  F  S+  CGSP+S L  CW
Sbjct  357  ENTCSLDVKGYSLAEWSPEELGKGDSIVYQKFARSSF-CGSPKSVLQDCW  405



>emb|CAN66014.1| hypothetical protein VITISV_041154 [Vitis vinifera]
Length=357

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKTHSSSA  MT TSGIR ILP+SEICDF+F+PCGYSMNAIE 
Sbjct  181  TLEMCMTGLDREMASVFYKTHSSSAVKMTDTSGIRKILPDSEICDFEFDPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE +GY+ K ++L+ L+ERVL+CF+P +FSVA+H++ +G  L
Sbjct  241  AAISTIHVTPEDGFSYASFETMGYNPKDVNLSQLIERVLSCFQPNEFSVAVHADISGKLL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCC  507
                 LDV+GY  ++ S + LG  GSI+Y  F   T    SPRS L CC
Sbjct  301  ERNCLLDVKGYCCEERSNEELGMCGSIVYHRFM-KTEGVVSPRSILKCC  348



>gb|ACZ73828.1| S-adenosylmethionine decarboxylase [Olea europaea]
Length=354

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK+ SSSA  MT TSGIR ILP+S+ICDF+FEPCGYSMN+IEE
Sbjct  178  TLEMCMTGLDREMASVFYKSDSSSATSMTNTSGIRKILPKSDICDFEFEPCGYSMNSIEE  237

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA GY+ K ++L+ L+ERVLACF+P +FS+A+H ++     
Sbjct  238  AAISTIHVTPEDGFSYASFEAAGYNLKDVNLSMLIERVLACFRPKEFSIAVHVDNGVMLF  297

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
             +++  D++GY  ++   +  G GGSI+Y  F   TA CGSPRS L C
Sbjct  298  DNIYFQDLKGYSVNEECHEEPGYGGSIVYQKFV-QTAYCGSPRSILKC  344



>gb|ABW21900.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21906.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PADFS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPADFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AEO52839.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIER  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ELVCSVDVKGYSLSEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29170.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAYMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29125.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29126.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
Length=343

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   ++S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAELSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AAR84406.1| S-adenosylmethionine decarboxylase [Daucus carota]
 gb|AAR84408.1| S-adenosylmethionine decarboxylase [Daucus carota]
Length=361

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMT L+   ASVFYKT+SSSA  MT  SGIRDILP S ICDF+F+PCGYSMNA+E 
Sbjct  181  TMEMCMTSLNRDKASVFYKTNSSSATSMTDNSGIRDILPNSRICDFEFDPCGYSMNAVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSY+SFEA+GYD K+++L+ LV RVL CF+P +FS+AL ++     L
Sbjct  241  PAVSTIHITPEDGFSYSSFEAVGYDPKSVNLSDLVARVLNCFQPGEFSIALQADIASELL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++ V+GY  ++ +C+ LG  GSI+Y  F  +T  C SPRS L CCW
Sbjct  301  EKTSSVHVKGYRVEEKTCEELGMDGSIVYQKFVKTTERCESPRSVLKCCW  350



>gb|ABW21925.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR+ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRNILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21898.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21899.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21907.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSIDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21863.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21866.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21867.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21868.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21874.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21875.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21877.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21883.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AEO52834.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52835.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52844.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|XP_006288009.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
 gb|EOA20907.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
Length=362

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDKDKASVFYKKESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  239  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVEQKGY  298

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
            GS   +D+  Y   +++ ++LG   G++MY  F      CGSPRSTL C WS      SE
Sbjct  299  GSGLAVDLDDYGCRELTMESLGEERGAVMYQRFEKLGKYCGSPRSTLKCEWSSNSSCHSE  358

Query  523  DEE  531
            DE+
Sbjct  359  DEK  361



>gb|AAX56882.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56883.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56885.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56887.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56891.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56892.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56894.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56896.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56897.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56898.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56899.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56900.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56902.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56903.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56904.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56906.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56907.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56908.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56909.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|ABW21864.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21865.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21869.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21870.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21871.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21872.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21879.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21880.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21881.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21882.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21884.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21891.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21892.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21893.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21897.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21905.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21909.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21910.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21911.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21914.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21916.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21918.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21926.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21929.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ADV29115.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29116.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29117.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29118.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29119.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29120.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29121.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29122.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29123.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29124.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29127.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29128.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29129.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29130.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29131.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29132.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29133.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29134.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29135.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29136.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29137.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29138.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29139.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29141.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29142.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29143.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29144.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29145.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29146.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29147.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29148.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29149.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29150.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29151.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29152.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29153.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29154.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29155.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29156.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29157.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29158.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29159.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29160.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29161.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29162.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29163.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29164.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29174.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|AEO52757.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52759.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52760.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52761.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52762.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52764.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52765.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52766.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52832.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52836.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52838.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52840.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52843.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52845.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AAX56886.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56890.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29176.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29177.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29178.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AEO52842.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21873.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AEO52841.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21915.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21878.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AEO52837.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EGVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AAR15894.1| S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=369

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 131/186 (70%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  183  TLEMCMTGLDKEKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  243  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVAQKSY  302

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
             S  ++D+  Y   + + ++LG   G++MY SF      CGSPRSTL C W       SE
Sbjct  303  DSGLSVDLEDYGCRETTIESLGEERGTVMYQSFEKLGRYCGSPRSTLKCEWSSSSSCTSE  362

Query  517  SEDEEG  534
             E EEG
Sbjct  363  DEKEEG  368



>gb|ADV29140.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
Length=343

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRRILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21887.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21888.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21901.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21902.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21903.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21904.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21908.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21913.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AEO52763.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
Length=343

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21917.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSA+ MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSASHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYALAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>sp|Q43820.1|DCAM_PEA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Pisum sativum]
 gb|AAB03865.1| S-adenosylmethionine decarboxylase [Pisum sativum]
Length=353

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K  + SAA MT  SGIR IL  SEICDFDFEPCGYSMN++E 
Sbjct  179  TLEMCMTGLDREKASVFFKEQTGSAAEMTVNSGIRKILRNSEICDFDFEPCGYSMNSVEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +A+STIH+TPEDGFSYASFE  GYD K ++LN +V RVLACF+P +FSVA+H ++     
Sbjct  239  SAVSTIHITPEDGFSYASFETAGYDLKAINLNEMVMRVLACFQPTEFSVAVHVDNASKSF  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 LDV+GY  ++ S + LG  GS++Y  F   T+ CGSPRSTL  CW + ++EE
Sbjct  299  EQGCLLDVKGYCCEEKSHQGLGMSGSVVYQKFL-KTSYCGSPRSTLK-CWKDEDEEE  353



>sp|O49972.1|DCAM2_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC 2; Short=SAMDC 2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 2 beta chain; 
Flags: Precursor [Brassica juncea]
 gb|AAB88273.1| S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=369

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 130/186 (70%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  183  TLEMCMTGLDKEKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  243  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVAQKSY  302

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
             S  ++D+  Y   + + + LG   G++MY SF      CGSPRSTL C W       SE
Sbjct  303  DSGLSVDLEDYGCRETTIELLGEERGTVMYQSFEKLGRYCGSPRSTLKCEWSSSSSCTSE  362

Query  517  SEDEEG  534
             E EEG
Sbjct  363  DEKEEG  368



>gb|ABW21919.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21920.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21921.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21922.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21923.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21924.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21927.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21928.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21930.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVGTKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>emb|CDY26478.1| BnaC09g41900D [Brassica napus]
Length=367

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 129/186 (69%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  181  TLEMCMTGLDKDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  241  GAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVAQKSY  300

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
             S  ++D+  Y   + + ++LG   G++MY  F      CGSPRSTL C W       SE
Sbjct  301  DSGLSVDLEDYGCRETTVESLGEERGTVMYQRFEKLGMYCGSPRSTLKCEWSSNSSCTSE  360

Query  517  SEDEEG  534
             E EEG
Sbjct  361  DEKEEG  366



>gb|AAZ85232.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85233.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85234.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85235.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85236.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85238.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85239.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85240.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L +LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGSLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|NP_197099.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 ref|NP_001031888.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 sp|Q9S7T9.1|DCAM2_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 beta chain; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32007.1|AF436825_1 AT5g15950/F1N13_90 [Arabidopsis thaliana]
 emb|CAB63805.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 emb|CAB64672.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 emb|CAC01794.1| S-adenosylmethionine decarboxylase (adoMetDC2) [Arabidopsis thaliana]
 gb|AAL47397.1| AT5g15950/F1N13_90 [Arabidopsis thaliana]
 gb|AED92227.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 gb|AED92228.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
Length=362

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDKDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CFKP  FSVA+HS       
Sbjct  239  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFKPKQFSVAVHSTVAQKSY  298

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
             S  ++D+  Y   + + ++LG   G++MY  F      CGSPRSTL C WS      SE
Sbjct  299  DSGLSVDLDDYGCKESTMESLGEERGTVMYQRFEKLGRYCGSPRSTLKCEWSSNSSCNSE  358

Query  523  DEE  531
            DE+
Sbjct  359  DEK  361



>gb|ADV29203.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVKSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|EPS62258.1| s-adenosylmethionine decarboxylase proenzyme, partial [Genlisea 
aurea]
Length=357

