BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4769_g1_i1 len=752 path=[2294:0-751]

Length=752
                                                                      Score     E

sp|Q96471.1|DCAM_IPONI  RecName: Full=S-adenosylmethionine decarb...    317   2e-103   Ipomoea nil [qian niu]
sp|Q9M6K1.1|DCAM_IPOBA  RecName: Full=S-adenosylmethionine decarb...    309   1e-100   Ipomoea batatas [batate]
gb|EYU28926.1|  hypothetical protein MIMGU_mgv1a008898mg                308   2e-100   
emb|CAD20741.1|  S-adenosyl-L-methionine decarboxylase                  301   2e-99    Vitis vinifera
gb|AGT80621.1|  S-adenosylmethionine decarboxylase                      303   3e-98    
ref|XP_007045669.1|  S-adenosylmethionine decarboxylase proenzyme       303   4e-98    
ref|XP_002282704.1|  PREDICTED: S-adenosylmethionine decarboxylas...    301   2e-97    Vitis vinifera
gb|KEH16884.1|  S-adenosylmethionine decarboxylase proenzyme            300   5e-97    
ref|XP_010660529.1|  PREDICTED: S-adenosylmethionine decarboxylas...    301   7e-97    
gb|ABO77440.1|  S-adenosylmethionine decarboxylase                      298   3e-96    Medicago falcata [sickle alfalfa]
gb|KHG07410.1|  S-adenosylmethionine decarboxylase proenzyme            297   5e-96    
ref|XP_011077597.1|  PREDICTED: S-adenosylmethionine decarboxylas...    296   1e-95    
gb|ADF81048.1|  S-adenosylmethionine decarboxylase                      296   2e-95    
ref|XP_002314904.2|  S-adenosylmethionine decarboxylase family pr...    296   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008243751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    296   2e-95    
ref|XP_007225621.1|  hypothetical protein PRUPE_ppa007732mg             296   2e-95    
gb|ADD91750.1|  S-adenosylmethionine decarboxylase proenzyme            295   3e-95    
gb|AEI98604.1|  S-adenosylmethionine decarboxylase                      295   4e-95    
sp|O80402.1|DCAM_NICSY  RecName: Full=S-adenosylmethionine decarb...    295   4e-95    Nicotiana sylvestris
ref|XP_009622584.1|  PREDICTED: S-adenosylmethionine decarboxylas...    296   4e-95    
sp|Q9M4D8.1|DCAM_VICFA  RecName: Full=S-adenosylmethionine decarb...    295   4e-95    Vicia faba [broad bean]
sp|Q43820.1|DCAM_PEA  RecName: Full=S-adenosylmethionine decarbox...    295   4e-95    Pisum sativum [garden pea]
ref|XP_011008996.1|  PREDICTED: S-adenosylmethionine decarboxylas...    296   5e-95    
sp|Q9AXE3.1|DCAM_DAUCA  RecName: Full=S-adenosylmethionine decarb...    295   5e-95    Daucus carota [Queen Anne's lace]
gb|AAR84406.1|  S-adenosylmethionine decarboxylase                      295   5e-95    Daucus carota [Queen Anne's lace]
gb|ADF81049.1|  S-adenosylmethionine decarboxylase                      294   7e-95    
ref|XP_009764781.1|  PREDICTED: S-adenosylmethionine decarboxylas...    294   8e-95    
gb|ADD91751.1|  S-adenosylmethionine decarboxylase proenzyme            294   8e-95    
emb|CAN66014.1|  hypothetical protein VITISV_041154                     294   9e-95    Vitis vinifera
ref|XP_009625495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    295   1e-94    
ref|XP_002514534.1|  s-adenosylmethionine decarboxylase, putative       293   2e-94    Ricinus communis
emb|CAD98785.2|  S-adenosylmethionine decarboxylase proenzyme           293   2e-94    Vitis vinifera
ref|XP_004490299.1|  PREDICTED: S-adenosylmethionine decarboxylas...    293   2e-94    
ref|XP_004233654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    295   2e-94    
sp|O04009.1|DCAM_TOBAC  RecName: Full=S-adenosylmethionine decarb...    293   3e-94    Nicotiana tabacum [American tobacco]
emb|CDP02379.1|  unnamed protein product                                293   3e-94    
dbj|BAF91878.1|  S-adenosylmethionine decarboxylase                     291   3e-94    Nicotiana benthamiana
gb|AAB88854.1|  S-adenosylmethionine decarboxylase                      293   3e-94    Nicotiana tabacum [American tobacco]
gb|ADH95190.1|  S-adenosylmethionine decarboxylase                      293   3e-94    
ref|XP_010654269.1|  PREDICTED: S-adenosylmethionine decarboxylas...    292   4e-94    
ref|XP_004490298.1|  PREDICTED: S-adenosylmethionine decarboxylas...    294   6e-94    
ref|XP_006338297.1|  PREDICTED: S-adenosylmethionine decarboxylas...    292   7e-94    
sp|Q04694.1|DCAM_SOLTU  RecName: Full=S-adenosylmethionine decarb...    292   8e-94    Solanum tuberosum [potatoes]
emb|CDP00521.1|  unnamed protein product                                291   1e-93    
ref|XP_004297173.1|  PREDICTED: S-adenosylmethionine decarboxylas...    291   2e-93    
gb|AAZ85231.1|  putative S-adenosylmethionine decarboxylase proen...    290   2e-93    Solanum lycopersicoides
ref|XP_010325052.1|  PREDICTED: S-adenosylmethionine decarboxylas...    291   2e-93    
gb|AFV67665.1|  S-adenosylmethionine decarboxylase                      291   2e-93    
ref|XP_003631339.1|  PREDICTED: S-adenosylmethionine decarboxylas...    292   2e-93    
gb|ADV29171.1|  S-adenosylmethionine decarboxylase proenzyme            290   2e-93    
gb|AEO52839.1|  putative S-adenosylmethionine decarboxylase proen...    290   3e-93    
gb|AAZ85232.1|  putative S-adenosylmethionine decarboxylase proen...    290   3e-93    Solanum chmielewskii
gb|ADV29125.1|  S-adenosylmethionine decarboxylase proenzyme            290   4e-93    
gb|AAZ85237.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum chmielewskii
gb|ABW21876.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|ABW21912.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum chilense
gb|ABW21873.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
ref|XP_006348617.1|  PREDICTED: S-adenosylmethionine decarboxylas...    290   4e-93    
gb|ADV29140.1|  S-adenosylmethionine decarboxylase proenzyme            289   4e-93    
gb|AAX56884.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|AAX56882.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|ABW21887.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|ADV29203.1|  S-adenosylmethionine decarboxylase proenzyme            289   4e-93    
gb|ADV29194.1|  S-adenosylmethionine decarboxylase proenzyme            289   4e-93    
gb|ABW21885.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|ABW21878.1|  putative S-adenosylmethionine decarboxylase proen...    289   4e-93    Solanum peruvianum [Peruvian tomato]
gb|ABW21925.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum chilense
gb|ADV29165.1|  S-adenosylmethionine decarboxylase proenzyme            289   5e-93    
gb|ABW21900.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum chilense
gb|AAZ85242.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum pimpinellifolium [currant tomato]
gb|ADV29170.1|  S-adenosylmethionine decarboxylase proenzyme            289   5e-93    
sp|Q96555.1|DCAM_DATST  RecName: Full=S-adenosylmethionine decarb...    290   5e-93    Datura stramonium [common thornapple]
gb|AAX56886.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum peruvianum [Peruvian tomato]
gb|ADV29181.1|  S-adenosylmethionine decarboxylase proenzyme            289   5e-93    
gb|ABW21931.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum chilense
gb|ABW21889.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum peruvianum [Peruvian tomato]
gb|ABW21919.1|  putative S-adenosylmethionine decarboxylase proen...    289   5e-93    Solanum chilense
gb|ADV29198.1|  S-adenosylmethionine decarboxylase proenzyme            289   5e-93    
gb|AAX56905.1|  putative S-adenosylmethionine decarboxylase proen...    289   6e-93    Solanum habrochaites
gb|AAB32507.1|  S-adenosylmethionine decarboxylase                      290   6e-93    Solanum tuberosum [potatoes]
gb|ABW21898.1|  putative S-adenosylmethionine decarboxylase proen...    289   6e-93    Solanum chilense
gb|ABW21917.1|  putative S-adenosylmethionine decarboxylase proen...    289   6e-93    Solanum chilense
gb|AEO52817.1|  putative S-adenosylmethionine decarboxylase proen...    289   7e-93    
gb|ABY55856.1|  S-adenosylmethionine decarboxylase 3                    290   7e-93    Solanum lycopersicum
ref|NP_001234699.1|  S-adenosylmethionine decarboxylase                 289   9e-93    
gb|AEO52841.1|  putative S-adenosylmethionine decarboxylase proen...    288   9e-93    
gb|ABW21863.1|  putative S-adenosylmethionine decarboxylase proen...    288   9e-93    Solanum peruvianum [Peruvian tomato]
ref|XP_004297172.1|  PREDICTED: S-adenosylmethionine decarboxylas...    290   1e-92    
gb|ABW21886.1|  putative S-adenosylmethionine decarboxylase proen...    288   1e-92    Solanum peruvianum [Peruvian tomato]
gb|ADV29185.1|  S-adenosylmethionine decarboxylase proenzyme            288   1e-92    
ref|XP_010091687.1|  S-adenosylmethionine decarboxylase proenzyme       288   2e-92    
gb|AEO52842.1|  putative S-adenosylmethionine decarboxylase proen...    288   2e-92    
gb|ABY55855.1|  S-adenosylmethionine decarboxylase 2                    288   3e-92    Solanum lycopersicum
gb|KDP31452.1|  hypothetical protein JCGZ_11828                         288   3e-92    
gb|ADV29193.1|  S-adenosylmethionine decarboxylase proenzyme            287   4e-92    
gb|AEO52758.1|  putative S-adenosylmethionine decarboxylase proen...    287   4e-92    