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 126/170 (74%), Gaps = 4/170 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD + ASVFYK  SSSAA MT++SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  184  TVEMCMTGLDRERASVFYKEDSSSAAQMTKSSGIRHILPDSEICDFEFEPCGYSMNSIEG  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA GYD K L+L  L+ER L CF+P +FSV++H    G EL
Sbjct  244  AAISTIHVTPEDGFSYASFEAAGYDLKRLNLELLIERALTCFEPDEFSVSVHGER-GTEL  302

Query  361  --GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
                   LD+ GYV +D   + LG GG IMY  F  +   CGSPRS L C
Sbjct  303  CDDEDVGLDMCGYVCEDKWFEELGQGGWIMYRKFARAR-RCGSPRSILKC  351



>gb|AAX56905.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSFALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AEO52758.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29171.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPCCESP  343



>gb|AAX56884.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56888.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56893.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56895.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56901.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21894.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29169.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29175.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|AEO52833.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29165.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29166.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29167.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29168.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29172.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29173.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29179.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29180.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29182.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29183.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29187.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29188.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29189.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29190.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29191.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29192.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29195.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29196.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29197.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29201.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29204.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21895.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AGV54395.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=354

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A +FYK  S+SAA+MT  SGIR ILP S+ICDFDFEPCGYSMN++E 
Sbjct  180  TLEMCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPNSDICDFDFEPCGYSMNSVEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE +GYDFK L+LNALV+RVL+CF P +FSVA+  +      
Sbjct  240  DAVSTIHITPEDGFSYASFETVGYDFKVLNLNALVDRVLSCFLPNEFSVAVRVDGASKPS  299

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              +  +DV+GY  ++   + LG GG ++Y  F    + C SPRSTL  CW +  +EE
Sbjct  300  EQMCFVDVKGYCREEWIHEGLGMGGFVVYQKFV-KISDCVSPRSTLK-CWKDEVEEE  354



>gb|ADV29193.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21885.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21896.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29184.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|XP_007153542.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
 gb|ESW25536.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
Length=354

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 129/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A +FYK  S+SAA+MT  SGIR ILP S+ICDFDFEPCGYSMN++E 
Sbjct  180  TLEMCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPNSDICDFDFEPCGYSMNSVEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE +GYDFK L+LNALV+RVL+CF P +FSVA+  +      
Sbjct  240  DAVSTIHITPEDGFSYASFETVGYDFKVLNLNALVDRVLSCFLPNEFSVAVRVDGASKPS  299

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              +  +DV+GY  ++   + LG GG ++Y  F    + C SPRSTL  CW +  +EE
Sbjct  300  EQMCFVDVKGYCREEWIHEGLGMGGFVVYQKFV-KISDCVSPRSTLK-CWKDEVEEE  354



>gb|ABW21889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=344

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSC-KALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   +  C +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWRCPEEFGKGGSIVYQKFT-RTPYCESP  344



>gb|ABW21890.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>sp|Q9AXE3.1|DCAM_DAUCA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Daucus carota]
 gb|AAG61146.1|AF334029_1 S-adenosyl-methionine decarboxylase [Daucus carota]
Length=361

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 127/170 (75%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMT L+   ASVFYKT+SSSA  +T  SG+RDILP S ICDF+F+PCGYSMNA+E 
Sbjct  181  TMEMCMTSLNRDKASVFYKTNSSSATSVTDNSGLRDILPNSRICDFEFDPCGYSMNAVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSY+SFEA+GYD K+++L+ LV RVL CF+P +FS+AL ++     L
Sbjct  241  PAVSTIHITPEDGFSYSSFEAVGYDPKSVNLSDLVARVLNCFQPGEFSIALQADIASELL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                ++ V+GY  ++ +C+ LG  GSI+Y  F  +T  C SPRS L CCW
Sbjct  301  EKTSSVHVKGYRVEEKTCEELGMDGSIVYQKFVKTTERCESPRSVLKCCW  350



>gb|AAZ85231.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicoides]
Length=343

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+P++FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPSEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSVAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21876.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTDESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|XP_010904619.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Elaeis 
guineensis]
Length=356

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMTGLD + ASVFYK   +SA+ MT  SGI  ILP SEICDF F+PCGYSMNAIE 
Sbjct  179  TVEMCMTGLDKRLASVFYKNQHNSASKMTIASGISKILPGSEICDFQFDPCGYSMNAIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFEA+GYD + ++++ L+ RVLACF+P +FS+A+HS       
Sbjct  239  PAMSTIHVTPEDGFSYASFEAMGYDPEAVNMSQLIARVLACFQPREFSIAIHSGLRSEVY  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
                  D+ GYVS   S + LGNGGS+++ SF      CGSPRS L  CW E E+E
Sbjct  299  LLESGFDITGYVSGAKSYQELGNGGSLVFQSFR--ITDCGSPRSILKGCWEEGEEE  352



>gb|ABW21931.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVGTKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29194.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTGESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AEO52817.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum ochranthum]
Length=343

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+P +FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTQLGPLVERVLACFEPTEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ABW21912.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLDREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+ Y   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKDYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29198.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29199.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29200.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29202.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            A++STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  ASVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>sp|P46255.1|DCAM_SPIOL RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA57170.1| adenosylmethionine decarboxylase [Spinacia oleracea]
Length=363

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL  + ASVF+K+ S +AAVMT++SGIR ILP+S+ICDFDFEPCGYSMNAIE 
Sbjct  179  TLEMCMTGLKKEKASVFFKSQSPNAAVMTESSGIRKILPDSKICDFDFEPCGYSMNAIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIH+TPEDGFSYASFEA+GYD K   LN LVERVLACF+P++FS+A+H+      +
Sbjct  239  PAISTIHITPEDGFSYASFEAVGYDLKKTDLNQLVERVLACFEPSEFSIAIHAEIAANSM  298

Query  361  GSVFNLDVRGYVSDDMSCKALGNG-GSIMYCSFTSSTASCGS---PRSTLNCCWSESEDE  528
                 ++V GY  ++   + LG G  S+ Y  F  ++   G+   P+  L CCW E + E
Sbjct  299  EHNCYVNVNGYSREEGGIEELGFGAASVFYQKFCKASTGFGATNKPKPALKCCWKEDKFE  358

Query  529  E  531
            E
Sbjct  359  E  359



>gb|ABW21886.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSKICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|ADV29185.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29186.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TL+MCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLDMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>dbj|BAB83763.1| S-adenosylmethionine decarboxylase [Phaseolus lunatus]
Length=354

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A +FYK  S+SAA+MT  SGIR ILP+S+ICDFDFEPCGYSMN++E 
Sbjct  180  TLEMCMTGLDREKAQIFYKEQSASAAIMTVNSGIRKILPKSDICDFDFEPCGYSMNSVEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE +GYDFK L+LNA+V+RVL+CF P +FSVA+  +      
Sbjct  240  DAVSTIHITPEDGFSYASFETVGYDFKVLNLNAMVDRVLSCFLPNEFSVAVRVDGASKPS  299

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
              +  +DV+GY  ++   + LG GG ++Y  F    + C SPRSTL  CW +  +EE
Sbjct  300  EHMCFVDVKGYCREEWCHEELGMGGFVVYQKFV-KISDCVSPRSTLK-CWKDEVEEE  354



>gb|AAZ85242.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85243.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85244.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85245.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85246.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85247.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85248.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85249.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85250.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85251.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
Length=343

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  TAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  EHVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>gb|AAZ85237.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85241.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  SSAA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESSAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKLL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
                ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERACSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|XP_010692003.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=358

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 133/180 (74%), Gaps = 2/180 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+   ASVFYKT+SSSA+ MT++SGIR ILP+S ICDF+F+PCGYSMN++E 
Sbjct  176  TLEMCMTGLNKNCASVFYKTNSSSASDMTESSGIRKILPQSRICDFEFDPCGYSMNSVEG  235

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFE+ GYD K + +  +VERVL CF+P +FS+++H       L
Sbjct  236  AAISTIHVTPEDGFSYASFESAGYDLKKMKVEHMVERVLVCFQPTEFSLSVHCEEHADLL  295

Query  361  GS-VFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGG  537
             S V ++ V GY  +  SC+ LG+GGS++Y  F  S   C SPRS L C W + ++ + G
Sbjct  296  ESTVGSVIVDGYYMNYKSCEELGDGGSVIYYQFLKSEV-CQSPRSILKCGWKDEDESDSG  354



>ref|XP_002871694.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47953.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=363

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVF+K  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDKDKASVFFKNDSSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  239  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVAQNGY  298

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
             SV  +D+  Y   + + ++LG   G++MY SF      CGSPRSTL C WS      SE
Sbjct  299  DSVLCVDLDDYGCRETTMESLGEERGTVMYQSFEKLGKYCGSPRSTLKCEWSSNSSCNSE  358

Query  523  DEE  531
            DE+
Sbjct  359  DEK  361



>gb|ADV29181.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVFYKT  S AA MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  183  TLEMCMTGLNREKASVFYKTEESLAAHMTVRSGIRKILPKSEICDFEFEPCGYSMNSIEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIH+TPEDGFSYASFE++GYD KT  L  LVERVLACF+PA+FS+ALH++     L
Sbjct  243  AAVSTIHITPEDGFSYASFESVGYDPKTTELGPLVERVLACFEPAEFSIALHADVATKIL  302

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSP  486
              V ++DV+GY   + S +  G GGSI+Y  FT  T  C SP
Sbjct  303  ERVCSVDVKGYSLAEWSPEEFGKGGSIVYQKFT-RTPYCESP  343



>ref|XP_006395646.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 ref|XP_006395647.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32932.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32933.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
Length=362

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+KT   SA+ MT +SGIR+ILP SEICDF+F+PCGYSMN+IEE
Sbjct  184  TLEMCMTGLDKRKASVFFKTPLVSASEMTLSSGIRNILPSSEICDFEFDPCGYSMNSIEE  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHV PEDGFSYASFE +GYD K L+   LV RVL CF P +FSVA+H++     L
Sbjct  244  DAVSTIHVIPEDGFSYASFETVGYDLKALNFKELVNRVLVCFGPGEFSVAVHADHGTGLL  303

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 +DV+GY+  +   + L  GGS++Y  F   T  CGSP+STL  CW
Sbjct  304  ARDCVVDVKGYLIKERGLEELELGGSVLYQKFV-KTVECGSPKSTLRFCW  352



>ref|XP_006400122.1| hypothetical protein EUTSA_v10015260mg [Eutrema salsugineum]
 gb|ESQ41575.1| hypothetical protein EUTSA_v10015260mg [Eutrema salsugineum]
Length=369

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 128/186 (69%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  183  TLEMCMTGLDKDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  242

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  243  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAIHSSVGQMSY  302

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
             S   +D+  Y   + + ++LG   G++MY  F      CGSPRSTL C W       SE
Sbjct  303  DSSLCVDLGDYGCRESTMESLGEERGTVMYQRFEKLGRYCGSPRSTLKCEWSSNSSCTSE  362

Query  517  SEDEEG  534
             E EEG
Sbjct  363  DEKEEG  368



>gb|AGZ90156.1| S-adenosylmethionine decarboxylase, partial [Litsea cubeba]
Length=358

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 5/182 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVFYKT +S+AA+MT  SGIR ILP SEI DF+F+PCGYSMN+IE 
Sbjct  179  TLEMCMTGLDRKLASVFYKTETSTAALMTDASGIRKILPGSEISDFEFDPCGYSMNSIEG  238

Query  181  AAISTIHVTPEDGFSYASFEALGYDF-KTLSLNALVERVLACFKPADFSVALHSN-STGA  354
            +AISTIHVTPEDGFSYASFEA GYD    + L+ LVERVL CF+P +FS+A+H + S   
Sbjct  239  SAISTIHVTPEDGFSYASFEAAGYDLMNVVDLSQLVERVLNCFQPEEFSLAVHVDASANI  298

Query  355  ELGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEG  534
            ELG V +LD+ GY+  +   + LG GG ++Y SF      C SP+S L  CW+E + EE 
Sbjct  299  ELGCVGSLDLSGYLCGERCYQTLGKGGYLVYQSF--KMGRCASPKSILK-CWAEEDSEEE  355

Query  535  GI  540
             +
Sbjct  356  SV  357



>ref|XP_010492454.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2 [Camelina 
sativa]
 ref|XP_010492455.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2 [Camelina 
sativa]
Length=363

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 124/171 (73%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDRDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHSSVAQKGY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW  510
             S  ++D+  Y   +++ ++LG   G+++Y  F      CGSPRSTL C W
Sbjct  300  NSGLSVDLDDYGCSELTMESLGEERGTMIYQRFEKLGKYCGSPRSTLKCEW  350



>emb|CAA69073.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 127/186 (68%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VFYK  +     MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +D+  Y   + + ++LG   G++MY +F      CGSPRSTL C W       SE
Sbjct  300  KPEITVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  517  SEDEEG  534
             E +EG
Sbjct  360  DEKDEG  365



>ref|NP_186896.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001078093.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001154585.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 sp|Q96286.2|DCAM1_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 beta chain; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL16237.1|AF428468_1 AT3g02470/F16B3_10 [Arabidopsis thaliana]
 gb|AAF32454.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAK68764.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAM10008.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 dbj|BAH19598.1| AT3G02470 [Arabidopsis thaliana]
 gb|AEE73812.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73813.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73814.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 127/186 (68%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VFYK  +     MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +D+  Y   + + ++LG   G++MY +F      CGSPRSTL C W       SE
Sbjct  300  KPEITVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  517  SEDEEG  534
             E +EG
Sbjct  360  DEKDEG  365



>gb|AAL06846.1| AT3g02470/F16B3_10 [Arabidopsis thaliana]
Length=366

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 127/186 (68%), Gaps = 8/186 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VFYK  +     MT  SGIR ILP+SEICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKILPKSEICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +D+  Y   + + ++LG   G++MY +F      CGSPRSTL C W       SE
Sbjct  300  KPEITVDLEDYGCRERTFESLGEESGTVMYHTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  517  SEDEEG  534
             E +EG
Sbjct  360  DEKDEG  365



>gb|AAS45435.1| S-adenosylmethionine decarboxylase [Brassica juncea]
Length=366

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKASVFYKNETGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANAY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  300  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  523  DEE  531
            DE+
Sbjct  360  DEK  362



>ref|XP_010420276.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Camelina sativa]
Length=364

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDKDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+H +      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHCSVAQQGY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW  510
             S  ++D+  Y    ++ ++LG   G++MY  F      CGSPRSTL C W
Sbjct  300  NSGLSVDLDDYGCSKLTMESLGEERGTMMYQKFEKLGKYCGSPRSTLKCEW  350



>ref|XP_006291363.1| hypothetical protein CARUB_v10017502mg [Capsella rubella]
 gb|EOA24261.1| hypothetical protein CARUB_v10017502mg [Capsella rubella]
Length=362

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K A VF K +S SA+ MT TSGIR+IL +SEICDFDFEPCGYSMN+IEE
Sbjct  184  TLEMCMTGLDKKKALVFLKKNSVSASEMTVTSGIRNILTDSEICDFDFEPCGYSMNSIEE  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTP DGFSYASFE +GYD K L+   LV+RVL CF P +FS+A+H+N     +
Sbjct  244  DAVSTIHVTPGDGFSYASFETVGYDLKALNFKELVDRVLVCFGPKEFSLAVHANLGTELV  303

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
             S   +D +GY+  +   + LG GGS++Y  F   T   GSP+STL  CW
Sbjct  304  ASDCVVDTKGYLRQERGLEELGLGGSVLYQKFV-KTIEPGSPKSTLGFCW  352



>ref|XP_010681340.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=372

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGL+ + ASVF+K  S SAAVMT++SGIR ILP+S ICDFDFEPCGYSMNAIE 
Sbjct  193  TLEMCMTGLNKEKASVFFKAQSDSAAVMTESSGIRKILPDSAICDFDFEPCGYSMNAIEG  252

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA+GYD K + LN LVERVLACF+P++FS+A++++     +
Sbjct  253  PAVSTIHITPEDGFSYASFEAVGYDLKMIDLNQLVERVLACFEPSEFSIAINADIAAYPM  312

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                 ++  GY  ++   + LG G S+ Y  F  +T   G  +  L C W
Sbjct  313  EQNCTVNANGYSREEGGIEELGFGASVFYQKFCKATTMIGFTKPALKCLW  362



>ref|XP_002882231.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58490.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKASVFYKNEADKTGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  300  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  523  DEE  531
            DE+
Sbjct  360  DEK  362



>gb|ADD91751.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VF+K  S+ + +MT TSGIR+ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  182  TLEMCMTGLDREKAAVFFKNESNVSTLMTNTSGIRNILPKSHICDFEFEPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA GYD K ++L ALVERVLACF+P +FSV++H+   GAEL
Sbjct  242  DAVSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLACFEPNEFSVSVHAQ-CGAEL  300

Query  361  -GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESE  522
               +   +++ Y   + S + LG GG+I Y  F  S  SCGSPRSTL C   E +
Sbjct  301  FEEICFPELKCYSGGERSVEELGAGGAITYQKFVRSV-SCGSPRSTLKCFRDEDD  354



>ref|XP_006408415.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
 dbj|BAJ33801.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49868.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
Length=366

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKASVFYKNETGETGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSIGVKAY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  300  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCDWSSNNSCSSE  359

Query  523  DEE  531
            DE+
Sbjct  360  DEK  362



>ref|NP_189184.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 ref|NP_001189972.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 sp|Q9LSU6.1|DCAM3_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 3; 
Short=AdoMetDC3; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 beta chain [Arabidopsis thaliana]
 dbj|BAB01327.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAT06473.1| At3g25570 [Arabidopsis thaliana]
 gb|AEE77029.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE77030.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=349

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD+  ASVF+KT+S SA+ MT +SGIR+ILP SEICDF+FEPCGYSMN+IE 
Sbjct  182  TLEMCMTGLDNIKASVFFKTNSVSASEMTISSGIRNILPGSEICDFNFEPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFE +GYD K L+   LV+RVL CF P +FSVA+H+N     L
Sbjct  242  DAVSTIHVTPEDGFSYASFETVGYDLKALNFKELVDRVLVCFGPEEFSVAVHANLGTEVL  301

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCC  507
             S    DV GY S +   + LG GGS++Y  F   T  C SP+STL  C
Sbjct  302  ASDCVADVNGYFSQERELEELGLGGSVLYQRFV-KTVECCSPKSTLGFC  349



>ref|XP_009132246.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Brassica rapa]
Length=287

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSS   MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  104  TLEMCMTGLDKDKASVFYKNESSS---MTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  160

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL CF+P  FSVA+HS+      
Sbjct  161  GAISTIHVTPEDGFSYASFEAVGYDFTTMDLSLLVSRVLTCFEPKQFSVAIHSSIAQKSY  220