emb|CAG28949.1|  S-adenosylmethionine decarboxylase                     286   4e-92    Prunus persica
gb|ABW21895.1|  putative S-adenosylmethionine decarboxylase proen...    286   5e-92    Solanum peruvianum [Peruvian tomato]
gb|KHG10311.1|  S-adenosylmethionine decarboxylase proenzyme            287   5e-92    
gb|ABW21890.1|  putative S-adenosylmethionine decarboxylase proen...    286   5e-92    Solanum peruvianum [Peruvian tomato]
gb|KDO70175.1|  hypothetical protein CISIN_1g0194112mg                  285   5e-92    
ref|XP_006367530.1|  PREDICTED: S-adenosylmethionine decarboxylas...    287   5e-92    
ref|XP_006373494.1|  hypothetical protein POPTR_0017s14280g             287   6e-92    
ref|XP_010528023.1|  PREDICTED: S-adenosylmethionine decarboxylas...    287   6e-92    
gb|AER27717.1|  S-adenosylmethionine decarboxylase                      283   7e-92    
gb|ABW21915.1|  putative S-adenosylmethionine decarboxylase proen...    286   8e-92    Solanum chilense
sp|Q38IY3.1|DCAM_SOLCI  RecName: Full=S-adenosylmethionine decarb...    286   9e-92    Solanum chilense
ref|XP_010320542.1|  PREDICTED: S-adenosylmethionine decarboxylas...    288   9e-92    
ref|XP_008230354.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    288   1e-91    
ref|XP_007215554.1|  hypothetical protein PRUPE_ppa007294mg             287   1e-91    
dbj|BAC55114.1|  S-adenosylmethionine decarboxylase                     286   1e-91    Malus domestica [apple tree]
ref|XP_011070874.1|  PREDICTED: S-adenosylmethionine decarboxylas...    286   2e-91    
ref|NP_001275865.1|  S-adenosylmethionine decarboxylase                 286   2e-91    
ref|XP_010032594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    285   2e-91    
ref|XP_008353516.1|  PREDICTED: S-adenosylmethionine decarboxylas...    286   3e-91    
ref|NP_001236931.1|  S-adenosylmethionine decarboxylase                 285   3e-91    
ref|XP_009373729.1|  PREDICTED: S-adenosylmethionine decarboxylas...    286   3e-91    
ref|XP_006573201.1|  PREDICTED: S-adenosylmethionine decarboxylas...    285   3e-91    
gb|KHG30390.1|  S-adenosylmethionine decarboxylase proenzyme            285   3e-91    
ref|XP_008362232.1|  PREDICTED: S-adenosylmethionine decarboxylas...    285   4e-91    
gb|ACZ73828.1|  S-adenosylmethionine decarboxylase                      285   5e-91    Olea europaea
ref|XP_009801145.1|  PREDICTED: S-adenosylmethionine decarboxylas...    286   5e-91    
ref|XP_010549939.1|  PREDICTED: S-adenosylmethionine decarboxylas...    284   8e-91    
gb|AGI02585.1|  S-adenosylmethionine decarboxylase                      285   8e-91    
sp|P46255.1|DCAM_SPIOL  RecName: Full=S-adenosylmethionine decarb...    284   9e-91    Spinacia oleracea
gb|AFV92895.1|  S-adenosylmethionine decarboxylase                      284   1e-90    
sp|Q39676.1|DCAM1_DIACA  RecName: Full=S-adenosylmethionine decar...    284   1e-90    Dianthus caryophyllus [carnation]
ref|NP_001280825.1|  uncharacterized protein LOC103451713               283   1e-90    
gb|KEH20218.1|  S-adenosylmethionine decarboxylase proenzyme            284   1e-90    
ref|XP_008339774.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   1e-90    
ref|XP_008360070.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   2e-90    
gb|AIS20829.1|  SAMDC3                                                  283   2e-90    
ref|XP_009356498.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   2e-90    
ref|XP_006602987.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   2e-90    
gb|KHN13794.1|  S-adenosylmethionine decarboxylase proenzyme            283   2e-90    
ref|XP_010681340.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   3e-90    
ref|XP_011021158.1|  PREDICTED: S-adenosylmethionine decarboxylas...    282   4e-90    
ref|XP_007033428.1|  S-adenosylmethionine decarboxylase proenzyme...    284   5e-90    
gb|EYU44271.1|  hypothetical protein MIMGU_mgv1a008754mg                282   6e-90    
ref|XP_004491770.1|  PREDICTED: S-adenosylmethionine decarboxylas...    282   7e-90    
ref|XP_009588870.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   7e-90    
ref|XP_011008131.1|  PREDICTED: S-adenosylmethionine decarboxylas...    281   8e-90    
ref|XP_011099087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    283   8e-90    
sp|Q42679.1|DCAM_CATRO  RecName: Full=S-adenosylmethionine decarb...    281   8e-90    Catharanthus roseus [chatas]
ref|XP_006437789.1|  hypothetical protein CICLE_v10033607mg             285   1e-89    
gb|KEH21805.1|  S-adenosylmethionine decarboxylase proenzyme            281   1e-89    
ref|XP_007033429.1|  S-adenosylmethionine decarboxylase proenzyme...    281   1e-89    
gb|AAM44307.1|AF512545_1  S-adenosylmethionine decarboxylase            281   2e-89    Citrus x microcarpa [Panama orange]
ref|XP_006585825.1|  PREDICTED: S-adenosylmethionine decarboxylas...    280   2e-89    
sp|Q39677.1|DCAM2_DIACA  RecName: Full=S-adenosylmethionine decar...    280   4e-89    Dianthus caryophyllus [carnation]
ref|XP_002305295.2|  S-adenosylmethionine decarboxylase family pr...    280   4e-89    Populus trichocarpa [western balsam poplar]
ref|XP_010044331.1|  PREDICTED: S-adenosylmethionine decarboxylas...    279   4e-89    
gb|AGZ90156.1|  S-adenosylmethionine decarboxylase                      279   6e-89    
ref|XP_004304166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    280   7e-89    
ref|XP_006291363.1|  hypothetical protein CARUB_v10017502mg             279   8e-89    
ref|XP_010525150.1|  PREDICTED: S-adenosylmethionine decarboxylas...    279   1e-88    
gb|ABK95104.1|  unknown                                                 278   2e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010100905.1|  S-adenosylmethionine decarboxylase proenzyme       278   2e-88    
ref|XP_010257836.1|  PREDICTED: S-adenosylmethionine decarboxylas...    279   3e-88    
gb|KEH17677.1|  S-adenosylmethionine decarboxylase proenzyme            279   3e-88    
gb|AGL95795.1|  S-adenosylmenthionine decarboxylase                     277   4e-88    
ref|NP_189184.1|  S-adenosylmethionine decarboxylase                    277   4e-88    Arabidopsis thaliana [mouse-ear cress]
gb|KGN57743.1|  hypothetical protein Csa_3G271360                       277   6e-88    
dbj|BAP47514.1|  S-adenosylmethionine decarboxylase                     276   8e-88    
gb|KDP24344.1|  hypothetical protein JCGZ_25640                         276   1e-87    
gb|AER27716.1|  S-adenosylmethionine decarboxylase                      271   3e-87    
gb|AGV68760.1|  S-adenosylmethionine decarboxylase                      275   3e-87    
ref|XP_010261810.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    274   5e-87    
gb|EPS62258.1|  s-adenosylmethionine decarboxylase proenzyme            274   8e-87    
gb|KDO58885.1|  hypothetical protein CISIN_1g039582mg                   273   1e-86    
gb|ABY81906.1|  S-adenosylmethionine decarboxylase                      272   3e-86    Vigna radiata [mung bean]
ref|XP_008461582.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    274   3e-86    
ref|XP_006430871.1|  hypothetical protein CICLE_v10013866mg             272   3e-86    
ref|XP_002525956.1|  s-adenosylmethionine decarboxylase, putative       270   2e-85    Ricinus communis
ref|XP_007139351.1|  hypothetical protein PHAVU_008G022100g             269   4e-85    
ref|XP_006288009.1|  hypothetical protein CARUB_v10001243mg             269   5e-85    
ref|XP_009121534.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    269   6e-85    
ref|XP_008811197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    268   1e-84    
gb|ABU55003.1|  S-adenosylmethionine decarboxylase                      266   2e-84    Phaseolus vulgaris [French bean]
emb|CDX69487.1|  BnaA10g18360D                                          268   2e-84    
ref|XP_002876918.1|  adenosylmethionine decarboxylase family protein    266   2e-84    
ref|XP_007153542.1|  hypothetical protein PHAVU_003G044200g             267   4e-84    
emb|CDY57536.1|  BnaA05g33510D                                          266   8e-84    
ref|XP_010463654.1|  PREDICTED: S-adenosylmethionine decarboxylas...    266   8e-84    
emb|CAA69073.1|  S-adenosylmethionine decarboxylase                     266   1e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAL06846.1|  AT3g02470/F16B3_10                                      266   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|NP_186896.1|  conserved peptide upstream open reading frame 9       266   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882231.1|  S-adenosylmethionine decarboxylase                 266   2e-83    
ref|XP_010904619.1|  PREDICTED: S-adenosylmethionine decarboxylas...    265   2e-83    
ref|XP_006408415.1|  hypothetical protein EUTSA_v10022357mg             264   5e-83    
dbj|BAB83763.1|  S-adenosylmethionine decarboxylase                     263   9e-83    Phaseolus lunatus
sp|O65354.1|DCAM_HELAN  RecName: Full=S-adenosylmethionine decarb...    263   1e-82    Helianthus annuus
ref|XP_006395646.1|  hypothetical protein EUTSA_v10004463mg             263   1e-82    
gb|AAB17665.1|  S-adenosylmethionine decarboxylase                      263   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299023.1|  hypothetical protein CARUB_v10015160mg             264   3e-82    
ref|XP_009147351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    262   3e-82    
gb|KEH21806.1|  S-adenosylmethionine decarboxylase proenzyme            263   4e-82    
ref|XP_010492454.1|  PREDICTED: S-adenosylmethionine decarboxylas...    261   6e-82    
emb|CDX70666.1|  BnaC03g07500D                                          261   1e-81    
sp|Q9SDM8.1|DCAM3_BRAJU  RecName: Full=S-adenosylmethionine decar...    261   1e-81    Brassica juncea [Indian mustard]
gb|AGV54395.1|  S-adenosylmethionine decarboxylase                      260   2e-81    
emb|CDY26478.1|  BnaC09g41900D                                          260   2e-81    
gb|AAS45435.1|  S-adenosylmethionine decarboxylase                      259   3e-81    Brassica juncea [Indian mustard]
ref|XP_010453744.1|  PREDICTED: S-adenosylmethionine decarboxylas...    259   6e-81    
emb|CDX74257.1|  BnaA03g27900D                                          259   6e-81    
ref|XP_009134671.1|  PREDICTED: S-adenosylmethionine decarboxylas...    259   8e-81    
ref|XP_010420276.1|  PREDICTED: S-adenosylmethionine decarboxylas...    258   8e-81    
gb|ADG57793.1|  S-adenosyl-l-methionine decarboxylase 3-2               259   8e-81    
emb|CDY43235.1|  BnaC05g48280D                                          261   8e-81    
emb|CDX91992.1|  BnaC03g32940D                                          258   1e-80    
gb|ADG57791.1|  S-adenosyl-l-methionine decarboxylase 3-1               258   1e-80    
gb|AAR15894.1|  S-adenosyl-L-methionine decarboxylase                   258   2e-80    Brassica juncea [Indian mustard]
sp|O49972.1|DCAM2_BRAJU  RecName: Full=S-adenosylmethionine decar...    258   2e-80    Brassica juncea [Indian mustard]
ref|NP_197099.1|  S-adenosylmethionine decarboxylase proenzyme 2        257   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400122.1|  hypothetical protein EUTSA_v10015260mg             257   4e-80    
ref|XP_002871694.1|  adenosylmethionine decarboxylase family protein    256   6e-80    
sp|Q42613.1|DCAM1_BRAJU  RecName: Full=S-adenosylmethionine decar...    256   6e-80    Brassica juncea [Indian mustard]
emb|CDY71278.1|  BnaAnng36830D                                          256   8e-80    
ref|XP_009118044.1|  PREDICTED: S-adenosylmethionine decarboxylas...    253   2e-78    
emb|CDY71710.1|  BnaAnng38530D                                          253   1e-77    
ref|XP_010692003.1|  PREDICTED: S-adenosylmethionine decarboxylas...    249   3e-77    
gb|AAR00210.1|  S-adenosylmethionine decarboxylase                      246   9e-77    Phaseolus vulgaris [French bean]
ref|XP_010430714.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    246   1e-76    
gb|KEH21807.1|  S-adenosylmethionine decarboxylase proenzyme            247   2e-76    
gb|AEW43295.1|  putative S-adenosylmethionine decarboxylase             243   5e-76    
gb|ADQ37302.1|  putative S-adenosyl methionine decarboxylase            247   5e-76    
gb|ABK25576.1|  unknown                                                 245   2e-75    Picea sitchensis
ref|XP_009765510.1|  PREDICTED: S-adenosylmethionine decarboxylas...    243   4e-75    
gb|ABR17745.1|  unknown                                                 244   5e-75    Picea sitchensis
ref|XP_010277986.1|  PREDICTED: S-adenosylmethionine decarboxylas...    242   3e-74    
gb|EPS67756.1|  hypothetical protein M569_07018                         243   4e-74    
gb|ACE97512.1|  S-adenosylmethionine decarboxylase                      236   1e-73    Populus tremula [European aspen]
gb|ACE97514.1|  S-adenosylmethionine decarboxylase                      236   1e-73    Populus tremula [European aspen]
gb|ACE97515.1|  S-adenosylmethionine decarboxylase                      236   1e-73    Populus tremula [European aspen]
gb|ACE97508.1|  S-adenosylmethionine decarboxylase                      236   1e-73    Populus tremula [European aspen]
gb|ACE97505.1|  S-adenosylmethionine decarboxylase                      236   1e-73    Populus tremula [European aspen]
gb|ACE97491.1|  S-adenosylmethionine decarboxylase                      236   2e-73    Populus tremula [European aspen]
gb|ACE97522.1|  S-adenosylmethionine decarboxylase                      236   2e-73    Populus tremula [European aspen]
gb|ACE97499.1|  S-adenosylmethionine decarboxylase                      236   2e-73    Populus tremula [European aspen]
gb|ACE97495.1|  S-adenosylmethionine decarboxylase                      236   2e-73    Populus tremula [European aspen]
gb|ACE97520.1|  S-adenosylmethionine decarboxylase                      235   2e-73    Populus tremula [European aspen]
gb|ACE97501.1|  S-adenosylmethionine decarboxylase                      235   2e-73    Populus tremula [European aspen]
gb|ACE97513.1|  S-adenosylmethionine decarboxylase                      235   2e-73    Populus tremula [European aspen]
gb|ACE97496.1|  S-adenosylmethionine decarboxylase                      235   2e-73    Populus tremula [European aspen]
gb|ACE97492.1|  S-adenosylmethionine decarboxylase                      235   2e-73    Populus tremula [European aspen]
ref|NP_001047404.1|  Os02g0611200                                       239   5e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002462403.1|  hypothetical protein SORBIDRAFT_02g025110          239   9e-73    Sorghum bicolor [broomcorn]
gb|EMS62883.1|  S-adenosylmethionine decarboxylase proenzyme            238   1e-72    
ref|XP_010235689.1|  PREDICTED: S-adenosylmethionine decarboxylas...    238   2e-72    
ref|XP_010268432.1|  PREDICTED: S-adenosylmethionine decarboxylas...    238   2e-72    
dbj|BAK00199.1|  predicted protein                                      237   3e-72    
gb|ACE97507.1|  S-adenosylmethionine decarboxylase                      233   3e-72    Populus tremula [European aspen]
gb|EEE57355.1|  hypothetical protein OsJ_07492                          239   3e-72    Oryza sativa Japonica Group [Japonica rice]
gb|AHJ14567.1|  S-adenosyl methionine decarboxylase 1                   237   4e-72    
sp|Q42829.1|DCAM_HORCH  RecName: Full=S-adenosylmethionine decarb...    237   4e-72    Hordeum chilense
gb|AHJ14568.1|  S-adenosyl methionine decarboxylase 1                   237   4e-72    
ref|XP_004956866.1|  PREDICTED: S-adenosylmethionine decarboxylas...    237   4e-72    
gb|ADD70015.1|  S-adenosyl-L-methionine decarboxylase 2                 237   5e-72    Leymus chinensis
gb|ABO32297.1|  S-adenosylmethionine decarboxylase                      232   7e-72    Saccharum arundinaceum
ref|XP_009403328.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   9e-72    
ref|XP_004953064.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   1e-71    
ref|XP_009401295.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   1e-71    
gb|ACV52078.1|  S-adenosylmethionine decarboxylase 1                    236   1e-71    Sorghum bicolor [broomcorn]
gb|AHJ14569.1|  S-adenosyl methionine decarboxylase 2                   236   1e-71    
gb|ADE92938.1|  S-adenosylmethionine decarboxylase                      235   1e-71    
gb|ABJ15728.1|  S-adenosylmethionine decarboxylase                      235   1e-71    Triticum monococcum [einkorn wheat]
gb|EMT11715.1|  S-adenosylmethionine decarboxylase proenzyme            235   2e-71    
gb|EMT10641.1|  S-adenosylmethionine decarboxylase proenzyme            234   3e-71    
gb|ADC45378.1|  S-adenosylmethionine decarboxylase 2                    235   4e-71    
ref|XP_009401296.1|  PREDICTED: S-adenosylmethionine decarboxylas...    236   4e-71    
ref|XP_009390538.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   5e-71    
gb|ABO32298.1|  S-adenosylmethionine decarboxylase                      234   5e-71    Saccharum officinarum [noble cane]
gb|ACT53876.1|  S-adenosylmethionine decarboxylase                      234   5e-71    Saccharum officinarum [noble cane]
gb|AHJ14566.1|  S-adenosyl methionine decarboxylase 1                   234   5e-71    
emb|CAC09496.2|  H0711G06.2                                             233   7e-71    
gb|ADC45379.1|  S-adenosylmethionine decarboxylase                      234   9e-71    
gb|AGT16271.1|  S-adenosylmethionine decarboxylase                      233   9e-71    
ref|XP_006660640.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   1e-70    
gb|AEL33693.1|  S-adenosyl methionine decarboxylase                     233   1e-70    
ref|XP_002446740.1|  hypothetical protein SORBIDRAFT_06g021540          233   1e-70    
ref|XP_009410197.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   2e-70    
gb|ACV52081.1|  S-adenosylmethionine decarboxylase 3                    233   2e-70    
gb|AAL16065.1|AF420239_1  S-adenosyl-L-methionine decarboxylase         232   2e-70    
ref|NP_001053213.1|  Os04g0498600                                       232   3e-70    
sp|A2XV58.2|DCAM_ORYSI  RecName: Full=S-adenosylmethionine decarb...    232   3e-70    
gb|AGR89928.1|  S-adenosyl-L-methionine decarboxylase                   231   5e-70    
gb|AAD17232.1|  S-adenosylmethionine decarboxylase precursor            231   5e-70    
ref|NP_001105713.1|  S-adenosylmethionine decarboxylase proenzyme       232   5e-70    
ref|XP_010240071.1|  PREDICTED: S-adenosylmethionine decarboxylas...    233   6e-70    