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +++  Y   + + ++LG   G++MY  F      CGSPRSTL C W       SE
Sbjct  221  YKGLCVELDDYGCRETTMESLGEERGTVMYQRFEKLGRYCGSPRSTLKCEWSSNSSCTSE  280

Query  517  SEDEEG  534
             E EEG
Sbjct  281  DEKEEG  286



>gb|ADF81049.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VF+K  S+ + +MT TSGIR+ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  182  TLEMCMTGLDREKAAVFFKNESNVSTLMTNTSGIRNILPKSHICDFEFEPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA GYD K ++L ALVERVLACF+P +FSV++H+   GAEL
Sbjct  242  DAVSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLACFEPNEFSVSVHAQ-CGAEL  300

Query  361  -GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
               +   +++ Y   + S + LG GG+I Y  F  S  SCGSPRSTL C
Sbjct  301  FEEICFPELKCYSGGERSVEELGAGGAITYQKFVRSV-SCGSPRSTLKC  348



>emb|CDX78666.1| BnaA03g05780D [Brassica napus]
Length=302

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 126/187 (67%), Gaps = 11/187 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSS   MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  119  TLEMCMTGLDKDKASVFYKNESSS---MTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  175

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL CF+P  FSVA+HS+      
Sbjct  176  GAISTIHVTPEDGFSYASFEAVGYDFTTMDLSLLVSRVLTCFEPKQFSVAIHSSIAQKSY  235

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +++  Y   + + ++LG   G++MY  F      CGSPRSTL C W       SE
Sbjct  236  YKGLCVELDDYGCRETTMESLGEERGTVMYQRFEKLGRYCGSPRSTLKCEWSSNSSCTSE  295

Query  517  SEDEEGG  537
             E EEG 
Sbjct  296  DEKEEGA  302



>sp|Q39677.1|DCAM2_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC 2; Short=SAMDC 2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 2 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09840.1| S-adenosylmethionine decarboxylase 2 [Dianthus caryophyllus]
Length=377

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVF+K+ S+SAAVMT++SGIR ILP+S ICDFDFEPCGYSMNAIE 
Sbjct  193  TLEMCMTGLDKEKASVFFKSQSASAAVMTESSGIRKILPDSVICDFDFEPCGYSMNAIEG  252

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
             A+STIH+TPEDGFSYASFEA+GYD + + LN LVERVLACF+P +FS+A+H+++  A+ 
Sbjct  253  PAVSTIHITPEDGFSYASFEAVGYDLQVVDLNLLVERVLACFEPKEFSIAVHADTDTADK  312

Query  358  -LGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASC--GSPRSTLNCCWS  513
             L    +++V GY  ++   + LG GGS+ Y  F   TA     +P+ TL CCW 
Sbjct  313  VLARNCSVNVIGYSREEGGIEELGLGGSVFYQKFCKGTAPVCPPAPKKTLKCCWK  367



>emb|CDX69487.1| BnaA10g18360D [Brassica napus]
Length=368

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 129/187 (69%), Gaps = 9/187 (5%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVF+K  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN++E 
Sbjct  181  TLEMCMTGLDKDKASVFFKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL CF+P  FSVA++S+      
Sbjct  241  DAISTIHVTPEDGFSYASFEAVGYDFTTMDLSHLVSRVLTCFEPKQFSVAVNSSVAQKSY  300

Query  361  G-SVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------S  513
              S  ++D+  Y   + + ++LG   G++MY  F      CGSPRSTL C W       S
Sbjct  301  DHSGLSVDLEDYGCRETTVESLGEERGTVMYQRFEKLGMYCGSPRSTLKCEWSSNSSCTS  360

Query  514  ESEDEEG  534
            E E EEG
Sbjct  361  EDEKEEG  367



>ref|XP_010549939.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96871.1| hypothetical protein [Cleome spinosa]
Length=363

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 125/181 (69%), Gaps = 3/181 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K ASVF+KT S S   MT+ SGIR ILP S ICDF+FEPCGYSMN++E 
Sbjct  185  TLEMCMTGLDRKKASVFFKTESGSTTSMTEGSGIRKILPNSAICDFEFEPCGYSMNSVEG  244

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDGFSYASFE++GYD     L  +V RVL CF+P  FSVA+H++      
Sbjct  245  DAVSTIHVTPEDGFSYASFESVGYDLNAAELKGMVRRVLECFEPKQFSVAIHADMAEGVH  304

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGG  537
            G   ++D   YV  + + + LG   G+++Y  F    A+CGSPRS L C WS  ++++ G
Sbjct  305  GKAIDMD--DYVCVERTMEKLGEERGAVVYQGFERVAAACGSPRSILKCGWSSEDEKDEG  362

Query  538  I  540
            I
Sbjct  363  I  363



>gb|ADG57793.1| S-adenosyl-l-methionine decarboxylase 3-2 [Brassica napus]
Length=368

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE
Sbjct  181  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIE  240

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+     
Sbjct  241  GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANA  300

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  301  YKPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  360

Query  520  EDEE  531
            EDEE
Sbjct  361  EDEE  364



>gb|EPS67756.1| hypothetical protein M569_07018, partial [Genlisea aurea]
Length=411

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 131/182 (72%), Gaps = 5/182 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVF+K   +SAA MT  SGIR++LP S+ICDFDF+PCGYSMNAIE 
Sbjct  230  TLEMCMTNLDPKKASVFFKERCNSAAAMTDASGIRNVLPGSDICDFDFDPCGYSMNAIEG  289

Query  181  AAISTIHVTPEDGFSYASFEALGYDF-KTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
             AIST+HVTPEDGFSYASFEA GY F K L L+ LV  VLACF+PA FS++L S+  G+ 
Sbjct  290  GAISTVHVTPEDGFSYASFEAAGYGFGKQLDLSRLVGDVLACFEPAQFSLSLSSDVGGSG  349

Query  358  ---LGSVFNLDVRGYVSDDMSCKALGNGGSI-MYCSFTSSTASCGSPRSTLNCCWSESED  525
               L    N+DV GYV  ++S + +G GG   ++ SFTS     GSP S L C WSE+++
Sbjct  350  DELLDGGDNVDVEGYVGGELSREVVGKGGGWNIFRSFTSRRNRGGSPASILQCYWSETDE  409

Query  526  EE  531
            EE
Sbjct  410  EE  411



>ref|XP_010463654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
 ref|XP_010463655.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
Length=366

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A VFYK  S     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKALVFYKDESDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTIHVTPEDGFSYASFEAVGYDFNTMDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  300  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  523  DEE  531
            DE+
Sbjct  360  DEK  362



>dbj|BAP47514.1| S-adenosylmethionine decarboxylase [Gentiana triflora]
Length=363

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  SSSA++MT +SGIR ILP+SEICDF+F+PCGYSMN+IE 
Sbjct  184  TLEMCMTGLDRDKASVFYKNESSSASLMTCSSGIRKILPDSEICDFEFDPCGYSMNSIEG  243

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNS-TGAE  357
            +AISTIHVTPE+GFSYASFEA GYD +++ L +L+ERVL CF+P+DFSVA+ ++S  G  
Sbjct  244  SAISTIHVTPENGFSYASFEAAGYDLESVKLGSLIERVLDCFQPSDFSVAVRTDSAAGKS  303

Query  358  LGSVFNLDVRGYVSDDMSC-KALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
            +  + ++DV  Y   + S  +A+G G  I+Y  F  +   CGSPRS L  CW
Sbjct  304  VERICSIDVEAYHMGEKSVEEAVGGGSCIVYQKFVKAEY-CGSPRSILKGCW  354



>gb|ADD91750.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VF+K  S+ + +MT TSG+R+ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  182  TLEMCMTGLDREKAAVFFKNESNVSMLMTNTSGVRNILPKSHICDFEFEPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA GYD K ++L ALVERVL CF+P +FSV++H+   GAEL
Sbjct  242  DAVSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLGCFEPNEFSVSVHAQ-CGAEL  300

Query  361  -GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESE  522
               +   +++ Y   + S + LG GG+I Y  F  S  SCGSPRSTL C   E +
Sbjct  301  FEEICFPELKCYSGGERSVEELGAGGAITYQKFVRSV-SCGSPRSTLKCFRDEDD  354



>gb|ADF81048.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 128/169 (76%), Gaps = 3/169 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VF+K  S+ + +MT TSG+R+ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  182  TLEMCMTGLDREKAAVFFKNESNVSMLMTNTSGVRNILPKSHICDFEFEPCGYSMNSIEG  241

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA GYD K ++L ALVERVL CF+P +FSV++H+   GAEL
Sbjct  242  DAVSTIHITPEDGFSYASFEAAGYDLKAVNLGALVERVLGCFEPNEFSVSVHAQ-CGAEL  300

Query  361  -GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNC  504
               +   +++ Y   + S + LG GG+I Y  F  S  SCGSPRSTL C
Sbjct  301  FEEICFPELKCYSGGERSVEELGAGGAITYQKFVRSV-SCGSPRSTLKC  348



>ref|XP_006299023.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
 gb|EOA31921.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
Length=426

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 128/183 (70%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  240  TLEMCMTGLDREKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  299

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  300  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHSSVGCNAY  359

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  360  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  419

Query  523  DEE  531
            DE+
Sbjct  420  DEK  422



>ref|XP_010528023.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Tarenaya 
hassleriana]
Length=367