gb|AAX76987.1|  S-adenosylmethionine decarboxylase                      231   6e-70    
ref|NP_001149266.1|  LOC100282888                                       231   8e-70    
gb|ACL53872.1|  unknown                                                 231   9e-70    
ref|XP_008652738.1|  PREDICTED: S-adenosylmethionine decarboxylas...    232   1e-69    
gb|EAZ09149.1|  hypothetical protein OsI_31419                          231   1e-69    
emb|CAD41510.3|  OSJNBa0029H02.4                                        232   1e-69    
gb|AGL46977.1|  S-adenosylmethionine decarboxylase                      231   1e-69    
gb|EMS45151.1|  S-adenosylmethionine decarboxylase proenzyme            231   1e-69    
gb|EAY94718.1|  hypothetical protein OsI_16495                          232   1e-69    
gb|EAY86651.1|  hypothetical protein OsI_08032                          237   1e-69    
gb|ACG40518.1|  S-adenosylmethionine decarboxylase proenzyme            230   2e-69    
ref|XP_002452433.1|  hypothetical protein SORBIDRAFT_04g025720          230   3e-69    
gb|AGZ61932.1|  S-adenosylmethionine decarboxylase                      230   3e-69    
ref|XP_004976106.1|  PREDICTED: S-adenosylmethionine decarboxylas...    231   4e-69    
gb|EMT07332.1|  S-adenosylmethionine decarboxylase proenzyme            231   5e-69    
dbj|BAJ96795.1|  predicted protein                                      229   7e-69    
ref|XP_006647495.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   8e-69    
gb|ADD70012.1|  S-adenosyl-L-methionine decarboxylase 1                 228   1e-68    
ref|XP_010687659.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   1e-68    
ref|XP_010238180.1|  PREDICTED: S-adenosylmethionine decarboxylas...    229   1e-68    
ref|NP_001063217.1|  Os09g0424300                                       228   1e-68    
ref|XP_008794388.1|  PREDICTED: S-adenosylmethionine decarboxylas...    228   1e-68    
ref|XP_010929198.1|  PREDICTED: S-adenosylmethionine decarboxylas...    228   1e-68    
gb|AAO43186.1|  S-adenosylmethionine decarboxylase                      227   1e-68    
gb|ACJ84479.1|  unknown                                                 218   3e-68    
ref|NP_001148939.1|  S-adenosylmethionine decarboxylase proenzyme       227   4e-68    
ref|XP_001782581.1|  predicted protein                                  226   9e-68    
gb|ADU02193.1|  S-adenosylmethionine decarboxylase                      226   9e-68    
ref|XP_010687660.1|  PREDICTED: S-adenosylmethionine decarboxylas...    226   1e-67    
ref|XP_008793521.1|  PREDICTED: S-adenosylmethionine decarboxylas...    224   3e-67    
ref|XP_001775168.1|  predicted protein                                  224   4e-67    
ref|XP_009418028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    224   4e-67    
emb|CDP02875.1|  unnamed protein product                                223   1e-66    
ref|XP_010105415.1|  S-adenosylmethionine decarboxylase proenzyme       222   2e-66    
gb|ADW83722.1|  S-adenosylmethionine decarboxylase 2                    221   3e-66    
ref|XP_010904594.1|  PREDICTED: S-adenosylmethionine decarboxylas...    220   1e-65    
ref|XP_006878657.1|  hypothetical protein AMTR_s00011p00266060          219   2e-65    
ref|XP_010656641.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   3e-65    
gb|KDP38736.1|  hypothetical protein JCGZ_04089                         218   5e-65    
ref|XP_008808772.1|  PREDICTED: S-adenosylmethionine decarboxylas...    219   1e-64    
dbj|BAF75727.1|  S-adenosylmethionine decarboxylase                     217   1e-64    
gb|EMS50405.1|  S-adenosylmethionine decarboxylase proenzyme            219   1e-64    
gb|KCW78796.1|  hypothetical protein EUGRSUZ_C00232                     217   2e-64    
ref|XP_002324514.2|  hypothetical protein POPTR_0018s11040g             217   2e-64    
gb|KCW78797.1|  hypothetical protein EUGRSUZ_C00232                     217   5e-64    
ref|XP_011079446.1|  PREDICTED: S-adenosylmethionine decarboxylas...    215   5e-64    
emb|CAB64671.1|  S-adenosylmethionine decarboxylase 1                   207   1e-63    
ref|NP_001149694.1|  S-adenosylmethionine decarboxylase proenzyme       214   2e-63    
ref|XP_010914049.1|  PREDICTED: S-adenosylmethionine decarboxylas...    214   2e-63    
emb|CAN76946.1|  hypothetical protein VITISV_017165                     217   2e-63    
ref|XP_010047048.1|  PREDICTED: S-adenosylmethionine decarboxylas...    216   3e-63    
ref|XP_001757739.1|  predicted protein                                  214   4e-63    
ref|XP_009796351.1|  PREDICTED: S-adenosylmethionine decarboxylas...    213   4e-63    
ref|XP_011018087.1|  PREDICTED: S-adenosylmethionine decarboxylas...    214   4e-63    
ref|XP_002979516.1|  hypothetical protein SELMODRAFT_14106              210   6e-63    
gb|KGN61070.1|  hypothetical protein Csa_2G036680                       213   7e-63    
ref|XP_002534009.1|  s-adenosylmethionine decarboxylase, putative       209   2e-62    
ref|XP_004163988.1|  PREDICTED: S-adenosylmethionine decarboxylas...    213   3e-62    
ref|XP_004144715.1|  PREDICTED: S-adenosylmethionine decarboxylas...    213   3e-62    
ref|XP_008452459.1|  PREDICTED: S-adenosylmethionine decarboxylas...    213   3e-62    
ref|XP_001776491.1|  predicted protein                                  212   3e-62    
ref|XP_001776462.1|  predicted protein                                  211   3e-62    
gb|AID66751.1|  S-adenosylmethionine decarboxylase protein              204   7e-62    
gb|AGV09140.1|  S-adenosyl methionine decarboxylase                     204   1e-61    
ref|XP_006453539.1|  hypothetical protein CICLE_v10010502mg             209   1e-61    
ref|XP_002977805.1|  hypothetical protein SELMODRAFT_14131              208   2e-61    
gb|KDO62315.1|  hypothetical protein CISIN_1g035670mg                   209   3e-61    
ref|XP_007013911.1|  S-adenosylmethionine decarboxylase proenzyme...    209   3e-61    
ref|XP_006845442.1|  hypothetical protein AMTR_s00019p00109640          208   6e-61    
dbj|BAE72687.1|  S-adenosylmethionine decarboxylase                     199   7e-60    
ref|XP_009618361.1|  PREDICTED: S-adenosylmethionine decarboxylas...    203   2e-59    
gb|AFJ04521.1|  s-adenosylmethionine decarboxylase                      201   3e-59    
ref|XP_002977119.1|  hypothetical protein SELMODRAFT_106449             201   4e-59    
ref|XP_002992114.1|  hypothetical protein SELMODRAFT_134821             199   4e-58    
gb|EYU37130.1|  hypothetical protein MIMGU_mgv1a008734mg                198   1e-57    
gb|AEV40469.1|  S-adenosylmethionine decarboxylase                      196   2e-57    
gb|ABA03224.1|  S-adenosylmethionine decarboxylase 4                    193   5e-57    
dbj|BAD97831.1|  S-adenosylmethionine decarboxylase                     189   4e-56    
ref|XP_009803663.1|  PREDICTED: S-adenosylmethionine decarboxylas...    183   4e-54    
pdb|1MHM|A  Chain A, Crystal Structure Of S-Adenosylmethionine De...    186   1e-53    
gb|AAC17190.1|  S-adenosylmethionine decarboxylase                      180   2e-53    
gb|ABA03222.1|  S-adenosylmethionine decarboxylase 2                    182   2e-53    
emb|CAJ42877.1|  S-adenosyl methionine decarboxylase                    179   2e-51    
ref|XP_003550675.1|  PREDICTED: S-adenosylmethionine decarboxylas...    182   2e-51    
dbj|BAC81653.1|  S-adenosylmethionine decarboxylase                     179   4e-51    
ref|XP_010492932.1|  PREDICTED: S-adenosylmethionine decarboxylas...    181   4e-51    
ref|XP_010454143.1|  PREDICTED: S-adenosylmethionine decarboxylas...    181   4e-51    
ref|NP_197394.1|  S-adenosylmethionine decarboxylase                    181   7e-51    
ref|XP_010420666.1|  PREDICTED: S-adenosylmethionine decarboxylas...    180   9e-51    
ref|XP_009120934.1|  PREDICTED: S-adenosylmethionine decarboxylas...    181   2e-50    
ref|XP_006400447.1|  hypothetical protein EUTSA_v10013987mg             178   6e-50    
emb|CDX70856.1|  BnaC03g09400D                                          177   1e-49    
emb|CDX92572.1|  BnaA10g16110D                                          177   1e-49    
ref|XP_006290030.1|  hypothetical protein CARUB_v10003664mg             177   2e-49    
gb|KFK34011.1|  hypothetical protein AALP_AA5G090500                    176   3e-49    
ref|XP_002983556.1|  hypothetical protein SELMODRAFT_118443             177   3e-49    
emb|CDY13929.1|  BnaC09g38970D                                          176   4e-49    
ref|XP_002312726.1|  hypothetical protein POPTR_0008s20330g             174   2e-48    
ref|XP_011006075.1|  PREDICTED: S-adenosylmethionine decarboxylas...    174   2e-48    
ref|XP_002973835.1|  hypothetical protein SELMODRAFT_100475             175   2e-48    
gb|AAQ14849.1|  S-adenosylmethionine decarboxylase                      166   4e-48    
ref|XP_002314430.2|  hypothetical protein POPTR_0010s02930g             173   5e-48    
ref|XP_011011751.1|  PREDICTED: S-adenosylmethionine decarboxylas...    172   7e-48    
ref|XP_009131706.1|  PREDICTED: S-adenosylmethionine decarboxylas...    172   8e-48    
ref|XP_009126291.1|  PREDICTED: S-adenosylmethionine decarboxylas...    171   3e-47    
ref|XP_010921966.1|  PREDICTED: S-adenosylmethionine decarboxylas...    170   5e-47    
ref|XP_008811998.1|  PREDICTED: S-adenosylmethionine decarboxylas...    170   7e-47    
ref|XP_010524778.1|  PREDICTED: S-adenosylmethionine decarboxylas...    169   1e-46    
ref|XP_010546901.1|  PREDICTED: S-adenosylmethionine decarboxylas...    169   1e-46    
emb|CDX88906.1|  BnaA03g07430D                                          169   1e-46    
gb|KDO74922.1|  hypothetical protein CISIN_1g041801mg                   169   1e-46    
ref|XP_010105688.1|  S-adenosylmethionine decarboxylase proenzyme 3     168   4e-46    
ref|XP_010931927.1|  PREDICTED: S-adenosylmethionine decarboxylas...    167   5e-46    
ref|XP_002873919.1|  BUD2/SAMDC4                                        167   8e-46    
gb|ABA03221.1|  S-adenosylmethionine decarboxylase 1                    161   1e-45    
ref|XP_006489274.1|  PREDICTED: S-adenosylmethionine decarboxylas...    167   1e-45    
ref|XP_006419758.1|  hypothetical protein CICLE_v10005303mg             167   1e-45    
ref|XP_003528663.1|  PREDICTED: S-adenosylmethionine decarboxylas...    166   2e-45    
ref|XP_010036128.1|  PREDICTED: S-adenosylmethionine decarboxylas...    166   4e-45    
gb|AAT67246.1|  S-adenosylmethionine decarboxylase                      160   5e-45    
gb|KFK38065.1|  hypothetical protein AALP_AA3G065400                    165   6e-45    
ref|XP_002516818.1|  s-adenosylmethionine decarboxylase, putative       164   9e-45    
ref|XP_004297028.1|  PREDICTED: S-adenosylmethionine decarboxylas...    164   1e-44    
ref|XP_008793650.1|  PREDICTED: S-adenosylmethionine decarboxylas...    164   2e-44    
ref|XP_002277316.1|  PREDICTED: S-adenosylmethionine decarboxylas...    164   2e-44    
ref|XP_007035369.1|  Adenosylmethionine decarboxylase family protein    162   5e-44    
ref|XP_004145040.1|  PREDICTED: S-adenosylmethionine decarboxylas...    162   5e-44    
ref|XP_004153549.1|  PREDICTED: S-adenosylmethionine decarboxylas...    162   5e-44    
ref|XP_004486095.1|  PREDICTED: S-adenosylmethionine decarboxylas...    162   6e-44    
ref|XP_007154193.1|  hypothetical protein PHAVU_003G097900g             162   7e-44    
ref|XP_010279141.1|  PREDICTED: S-adenosylmethionine decarboxylas...    162   8e-44    
emb|CAN76568.1|  hypothetical protein VITISV_030214                     162   1e-43    
ref|XP_004508338.1|  PREDICTED: S-adenosylmethionine decarboxylas...    161   2e-43    
ref|XP_007222179.1|  hypothetical protein PRUPE_ppa007795mg             161   2e-43    
ref|XP_007147821.1|  hypothetical protein PHAVU_006G157800g             162   2e-43    
ref|XP_008223049.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    160   3e-43    
ref|XP_008458531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    160   4e-43    
gb|AGV54477.1|  S-adenosylmethionine decarboxylase                      153   5e-43    
ref|XP_002957689.1|  hypothetical protein VOLCADRAFT_84198              160   7e-43    
gb|EPS69535.1|  s-adenosylmethionine decarboxylase proenzyme            159   7e-43    
ref|XP_010024449.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   1e-42    
gb|KHN03415.1|  S-adenosylmethionine decarboxylase proenzyme            159   1e-42    
ref|XP_008340886.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   1e-42    
ref|XP_003594071.1|  S-adenosylmethionine decarboxylase proenzyme       159   2e-42    
ref|XP_003550518.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   2e-42    
ref|XP_008390797.1|  PREDICTED: S-adenosylmethionine decarboxylas...    159   2e-42    
gb|KDP40067.1|  hypothetical protein JCGZ_02065                         157   4e-42    
ref|XP_004963441.1|  PREDICTED: S-adenosylmethionine decarboxylas...    157   6e-42    
emb|CBI26155.3|  unnamed protein product                                157   7e-42    
ref|XP_009352148.1|  PREDICTED: S-adenosylmethionine decarboxylas...    156   1e-41    
emb|CDO98960.1|  unnamed protein product                                156   1e-41    
ref|XP_001693327.1|  S-adenosylmethionine decarboxylase                 157   2e-41    
ref|XP_009339941.1|  PREDICTED: S-adenosylmethionine decarboxylas...    155   2e-41    
ref|XP_004241063.1|  PREDICTED: S-adenosylmethionine decarboxylas...    155   3e-41    
ref|XP_006850850.1|  hypothetical protein AMTR_s00025p00139140          155   4e-41    
ref|XP_003609535.1|  S-adenosylmethionine decarboxylase proenzyme       154   1e-40    
gb|AFY06653.1|  s-adenosyl methionine decarboxylase                     152   1e-40    
ref|XP_011090841.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   2e-40    
ref|XP_004229470.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   2e-40    
ref|XP_006365286.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   2e-40    
ref|XP_011071531.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   2e-40    
ref|XP_009782050.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   3e-40    
ref|XP_009602655.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   4e-40    
gb|EYU45598.1|  hypothetical protein MIMGU_mgv1a019750mg                152   5e-40    
ref|XP_003542902.1|  PREDICTED: S-adenosylmethionine decarboxylas...    152   5e-40    
ref|XP_009781838.1|  PREDICTED: S-adenosylmethionine decarboxylas...    151   8e-40    
ref|XP_003547228.1|  PREDICTED: S-adenosylmethionine decarboxylas...    151   9e-40    
ref|XP_009393359.1|  PREDICTED: S-adenosylmethionine decarboxylas...    150   1e-39    
ref|XP_010255822.1|  PREDICTED: S-adenosylmethionine decarboxylas...    150   2e-39    
ref|XP_008438742.1|  PREDICTED: S-adenosylmethionine decarboxylas...    150   2e-39    
ref|XP_009621214.1|  PREDICTED: S-adenosylmethionine decarboxylas...    150   2e-39    
ref|XP_004134166.1|  PREDICTED: S-adenosylmethionine decarboxylas...    150   2e-39    
ref|XP_004167626.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    150   3e-39    
emb|CDY47189.1|  BnaAnng08590D                                          150   4e-39    
gb|KHN37543.1|  S-adenosylmethionine decarboxylase proenzyme 1          148   7e-39    
ref|XP_006356688.1|  PREDICTED: S-adenosylmethionine decarboxylas...    149   8e-39    
ref|XP_009385076.1|  PREDICTED: S-adenosylmethionine decarboxylas...    148   1e-38    
ref|XP_003082560.1|  S-adenosylmethionine decarboxylase (ISS)           148   4e-38    
ref|XP_005642931.1|  S-adenosylmethionine decarboxylase                 145   1e-37    
ref|XP_007514813.1|  S-adenosylmethionine decarboxylase                 145   8e-37    
ref|XP_010497704.1|  PREDICTED: S-adenosylmethionine decarboxylas...    134   2e-35    
gb|ADW83721.1|  S-adenosylmethionine decarboxylase 1                    137   9e-35    
ref|XP_002502359.1|  adenosylmethionine/pyridoxal dependant decar...    142   1e-34    
ref|XP_003057072.1|  adenosylmethionine/pyridoxal dependant decar...    140   5e-34    
gb|KDO25305.1|  adenosylmethionine decarboxylase                        135   2e-33    
ref|XP_008618635.1|  adenosylmethionine decarboxylase                   134   3e-33    
ref|XP_005709363.1|  S-adenosylmethionine decarboxylase isoform 2       137   6e-33    
gb|ADG38373.1|  AT3G02470-like protein                                  129   6e-33    
gb|KDD75116.1|  adenosylmethionine decarboxylase                        132   2e-32    
gb|ADG38370.1|  AT3G02470-like protein                                  128   3e-32    
gb|ADG38372.1|  AT3G02470-like protein                                  128   3e-32    
gb|AEN81738.1|  AT3G02470-like protein                                  128   3e-32    
gb|ADG38369.1|  AT3G02470-like protein                                  127   3e-32    
gb|ADG38371.1|  AT3G02470-like protein                                  127   4e-32    
ref|XP_004357207.1|  S-adenosylmethionine decarboxylase                 131   4e-32    
ref|XP_008353081.1|  PREDICTED: S-adenosylmethionine decarboxylas...    129   4e-32    
emb|CDX78666.1|  BnaA03g05780D                                          129   7e-32    
gb|ADG38367.1|  AT3G02470-like protein                                  127   8e-32    
emb|CBJ32442.1|  S-Adenosylmethionine decarboxylase                     130   1e-31    
emb|CCI40376.1|  unnamed protein product                                130   2e-31    
gb|ADG38368.1|  AT3G02470-like protein                                  125   2e-31    
ref|XP_003114618.1|  CRE-SMD-1 protein                                  128   4e-31    
gb|EIE80992.1|  adenosylmethionine decarboxylase                        128   1e-30    
gb|EGT32341.1|  hypothetical protein CAEBREN_00164                      127   1e-30    
ref|XP_002174770.1|  S-adenosylmethionine decarboxylase proenzyme...    127   1e-30    
ref|XP_459839.2|  DEHA2E12254p                                          127   3e-30    
emb|CEG63247.1|  Putative Adenosylmethionine decarboxylase              125   5e-30    
gb|EPX74124.1|  S-adenosylmethionine decarboxylase proenzyme Spe2       125   5e-30    
gb|EAY96506.1|  hypothetical protein OsI_18408                          125   5e-30    
emb|CEI85635.1|  Putative Adenosylmethionine decarboxylase              125   9e-30    
ref|XP_643401.2|  S-adenosylmethionine decarboxylase                    124   1e-29    