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 126/177 (71%), Gaps = 9/177 (5%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLE+CMTGLD + ASVFYK HS SAA MT  SGIR  LP SEICDF+F+PCGYSMN++E 
Sbjct  181  TLEICMTGLDREKASVFYKCHSGSAAEMTIGSGIRKFLPGSEICDFEFDPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIHVTPEDG SYASFE +GYD K L+LN LV +VL CFKP  FS+A+H++  GAEL
Sbjct  241  DAVSTIHVTPEDGLSYASFETVGYDLKNLNLNELVNKVLICFKPGGFSIAVHAD-LGAEL  299

Query  361  GSV-------FNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
                       ++DV+GY S +   + L  GGS++Y  F  S   C +P+STL CCW
Sbjct  300  LKQDCDFEFDPSVDVKGYCSKERCLEELELGGSVVYQKFVKS-GECDTPKSTLACCW  355



>ref|XP_010453744.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Camelina sativa]
Length=364

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD   ASVFYK  SSSA  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE+
Sbjct  181  TLEMCMTALDKDKASVFYKNESSSAGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIED  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPE GFSYASFEA+GYDF T+ L+ LV +VL CF+P  FSVA+H +      
Sbjct  241  DAISTIHVTPEAGFSYASFEAVGYDFTTMDLSHLVSKVLTCFEPKQFSVAVHCSVAQMGY  300

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW  510
             S  ++D+  Y   ++  ++LG   G++MY  F      CGSPRSTL C W
Sbjct  301  NSGLSVDLDDYGCSELIMESLGEERGTVMYQRFEKLGKYCGSPRSTLKCEW  351



>emb|CDX74257.1| BnaA03g27900D [Brassica napus]
Length=368

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE
Sbjct  181  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIE  240

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+     
Sbjct  241  GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNA  300

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  301  YKPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  360

Query  520  EDEE  531
            EDE+
Sbjct  361  EDEK  364



>emb|CDY71278.1| BnaAnng36830D [Brassica napus]
Length=363

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 129/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK   + +  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDREKASVFYKNGETGS--MTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  236

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  237  DAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  296

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  297  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  356

Query  523  DEE  531
            DE+
Sbjct  357  DEK  359



>sp|Q9SDM8.1|DCAM3_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 3; 
Short=AdoMetDC 3; Short=SAMDC 3; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 3 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 3 beta chain; 
Flags: Precursor [Brassica juncea]
 gb|AAF20160.1|AF215665_1 S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=367

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN++E
Sbjct  180  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVE  239

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+     
Sbjct  240  GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNA  299

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  300  YKPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  359

Query  520  EDEE  531
            EDE+
Sbjct  360  EDEK  363



>gb|AAB17665.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A+VFYK  +     MT  SGIR  LP+SEICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKAAVFYKDEADKTGSMTDNSGIRKNLPKSEICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AIST HVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  240  DAISTNHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLSCFEPKQFSVAVHSSVGANSY  299

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                 +D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  300  KPEITVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  359

Query  523  DEE  531
            DE+
Sbjct  360  DEK  362



>ref|XP_009134671.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3 [Brassica 
rapa]
Length=368

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 128/184 (70%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN++E
Sbjct  181  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVE  240

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL+CF+P  FSVA+HS+     
Sbjct  241  GDAISTIHVTPEDGFSYASFEAVGYDFSTLDLSQLVTRVLSCFEPKQFSVAVHSSVGSNA  300

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  301  YKPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  360

Query  520  EDEE  531
            EDE+
Sbjct  361  EDEK  364



>ref|XP_009118044.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=363

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK   + +  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDREKASVFYKNGETGS--MTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  236

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  237  DAISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  296

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  297  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSE  356

Query  523  DEE  531
            DE+
Sbjct  357  DEK  359



>emb|CDX91992.1| BnaC03g32940D [Brassica napus]
Length=367

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN++E
Sbjct  180  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSVE  239

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL CF+P  FSVA+HS+     
Sbjct  240  GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLCCFEPKQFSVAVHSSVGANA  299

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + + LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  300  YKPEISVDLEDYGCRERTFETLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  359

Query  520  EDEE  531
            EDE+
Sbjct  360  EDEK  363



>gb|KEH21806.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=385

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 123/162 (76%), Gaps = 2/162 (1%)
 Frame = +1

Query  28   DSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEAAISTIHVT  207
            + + ASVF+KT  SSAA MT+ SGIR ILP+S+ICDF+FEPCGYSMN IE +AISTIHVT
Sbjct  215  NKEKASVFFKTDKSSAASMTENSGIRKILPKSDICDFEFEPCGYSMNGIEGSAISTIHVT  274

Query  208  PEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELGSVFNLDVR  387
            PEDGFSYASFEA+GY F+  SLN LV RVLACF PA+FSVALH ++ G +L   F ++V+
Sbjct  275  PEDGFSYASFEAVGYSFEEKSLNELVGRVLACFYPAEFSVALHIDTNGEKLDK-FPVEVK  333

Query  388  GYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWS  513
            GY   +   + LG  G+++Y +F  +   C SPRSTL CCWS
Sbjct  334  GYSCGERINEVLGEDGAVVYRTFVRNDG-CSSPRSTLKCCWS  374



>emb|CDY71710.1| BnaAnng38530D [Brassica napus]
Length=429

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 129/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK   + +  MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  245  TLEMCMTGLDREKASVFYKNGETGS--MTDNSGIRKILPQSQICDFEFEPCGYSMNSIEG  302

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  303  DAISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  362

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ESE  522
                ++D+  Y   + + ++LG   G++MY +F      CGSPRSTL C WS      SE
Sbjct  363  KPEISVDLEDYGCRERTFESLGEESGTVMYQTFEKLGKYCGSPRSTLKCGWSSNNSCSSE  422

Query  523  DEE  531
            DE+
Sbjct  423  DEK  425



>gb|ADG57791.1| S-adenosyl-l-methionine decarboxylase 3-1 [Brassica napus]
Length=367

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 7/184 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSA-AVMTQTSGIRDILPESEICDFDFEPCGYSMNAIE  177
            TLEMCMTGLD + ASVFYK  +      MT  SGIR ILP+S+ICDF+FEPCGYSMN++E
Sbjct  180  TLEMCMTGLDKEKASVFYKNETGGENGSMTDNSGIRRILPKSQICDFEFEPCGYSMNSVE  239

Query  178  EAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE  357
              AISTIHVTPEDGFSYASFEA+GYDF TL L+ LV RVL CF+P  FSVA+HS+     
Sbjct  240  GDAISTIHVTPEDGFSYASFEAVGYDFNTLDLSQLVTRVLCCFEPKQFSVAVHSSVGANA  299

Query  358  LGSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCWS-----ES  519
                 ++D+  Y   + + + LG   G++MY +F      CGSPRSTL C WS      S
Sbjct  300  YEPEISVDLEDYGCRERTFETLGEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSS  359

Query  520  EDEE  531
            EDE+
Sbjct  360  EDEK  363



>ref|XP_010525150.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96954.1| hypothetical protein [Cleome spinosa]
Length=365

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD K A+VFYKT SSSA  MT+ SGIR ILP S ICDF+FEPCGYSMN+IE 
Sbjct  185  TLEMCMTGLDRKKAAVFYKTESSSALSMTEESGIRKILPNSAICDFEFEPCGYSMNSIEG  244

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAE-  357
             AISTIHVTPEDGFSYASFEA+GYDFK + ++ +V RV+ CF+P  FSVA+H+++   E 
Sbjct  245  EAISTIHVTPEDGFSYASFEAVGYDFKAMDVSGMVRRVIDCFEPKQFSVAIHADTVEEED  304

Query  358  --LGSVFNLDVRG-YVSDDMSCKALG--NGGSIMYCSFTSSTASCGSPRSTLNCCWSESE  522
              +  +  ++  G Y   + + + LG    G+++Y  F  +    GSPRS L C WS SE
Sbjct  305  MMMMMITGIEEDGDYGCRERTVQKLGEEERGAVLYYGFDRTN---GSPRSILKCGWS-SE  360

Query  523  DEE  531
            DE+
Sbjct  361  DEK  363



>ref|XP_009147351.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=364

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 11/187 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDREKASVFYK--NGETGTMTDNSGIRKILPKSHICDFEFEPCGYSMNSIEG  236

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  237  DAISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  296

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW--------S  513
                ++D+  Y   + + ++LG   G +MY +F      CGSPRSTL C W        S
Sbjct  297  KPEISVDLDDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEWSSNNSSCSS  356

Query  514  ESEDEEG  534
            E E +EG
Sbjct  357  EDEKDEG  363



>emb|CDY57536.1| BnaA05g33510D [Brassica napus]
Length=364

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 11/187 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S ICDF+FEPCGYSMN+IE 
Sbjct  179  TLEMCMTGLDREKASVFYK--NGETGTMTDNSGIRKILPKSHICDFEFEPCGYSMNSIEG  236

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS+      
Sbjct  237  DAISTIHVTPEDGFSYASFEAVGYDFNTMDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAY  296

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW--------S  513
                ++D+  Y   + + ++LG   G +MY +F      CGSPRSTL C W        S
Sbjct  297  KPEISVDLDDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEWSSNNSSCSS  356

Query  514  ESEDEEG  534
            E E +EG
Sbjct  357  EDEKDEG  363



>gb|KEH20218.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=370

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  SSSA +MT  SGIR+ILP+SEI DFDF+PCGYSMN++E 
Sbjct  181  TLEMCMTGLDKEKASVFYKEQSSSAFLMTANSGIRNILPDSEISDFDFDPCGYSMNSVEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AA+STIHVTPEDGFSYASFE   Y+ + ++LN LVERVL CF+P +F +A+H +      
Sbjct  241  AAVSTIHVTPEDGFSYASFETCEYNLELMNLNQLVERVLTCFQPNEFMIAVHVDVASNSF  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSE  516
                 L+V+GY  ++   + LG GG + +  F   T+ CGS  STL  CW E
Sbjct  301  EQNCLLNVKGYCREEKCYQELGRGGCVAFQKFI-KTSDCGSSFSTLQ-CWKE  350