>sp|Q96471.1|DCAM_IPONI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea nil]
 gb|AAC04611.1| S-adenosylmethionine decarboxylase [Ipomoea nil]
Length=362

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEGYEKRLEISFFE  IF++P+G+GL++LSKEQLD+VL PAECTIVSSL+N
Sbjct  1    MALSTSAIGFEGYEKRLEISFFEAGIFSDPEGRGLRALSKEQLDKVLKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGL LKVKSV+YTRGSF F
Sbjct  61   NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLSLKVKSVKYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P  Q +PHRNFSEEV +LDGYFG LG+GSK+YVMGG   QQQWHVYSASA+SA++  P Y
Sbjct  121  PEVQPYPHRNFSEEVAILDGYFGKLGTGSKAYVMGGAGKQQQWHVYSASAESAENTFPIY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>sp|Q9M6K1.1|DCAM_IPOBA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Ipomoea batatas]
 gb|AAF71199.1|AF188998_1 S-adenosylmethionine decarboxylase [Ipomoea batatas]
 gb|AAN03494.1|AF291761_2 S-adenosylmethionine decarboxylase [Ipomoea batatas]
Length=362

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEGYE RLEISFFE  IF++P+G+GL++LSKEQLD+VL PAECTIVSSL+N
Sbjct  1    MALSTSAIGFEGYENRLEISFFEAGIFSDPEGRGLRALSKEQLDKVLKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGL LKVKSV+YTRGSF F
Sbjct  61   NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLSLKVKSVKYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P  Q +PHRNFSEEV +LD YFG L +GSK+YVMGG   QQQWHVYSASA+SA++  P Y
Sbjct  121  PEVQPYPHRNFSEEVAILDSYFGKLSTGSKAYVMGGAGKQQQWHVYSASAESAENTFPIY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|EYU28926.1| hypothetical protein MIMGU_mgv1a008898mg [Erythranthe guttata]
Length=359

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  S IGFEG+EKRLEISFFEP IF +P+G+GLQSLSK Q+D++L PAECTIVSSL+N
Sbjct  1    MALSASPIGFEGFEKRLEISFFEPSIFADPEGKGLQSLSKSQIDEILGPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL LA  L L V++VRYTRGSFIF
Sbjct  61   EHIDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILNLAKSLSLSVQTVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHRNFSEEV VLDGYFG LGSGSK+YVMGG D +Q+WH+YSA A S + E+P Y
Sbjct  121  PGAQSYPHRNFSEEVAVLDGYFGKLGSGSKAYVMGGSDKEQKWHIYSACAASVEAENPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>emb|CAD20741.1| S-adenosyl-L-methionine decarboxylase [Vitis vinifera]
Length=228

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP IF +P G GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFFEPGIFADPVGMGLRSLSKTQLDEILEPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA+ LDL V+SV+YTRGSFIF
Sbjct  61   DEVDSYVLSESSLFVYHYKIIIKTCGTTKLLLSIPPILKLANSLDLSVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHRNFSEEV  LDG+FG LG+GSK+Y+MG  D  Q+WHVY+A+A+      P Y
Sbjct  121  PGAQSFPHRNFSEEVVELDGHFGELGAGSKAYMMGSHDKPQKWHVYTAAAEFTGRSDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AGT80621.1| S-adenosylmethionine decarboxylase [Camellia sinensis]
Length=359

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVS IGFEGYEKRLEISFFE  IF +P+  GL+SLSK QLD++LNPAECTIVSSLAN
Sbjct  1    MALPVSPIGFEGYEKRLEISFFESSIFADPRSNGLRSLSKSQLDEILNPAECTIVSSLAN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+ A+ L L V+SVRYTRGSFIF
Sbjct  61   DDVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKFAEMLSLSVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHR+FSEEV VLDGYFG LGSGSK+YVMG  D  ++WH+YSASA+S +   P Y
Sbjct  121  PGAQPFPHRDFSEEVAVLDGYFGKLGSGSKAYVMGSDDESRKWHIYSASAESTNHLRPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_007045669.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
 gb|EOY01501.1| S-adenosylmethionine decarboxylase proenzyme [Theobroma cacao]
Length=359

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            V ++M VSAIGFEGYEKRLEISFFEP IF +P+G+GL+SLSK QLD++L PAECTIVSSL
Sbjct  2    VDIAMAVSAIGFEGYEKRLEISFFEPGIFVDPEGKGLRSLSKAQLDEILGPAECTIVSSL  61

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N +VDSYVLSESSLFVYPYKIIIKTCGTTKLLL+IPPIL+LA GL L +KSVRYTRGSF
Sbjct  62   SNKQVDSYVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGGLSLAIKSVRYTRGSF  121

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQ +PHRNFSEEV +LD YFG LG GSK+YVMGG+D +Q+WHVYSASA++     P
Sbjct  122  IFPGAQPYPHRNFSEEVAILDSYFGKLGGGSKAYVMGGLD-KQKWHVYSASAEAVISSGP  180

Query  726  TYTLEMCMT  752
             YT+EMC+T
Sbjct  181  IYTVEMCLT  189



>ref|XP_002282704.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282708.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_002282716.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 ref|XP_010660528.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
 emb|CAN75613.1| hypothetical protein VITISV_022291 [Vitis vinifera]
Length=360

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP IF +P G GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFFEPGIFADPVGMGLRSLSKTQLDEILEPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LA+ LDL V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLANSLDLSVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHRNFSEEV  LDG+FG LG+GSK+Y+MG  D  Q+WHVY+A+A+      P Y
Sbjct  121  PGAQSFPHRNFSEEVVELDGHFGKLGAGSKAYMMGSHDKPQKWHVYTAAAEFTGRLDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|KEH16884.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=353

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISF +P +F++P G+GL+SL+K QLD++L PAECTIVSSLAN++
Sbjct  1    MAVSAIGFEGFEKRLEISFSDPGLFSDPHGRGLRSLTKSQLDEILAPAECTIVSSLANDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ + LKV+SVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLKVRSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLDGYFG LGSGS +Y+MGG D  Q WHVYSASADS       YTL
Sbjct  121  AQSFPHRHFSEEVAVLDGYFGKLGSGSTAYIMGGSDEAQNWHVYSASADSVSPNDSVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_010660529.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=405

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP IF +P G GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  46   MALPVSAIGFEGYEKRLEISFFEPGIFADPVGMGLRSLSKTQLDEILEPAECTIVSSLSN  105

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LA+ LDL V+SV+YTRGSFIF
Sbjct  106  DDVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLANSLDLSVRSVKYTRGSFIF  165

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHRNFSEEV  LDG+FG LG+GSK+Y+MG  D  Q+WHVY+A+A+      P Y
Sbjct  166  PGAQSFPHRNFSEEVVELDGHFGKLGAGSKAYMMGSHDKPQKWHVYTAAAEFTGRLDPVY  225

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  226  TLEMCMT  232



>gb|ABO77440.1| S-adenosylmethionine decarboxylase [Medicago falcata]
Length=353

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISF +P +F++P G+GL+SL+K QLD++L PAECTIVSSLAN++
Sbjct  1    MAVSAIGFEGFEKRLEISFSDPGLFSDPHGRGLRSLTKSQLDEILAPAECTIVSSLANDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ + LKV+SVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLKVRSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLDGYFG LGSGS +Y+MGG D    WHVYSASADS       YTL
Sbjct  121  AQSFPHRHFSEEVAVLDGYFGKLGSGSTAYIMGGSDEAHNWHVYSASADSVSPNDSVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>gb|KHG07410.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=355