>ref|XP_010044331.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Eucalyptus 
grandis]
 gb|KCW86415.1| hypothetical protein EUGRSUZ_B03086 [Eucalyptus grandis]
Length=348

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+E+CMTGL+ +S+SVF+K  S SAA MT  SGIR ILP SEIC F FEPCGYSMNAIE 
Sbjct  181  TMEICMTGLNKESSSVFFKFQSGSAAAMTINSGIRKILPNSEICAFGFEPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            +A STIHVTPEDGFSYASFEA+GYD K ++ N L+ RVLACF+P +FSVA+H+N     L
Sbjct  241  SATSTIHVTPEDGFSYASFEAVGYDPKDINYNQLIGRVLACFRPKEFSVAVHANVAAKSL  300

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFT  459
                +L+V+GY S +   + LG GGSIMY  F 
Sbjct  301  EQNCSLNVKGYCSGERCLEELGAGGSIMYQRFV  333



>ref|XP_010430714.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Camelina sativa]
Length=320

 Score =   193 bits (490),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 1/167 (1%)
 Frame = +1

Query  10   MCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEAAI  189
              + GLD+     ++   +SSA  MT +SGIR+ILP SEICDFDFEPCGYSMN+IEE A+
Sbjct  145  FVLGGLDNNPQRGWHVYSASSAYEMTISSGIRNILPGSEICDFDFEPCGYSMNSIEEDAV  204

Query  190  STIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELGSV  369
            STIHVTPEDGFSYASFE +GYD K L+   LV+RVL CF P +FSVA+H+N     L   
Sbjct  205  STIHVTPEDGFSYASFETVGYDLKGLNFRELVDRVLVCFGPEEFSVAVHANLGTELLARD  264

Query  370  FNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW  510
              +DV+GY+S ++  + LG GGS++Y  F   T  CGSP+STL  CW
Sbjct  265  CVVDVKGYLSQEIGLEELGLGGSVLYQKFV-KTVECGSPKSTLGFCW  310



>emb|CDX70666.1| BnaC03g07500D [Brassica napus]
Length=363

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   AS+FYK  SS    MT  SGIR ILP+S+ICDF+FEPCGYSMN++E+
Sbjct  180  TLEMCMTGLDKDKASMFYKNESS---FMTDNSGIRKILPQSQICDFEFEPCGYSMNSVED  236

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL CF+   FSVA++S+      
Sbjct  237  EAISTIHVTPEDGFSYASFEAVGYDFTTMHLSLLVSRVLTCFEAKQFSVAIYSSIAQKSY  296

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW-------SE  516
                 +++  Y   + + ++LG   G++MY +F      CGSPRSTL C W       SE
Sbjct  297  YKGLCVELDDYGCRETTMESLGEERGTVMYQTFEKLGRYCGSPRSTLKCEWSSNSSCTSE  356

Query  517  SEDEEG  534
             + EEG
Sbjct  357  DDKEEG  362



>emb|CDY43235.1| BnaC05g48280D [Brassica napus]
Length=463

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 125/187 (67%), Gaps = 11/187 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  278  TLEMCMTGLDREKASVFYK--NGETGTMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  335

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             AISTIHVTPEDGFSYASFEA+GYD  T+ L+ LV RVL+CF+P   SVA+HS+      
Sbjct  336  DAISTIHVTPEDGFSYASFEAVGYDLNTMDLSQLVTRVLSCFEPKQLSVAVHSSVGVNAY  395

Query  361  GSVFNLDVRGYVSDDMSCKALG-NGGSIMYCSFTSSTASCGSPRSTLNCCW--------S  513
                ++D+  Y   + + ++LG   G +MY +F      CGSPRSTL C W        S
Sbjct  396  KPEISVDLEDYGCRERTFESLGEESGMVMYQTFEKLGKYCGSPRSTLKCEWSSNNSSCSS  455

Query  514  ESEDEEG  534
            E E +EG
Sbjct  456  EDEKDEG  462



>gb|AAR00210.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=312

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + A +FY+  S+SAA+MT  SGIR ILP S+ICDFDFEPCGYSMN++E 
Sbjct  168  TLEMCMTGLDREKAQIFYREQSASAAIMTVNSGIRKILPMSDICDFDFEPCGYSMNSVEG  227

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFE +GYDFK L+LNALV+RVL+CF P +FSVA+  +      
Sbjct  228  DAVSTIHITPEDGFSYASFETVGYDFKVLNLNALVDRVLSCFLPDEFSVAVRVDGASKPS  287

Query  361  GSVFNLDVRGYVSDDMSCKALGNGG  435
              +  +DV+GY  ++   + LG GG
Sbjct  288  EQMCFVDVKGYCREEWIHEGLGMGG  312



>sp|Q39676.1|DCAM1_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC 1; Short=SAMDC 1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 1 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09839.1| S-adenosylmethionine decarboxylase 1 [Dianthus caryophyllus]
 gb|AAB70461.1| S-adenosylmethionine decarboxylase [Dianthus caryophyllus]
Length=381

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 127/177 (72%), Gaps = 1/177 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVF+K+ S+SAAVMT+TSGIR ILP+S ICDFDFEPCGYSMNAIE 
Sbjct  202  TLEMCMTGLDKGKASVFFKSESASAAVMTETSGIRKILPDSAICDFDFEPCGYSMNAIEG  261

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
             A+STIH+TPEDGFSYASFEA+GYD K + +N LVERVL CF+P +FS+A+  ++    L
Sbjct  262  PAVSTIHITPEDGFSYASFEAVGYDLKIVDVNQLVERVLNCFQPREFSIAVSVDTADKVL  321

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
                 ++V GY  ++   + LG GGS++Y  F       G  +S   CC  E E++E
Sbjct  322  EQYCAVNVAGYCREEGGVEGLGVGGSVLYQKFGKVATVSGLNKSP-KCCRKEEENDE  377



>gb|ABK25576.1| unknown [Picea sitchensis]
Length=373

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 126/187 (67%), Gaps = 8/187 (4%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVFYK  S SA  MT  SGI DILPES+ICDF F+PCGYSMNA+E 
Sbjct  180  TLEMCMTELDHKQASVFYKDTSKSAVEMTLNSGISDILPESKICDFQFDPCGYSMNALEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALH---SNSTG  351
            AAISTIHVTPEDGFSYASFEA+GY+ K   L ALVERVL+CF+P  FS+++H    N   
Sbjct  240  AAISTIHVTPEDGFSYASFEAMGYNPKDCDLEALVERVLSCFRPMVFSISVHVSVDNGRS  299

Query  352  AELGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEE  531
            +    VF    +GY+ D  S +AL    S++Y ++  +T    SPRSTL     E E EE
Sbjct  300  SWTKPVFP---QGYICDMTSHEALTGKSSVVYHTYRMATDE--SPRSTLPLLAWEEEGEE  354

Query  532  GGIRNTT  552
             G  + T
Sbjct  355  NGCLHLT  361



>ref|XP_009418028.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Musa 
acuminata subsp. malaccensis]
Length=389

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCM GLD K A+VFY     +A+ MT  SGI DILP S+IC+F F+PCGYSMN++E 
Sbjct  213  TLEMCMMGLDRKRAAVFYGKQHYTASEMTIASGISDILPGSQICEFQFDPCGYSMNSVEG  272

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA+GYD + + L  L+ RVLACF+PA+FS+A+ ++  G E 
Sbjct  273  AAISTIHVTPEDGFSYASFEAMGYDAEVIDLGRLITRVLACFRPAEFSIAVETDGVGEES  332

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGGI  540
                 LDV GYVS +   K +G  GS++Y SF +    C SP S L   W + +     +
Sbjct  333  PRGAALDVSGYVSGERRFKEMGR-GSVVYQSFKA--CDCESPTSILKNLWDDMDPHRSNL  389



>gb|ABR17745.1| unknown [Picea sitchensis]
Length=384

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 124/184 (67%), Gaps = 2/184 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVFYK  S SA  MT  SGI DILPES+ICDF F+PCGYSMNA+E 
Sbjct  191  TLEMCMTELDHKQASVFYKDTSKSAVEMTLNSGISDILPESKICDFQFDPCGYSMNALEG  250

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDGFSYASFEA+GY+ K   L ALVERVL+CF+P  FS+++H +      
Sbjct  251  AAISTIHVTPEDGFSYASFEAMGYNPKDCDLEALVERVLSCFRPMVFSISVHVSVDNGRS  310

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGGI  540
                 +  +GY+ D  S +AL    S++Y ++  +T    SPRSTL     E E EE G 
Sbjct  311  SWTKPVFPQGYICDMTSHEALTGKSSVVYHTYRMATDE--SPRSTLPLLAWEEEGEENGC  368

Query  541  RNTT  552
             + T
Sbjct  369  LHLT  372



>ref|XP_010261810.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme [Nelumbo nucifera]
Length=347

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 123/176 (70%), Gaps = 19/176 (11%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMC TGLD K AS+FYKT +SSAA MT  SGIR ILP+SEICDF+FEPCGYSMNAIE 
Sbjct  181  TLEMCRTGLDKKLASIFYKTGASSAAKMTDMSGIRKILPDSEICDFEFEPCGYSMNAIEG  240

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            A++STIHVTPEDGFSYASFEA+GYD K ++L+ LV+ V+                   E+
Sbjct  241  ASVSTIHVTPEDGFSYASFEAVGYDLKAVNLSQLVDGVI------------------KEV  282

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDE  528
            G  F LDV GY   + + ++L  GG+++Y SFT +  +C SP+S+L  C  E ED+
Sbjct  283  GWEFPLDVLGYRHGEKTYQSLAIGGAVVYQSFTWA-GNCWSPKSSLKSCGKEEEDK  337



>emb|CAJ42877.1| S-adenosyl methionine decarboxylase [Plantago major]
Length=269

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMCMT LD + ASVFYK  SSSAA MT  SGI  ILP+S ICDF+F+PCGYSMNAIEE
Sbjct  109  TVEMCMTDLDREKASVFYKNESSSAARMTNESGICKILPDSHICDFEFDPCGYSMNAIEE  168

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIH+TPEDGFSYASFEA GY+F +++L  L+ERVLACF+P +FSV++HS      L
Sbjct  169  AAISTIHITPEDGFSYASFEASGYNFNSVNLGLLMERVLACFEPKEFSVSVHSEFGAKFL  228

Query  361  GSVFNLDVRGYVSDDMSCKALGNGG  435
                  +++GY  D+ S + LG GG
Sbjct  229  NDAHCFNLKGYSMDEKSYEDLGMGG  253



>dbj|BAF91878.1| S-adenosylmethionine decarboxylase [Nicotiana benthamiana]
Length=296

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFY+T  SS+A MT  SGIR ILP SEICDF+FEPCGYSMN+IE 
Sbjct  180  TLEMCMTGLDREKASVFYRTEGSSSAHMTVQSGIRKILPNSEICDFEFEPCGYSMNSIEG  239

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSN  342
            AA+STIH+TPEDGFSYASFEA+GYD KT+ L  LVERVLACF+P +FS+ALH++
Sbjct  240  AALSTIHITPEDGFSYASFEAVGYDMKTMKLGPLVERVLACFEPDEFSIALHAD  293



>ref|XP_009401295.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 133/192 (69%), Gaps = 14/192 (7%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLD++ AS+F+K     H+SSA  MT+ SGI DI+PE EICDFDFEPCGYSMN
Sbjct  188  TLEMCMTGLDAERASIFFKNSVDGHNSSANEMTKLSGISDIIPEMEICDFDFEPCGYSMN  247

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
             I   A+STIHVTPEDGFSYAS+EA+G++  +L  + LVERVL CF P++FSVA+ +   
Sbjct  248  GIHGPALSTIHVTPEDGFSYASYEAMGFNPHSLKYHDLVERVLRCFGPSEFSVAV-TIFG  306

Query  349  GAELGSVF--NLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW----  510
            G  L + +   +D+ GY  +DM  + L   G ++Y +F +STA+  SPRS L+  W    
Sbjct  307  GRGLAATWAKKVDLHGYACNDMVEQELPGDGLLVYQTFAASTATAESPRSILH-HWEGVT  365

Query  511  --SESEDEEGGI  540
              +  +D +GG+
Sbjct  366  LENAGKDGKGGV  377



>gb|ABU55003.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=319

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +1

Query  4    LEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEEA  183
            LEMCMTGLD + ASVF+K ++SSAA MT+ SGIR ILP+S+ICDF+F+PCGYSMN IE  
Sbjct  178  LEMCMTGLDKECASVFFKENTSSAASMTENSGIRYILPQSDICDFEFDPCGYSMNGIEGN  237

Query  184  AISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAELG  363
            AISTIHVTP DGFSYASFEA+GYD    +L  LV+RVLACF+PA+FSVALH +  G E+ 
Sbjct  238  AISTIHVTPGDGFSYASFEAVGYDXDDKTLCELVDRVLACFRPAEFSVALHIDMHG-EML  296

Query  364  SVFNLDVRGYVSDDMSCKALGNG  432
              F LD++GY   + S + LG G
Sbjct  297  DKFPLDIKGYCCGERSFEELGMG  319



>ref|XP_009403328.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Musa acuminata subsp. malaccensis]
Length=376

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 125/182 (69%), Gaps = 13/182 (7%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLD + AS+F+K     H SSA  MT+ SGI DI+PE EICDFDFEPCGYSMN
Sbjct  188  TLEMCMTGLDPERASIFFKNSVDGHVSSAKEMTKLSGISDIIPEMEICDFDFEPCGYSMN  247

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVA---LHS  339
             +   A ST+HVTPEDGFSYAS+EA+G++  +LS + L+ERVL+CF P++FSVA   L  
Sbjct  248  GMHGPAFSTVHVTPEDGFSYASYEAMGFNPDSLSYHDLIERVLSCFGPSEFSVATTVLGG  307

Query  340  NSTGAELGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSES  519
             ST A       +D+ GY  D+M  + L  GG ++Y +F +S+ +  SPRS LN  W   
Sbjct  308  GSTWAN-----KVDIYGYSCDNMVEQELPGGGLLVYQTFAASSVTPMSPRSILN-NWQGK  361

Query  520  ED  525
            +D
Sbjct  362  DD  363



>gb|ADQ37302.1| putative S-adenosyl methionine decarboxylase [Pinus sylvestris]
Length=386

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMT LD K ASVFYK  S+SA  +T  SGI DILPES+ICDF F+PCGYSMNA+E 
Sbjct  191  TLEMCMTQLDRKQASVFYKDTSNSAMEITLNSGISDILPESKICDFQFDPCGYSMNALEG  250

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTGAEL  360
            AAISTIHVTPEDG SYASFEA+GY+ K   L ALVERVL+CF+P  FS+++H++      
Sbjct  251  AAISTIHVTPEDGSSYASFEAMGYNPKDCDLEALVERVLSCFRPMVFSISVHASVGNGHS  310

Query  361  GSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESEDEEGGI  540
                 +  +GY+ D  S + L    S++Y ++  +T    SPRSTL     E E EE G 
Sbjct  311  SWTRPVWPQGYICDMTSDQGLTGKSSVVYHTYRMATNE--SPRSTLPLLAWEEESEENGC  368

Query  541  RNTT  552
               T
Sbjct  369  LQLT  372



>ref|XP_009401296.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=439

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 133/192 (69%), Gaps = 14/192 (7%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLD++ AS+F+K     H+SSA  MT+ SGI DI+PE EICDFDFEPCGYSMN
Sbjct  231  TLEMCMTGLDAERASIFFKNSVDGHNSSANEMTKLSGISDIIPEMEICDFDFEPCGYSMN  290

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
             I   A+STIHVTPEDGFSYAS+EA+G++  +L  + LVERVL CF P++FSVA+ +   
Sbjct  291  GIHGPALSTIHVTPEDGFSYASYEAMGFNPHSLKYHDLVERVLRCFGPSEFSVAV-TIFG  349

Query  349  GAELGSVF--NLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCW----  510
            G  L + +   +D+ GY  +DM  + L   G ++Y +F +STA+  SPRS L+  W    
Sbjct  350  GRGLAATWAKKVDLHGYACNDMVEQELPGDGLLVYQTFAASTATAESPRSILH-HWEGVT  408

Query  511  --SESEDEEGGI  540
              +  +D +GG+
Sbjct  409  LENAGKDGKGGV  420



>ref|NP_001047404.1| Os02g0611200 [Oryza sativa Japonica Group]
 emb|CAB64600.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19232.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19677.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAF09318.1| Os02g0611200 [Oryza sativa Japonica Group]
 gb|AFI71861.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
 gb|AGH17542.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
Length=395

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLD K ASVF+KT    H++ A  MT+ SGI DI+PE E+CDFDFEPCGYSMN
Sbjct  186  TLEMCMTGLDKKKASVFFKTSADGHTTYAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMN  245

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI   A STIHVTPEDGFSYAS+E +G++  +L+   LV+RVL CF P +FSVA+     
Sbjct  246  AIHGPAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPLEFSVAVTIFGG  305

Query  349  GAELGS-VFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSST-ASCGSPRSTLNCCWSESE  522
                G+    LDV  Y   +M  + L +GG ++Y SFT++   + GSPRS L+C   E+ 
Sbjct  306  RNHAGTWAKGLDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENT  365

Query  523  DEEGGI  540
            ++ G +
Sbjct  366  EKAGKM  371



>gb|KDO70175.1| hypothetical protein CISIN_1g0194112mg, partial [Citrus sinensis]
Length=312

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            T+EMC+TGLD + ASVFYKT S SA  MT  SGIR ILP+S+ICDF+F+PCGYSMN++E 
Sbjct  186  TIEMCLTGLDREMASVFYKTQSGSAGAMTVNSGIRKILPDSKICDFEFDPCGYSMNSVEG  245

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNSTG  351
            AAIST+HVTPEDGFSYASFE +GYD   ++LN LVERVLACF+P DFS+A+H+   G
Sbjct  246  AAISTVHVTPEDGFSYASFETVGYDPNDVNLNQLVERVLACFQPRDFSIAVHAEVAG  302



>gb|AGR89928.1| S-adenosyl-L-methionine decarboxylase [Dendrobium catenatum]
Length=368

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 123/183 (67%), Gaps = 9/183 (5%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            T+EMCMTGL S+ AS+F+K     H SSA  MT+ SGIRDI+PE +ICDF+F+PCGYSMN
Sbjct  178  TVEMCMTGLSSERASIFFKNSVLGHESSAKEMTKRSGIRDIIPEMKICDFEFDPCGYSMN  237

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
             I   A+STIHVTPEDGFSYAS+EA+G++   +S   L+ERVL CF+P +FSVA+ +   
Sbjct  238  GINNQALSTIHVTPEDGFSYASYEAMGFEPSAISYRHLIERVLRCFEPVNFSVAV-TIFG  296

Query  349  GAELGSVFNLD--VRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESE  522
            G      +     V GY   D+  + L  GG ++Y SF +ST    SPRS L C   E+E
Sbjct  297  GRPFACSYGQKVCVDGYNCKDLVQQELSGGGLLLYQSFKASTDGSASPRSILYC--REAE  354

Query  523  DEE  531
            DEE
Sbjct  355  DEE  357



>gb|EMS62883.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=388

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 132/209 (63%), Gaps = 28/209 (13%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
             LEMCMTGLD K ASVF+KT    H+S A  MT+ SGI +I+PE EICDFDFEPCGYSMN
Sbjct  177  NLEMCMTGLDKKKASVFFKTSADGHTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMN  236

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI  +A STIHVTPEDGFSYAS+E +G D  +++   LV+RVL  F P++FSVA+ +   
Sbjct  237  AIHGSAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAV-TIFG  295

Query  349  GAELGSVF--NLDVRGYVSDDMSCKALGNGGSIMYCSFTS-STASCGSPRSTLNC-----  504
            G  L   +   L+V  Y S +M  + L +GG+++Y SFT+    S GSPRS LNC     
Sbjct  296  GRNLAGTWGERLNVGVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNCNVHGN  355

Query  505  -----------CW----SESEDEEGGIRN  546
                       CW    ++ +DE G ++ 
Sbjct  356  LESGSKMDAFLCWEDDAAQEKDERGAVKR  384



>gb|EEE57355.1| hypothetical protein OsJ_07492 [Oryza sativa Japonica Group]
Length=466

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 6/186 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLD K ASVF+KT    H++ A  MT+ SGI DI+PE E+CDFDFEPCGYSMN
Sbjct  257  TLEMCMTGLDKKKASVFFKTSADGHTTYAKEMTKLSGISDIIPEMEVCDFDFEPCGYSMN  316

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI   A STIHVTPEDGFSYAS+E +G++  +L+   LV+RVL CF P +FSVA+     
Sbjct  317  AIHGPAFSTIHVTPEDGFSYASYEVMGFNPASLAYGDLVKRVLRCFGPLEFSVAVTIFGG  376

Query  349  GAELGS-VFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSST-ASCGSPRSTLNCCWSESE  522
                G+    LDV  Y   +M  + L +GG ++Y SFT++   + GSPRS L+C   E+ 
Sbjct  377  RNHAGTWAKGLDVGAYSCSNMVEQELPSGGLLIYQSFTATAEIATGSPRSVLHCFADENT  436

Query  523  DEEGGI  540
            ++ G +
Sbjct  437  EKAGKM  442



>gb|AEN81738.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81739.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81740.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81741.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81742.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81743.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81744.1| AT3G02470-like protein, partial [Capsella rubella]
 gb|AEN81745.1| AT3G02470-like protein, partial [Capsella rubella]
Length=206

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDREKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>gb|ADG38371.1| AT3G02470-like protein [Capsella grandiflora]
Length=206

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDREKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>gb|ADG38370.1| AT3G02470-like protein [Capsella grandiflora]
Length=206

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD + ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDREKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFXTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>dbj|BAK00199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 119/176 (68%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
             LEMCMTGLD K ASVF+KT    H+S A  MT+ SGI DI+PE EICDFDFEPCGYSMN
Sbjct  177  NLEMCMTGLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMN  236

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS---  339
            AI  +A STIHVTPEDGFSY S+E +G D  +++   LV+RVL  F P++FSVA+     
Sbjct  237  AIHGSAFSTIHVTPEDGFSYGSYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAVTIFGC  296

Query  340  NSTGAELGSVFNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTA-SCGSPRSTLNC  504
             S     G   N+ V  Y S +M  + L  GGS++Y SFT++   S GSPRS LNC
Sbjct  297  PSLAGTWGERLNVGV--YDSTNMVVQELPGGGSLIYQSFTAAGEDSSGSPRSVLNC  350



>gb|ADE92938.1| S-adenosylmethionine decarboxylase [Triticum aestivum]
Length=388

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 131/209 (63%), Gaps = 28/209 (13%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
             LEMCMTGLD K ASVF+KT    H+S A  MT+ SGI DI+PE EICDFDFEPCGYSMN
Sbjct  177  NLEMCMTGLDKKKASVFFKTSADGHTSCAKEMTKLSGISDIIPEMEICDFDFEPCGYSMN  236

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI  +A STIHVTPEDGFSYAS+E +G D  +++   LV+RVL  F P++FSVA+ +   
Sbjct  237  AIHGSAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAV-TIFG  295

Query  349  GAELGSVF--NLDVRGYVSDDMSCKALGNGGSIMYCSFTS-STASCGSPRSTLNC-----  504
            G  L   +   L+V  Y S +M  + L +GG+++Y SFT+    S GSPRS  NC     
Sbjct  296  GRNLAGTWGERLNVGVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVPNCNVHGN  355

Query  505  -----------CW----SESEDEEGGIRN  546
                       CW    ++ +DE G ++ 
Sbjct  356  LESGSKMDAFLCWEDDAAQEKDERGAVKR  384



>gb|ADG38369.1| AT3G02470-like protein [Capsella grandiflora]
Length=206

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDRDKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>gb|ADG38368.1| AT3G02470-like protein [Capsella grandiflora]
Length=206

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDRXKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>gb|ADG38367.1| AT3G02470-like protein [Capsella grandiflora]
Length=206

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKTHSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMNAIEE  180
            TLEMCMTGLD   ASVFYK  +     MT  SGIR ILP+S+ICDF+FEPCGYSMN+IE 
Sbjct  93   TLEMCMTGLDRXKASVFYKDETDKTGSMTDNSGIRKILPKSQICDFEFEPCGYSMNSIEG  152

Query  181  AAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHS  339
             AISTIHVTPEDGFSYASFEA+GYDF T+ L+ LV RVL+CF+P  FSVA+HS
Sbjct  153  DAISTIHVTPEDGFSYASFEAVGYDFSTMDLSQLVTRVLSCFEPKQFSVAVHS  205



>gb|AAO43186.1| S-adenosylmethionine decarboxylase [Narcissus pseudonarcissus]
Length=370

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 123/182 (68%), Gaps = 6/182 (3%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
            TLEMCMTGLDS+ AS+F+ +    +++ +  MT+ SGI +I+PE EICDF+FEPCGYSMN
Sbjct  180  TLEMCMTGLDSEKASIFFNSPGNANNAQSKKMTKLSGISNIIPEMEICDFEFEPCGYSMN  239

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI  +A STIHVTPEDG SYAS+EA+G++   L    LVERVL CF PADFSVA+     
Sbjct  240  AICGSAHSTIHVTPEDGSSYASYEAMGFNPAELDFGGLVERVLECFGPADFSVAVTIFGG  299

Query  349  GAELGSV-FNLDVRGYVSDDMSCKALGNGGSIMYCSFTSSTASCGSPRSTLNCCWSESED  525
              + GS    +D  G+   D+  + L  GG +MY SFT+     GSPRSTL+ CW   E 
Sbjct  300  RGQAGSWGREVDSYGFRCVDLVEQELAGGGLLMYQSFTAGVGRMGSPRSTLH-CWDGEEI  358

Query  526  EE  531
            EE
Sbjct  359  EE  360



>gb|AHJ14567.1| S-adenosyl methionine decarboxylase 1 [Triticum aestivum]
Length=388

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 132/209 (63%), Gaps = 28/209 (13%)
 Frame = +1

Query  1    TLEMCMTGLDSKSASVFYKT----HSSSAAVMTQTSGIRDILPESEICDFDFEPCGYSMN  168
             LEMCMTGLD K ASVF+KT    ++S A  MT+ SGI +I+PE EICDFDFEPCGYSMN
Sbjct  177  NLEMCMTGLDKKKASVFFKTSADGYTSCAKEMTKLSGISEIIPEMEICDFDFEPCGYSMN  236

Query  169  AIEEAAISTIHVTPEDGFSYASFEALGYDFKTLSLNALVERVLACFKPADFSVALHSNST  348
            AI  +A STIHVTPEDGFSYAS+E +G D  +++   LV+RVL  F P++FSVA+ +   
Sbjct  237  AIHGSAFSTIHVTPEDGFSYASYEVMGLDPASMAYGDLVKRVLRSFGPSEFSVAV-TIFG  295

Query  349  GAELGSVF--NLDVRGYVSDDMSCKALGNGGSIMYCSFTS-STASCGSPRSTLNC-----  504
            G  L   +   L+V  Y S +M  + L +GG+++Y SFT+    S GSPRS LNC     
Sbjct  296  GRNLAGTWGERLNVEVYDSTNMVVQELPDGGALIYQSFTAVGEDSTGSPRSVLNCNVHGN  355

Query  505  -----------CW----SESEDEEGGIRN  546
                       CW    ++ +DE G ++ 
Sbjct  356  LESGSKMDAFLCWEDDAAQEKDERGAVKR  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1371696120284