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 162/185 (88%), Gaps = 1/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEISFFEP IF +P+G+GL++L++ QLDQ+L PAECTIVSSL+N +
Sbjct  1    MAVSAIGFEGYEKRLEISFFEPGIFADPEGKGLRALTRAQLDQILGPAECTIVSSLSNKQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLL+IPPIL+LA  L L VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGSLSLAVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ FPHRNFSEEV VLD YFG LG+GSK+ VMGG+D +Q+WHVYSASA+      P YTL
Sbjct  121  AQPFPHRNFSEEVAVLDNYFGKLGAGSKACVMGGLD-KQKWHVYSASAEPVTTTGPVYTL  179

Query  738  EMCMT  752
            EMC+T
Sbjct  180  EMCLT  184



>ref|XP_011077597.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Sesamum 
indicum]
Length=349

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEG+EKRLEISFFEP IF +P+G+GL+SLSK QLD++L PAECTIV+SL+N
Sbjct  1    MALPVSAIGFEGFEKRLEISFFEPSIFADPEGKGLRSLSKAQLDEILGPAECTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA  L L V+SVRYTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAQCLSLSVQSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FS+EV VLD +F  LGSG K+YVMG  D QQ+WHVYSA A + +   P Y
Sbjct  121  PGAQSYPHRSFSDEVAVLDSHFAKLGSGRKAYVMGSPDKQQKWHVYSACAGTVEATSPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|ADF81048.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEG+EKRLEISFFEP  F +P+G+GL+SLSK QLD++L PA+CTIV+SL+N
Sbjct  1    MALTASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LA  L L V+ V+YTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLG-SGSKSYVMGGVDPQQQWHVYSASADSADDEHPT  728
            PGAQSFPHR+FSEEV VLDGYFG LG SGSK+YVMG  D +QQWH+YSASA S + + P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKRQQWHIYSASAGSVECDSPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|XP_002314904.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEF01075.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=355

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M + VSAIGFEGYEKRLEI++FEP IF +P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MDLAVSAIGFEGYEKRLEITYFEPGIFDDPEGKGLRSLSKPQLDEILGPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD L L V+SVRYTRGSFIF
Sbjct  61   DYVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILKLADTLSLNVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FSEE+ VLDG FG LG  SK+Y+MGG+D  Q+WHVYSASADSA      Y
Sbjct  121  PGAQSYPHRSFSEEIAVLDGCFGKLGLASKAYIMGGLDKPQKWHVYSASADSARSRDLIY  180

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  181  TIEMCMT  187



>ref|XP_008243751.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Prunus 
mume]
Length=357

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEG+EKRLEISFFEP IF +P+G+GL+SL+K Q+D +L+ AECTIVSSL+N
Sbjct  1    MAMAVSAIGFEGFEKRLEISFFEPSIFVDPEGRGLRSLAKAQIDALLDEAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+YPYK+IIKTCGTTKLLL IPP+L+LA+ + L V++V+YTRGSFIF
Sbjct  61   DHVDSYVLSESSLFIYPYKMIIKTCGTTKLLLVIPPLLKLAETISLAVRAVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHRNFSEEV VLDGYFG LGSGS++YVMG  D  Q+WHVYSASA+S     P Y
Sbjct  121  PGAQSYPHRNFSEEVSVLDGYFGKLGSGSRAYVMGRSDGPQKWHVYSASAESGSLADPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_007225621.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
 gb|EMJ26820.1| hypothetical protein PRUPE_ppa007732mg [Prunus persica]
Length=357

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEG+EKRLEISFFEP IF +P+G+GL+SL+K Q+D +L+ AECTIVSSL+N
Sbjct  1    MAMAVSAIGFEGFEKRLEISFFEPSIFVDPEGRGLRSLAKAQIDALLDEAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+YPYK+IIKTCGTTKLLL IPP+L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DHVDSYVLSESSLFIYPYKMIIKTCGTTKLLLVIPPLLKLAETISLSVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHRNFSEEV VLDGYFG LGSGS++YVMG  D  Q+WHVYSASA+S     P Y
Sbjct  121  PGAQSYPHRNFSEEVSVLDGYFGKLGSGSRAYVMGRSDGPQKWHVYSASAESGSLVDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|ADD91750.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEG+EKRLEISFFEP  F +P+G+GL+SLSK QLD++L PA+CTIV+SL+N
Sbjct  1    MALTASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LA  L L V+ V+YTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLG-SGSKSYVMGGVDPQQQWHVYSASADSADDEHPT  728
            PGAQSFPHR+FSEEV VLDGYFG LG SGSK+YVMG  D +QQWH+YSASA S + + P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKRQQWHIYSASAGSVECDSPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>gb|AEI98604.1| S-adenosylmethionine decarboxylase [Gossypium hirsutum]
Length=355

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 161/185 (87%), Gaps = 1/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEISFFEP IF +P+G+GL++L+K QLD++L PAECTIVSSL+N +
Sbjct  1    MAVSAIGFEGYEKRLEISFFEPGIFADPEGKGLRALTKAQLDEILGPAECTIVSSLSNKQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLL+IPPIL+LA  L L VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLAGSLSLAVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ FPHRNFSEEV VLD YFG LG+G K+ VMGG+D +Q+WHVYSASA+      P YTL
Sbjct  121  AQPFPHRNFSEEVAVLDNYFGKLGAGGKACVMGGLD-KQKWHVYSASAEPVTATGPVYTL  179

Query  738  EMCMT  752
            EMC+T
Sbjct  180  EMCLT  184



>sp|O80402.1|DCAM_NICSY RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana sylvestris]
 dbj|BAA29040.1| S-adenosylmethionine decarboxylase [Nicotiana sylvestris]
Length=361

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            + M++PVSAIGFEG+EKRLEISFFEP +F +P G+GL+SLSK QLD++L PAECTIV SL
Sbjct  1    MDMALPVSAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N++VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDDVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_009622584.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=384

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 166/190 (87%), Gaps = 3/190 (2%)
 Frame = +3

Query  189  KMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLA  368
            KM++PVSAIGFEGYEKRLEI+FFE  +   P G GL+SLSK+QLD++L PA CTIVSSLA
Sbjct  22   KMAVPVSAIGFEGYEKRLEITFFELGMSDGP-GCGLRSLSKDQLDEILTPAACTIVSSLA  80

Query  369  NNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFI  548
            N+EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LAD L+LKVKSVRYTRGSFI
Sbjct  81   NDEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGSFI  140

Query  549  FPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS--ADDEH  722
            FPGAQ +PHR+FSEEV VLD YFG LG+GS +YVMG  D QQ WHVYSASA+S  A++ +
Sbjct  141  FPGAQPYPHRHFSEEVAVLDSYFGKLGAGSSAYVMGNADKQQNWHVYSASAESANANNPN  200

Query  723  PTYTLEMCMT  752
            P YTLEMCMT
Sbjct  201  PVYTLEMCMT  210



>sp|Q9M4D8.1|DCAM_VICFA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Vicia faba]
 emb|CAB76966.1| S-adenosylmethionine decarboxylase [Vicia faba]
Length=353

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISF +P +F++P+G+GL+SL+K QLD++L PAECTIVSSLAN +
Sbjct  1    MAVSAIGFEGFEKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANED  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ + L V++VRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKLAESISLDVRAVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLDG+FG LGSGSK+Y+MGG D  Q WHVY ASADS       YTL
Sbjct  121  AQSFPHRHFSEEVAVLDGFFGKLGSGSKAYIMGGSDEAQNWHVYCASADSVSPADSVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>sp|Q43820.1|DCAM_PEA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Pisum sativum]
 gb|AAB03865.1| S-adenosylmethionine decarboxylase [Pisum sativum]
Length=353

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISF +P +F++P+G+GL+SL+K QLD++L PAECTIVSSLAN +
Sbjct  1    MAVSAIGFEGFEKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANED  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YK+IIKTCGTTKLLLSIPPIL+LAD + L V+SVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKLIIKTCGTTKLLLSIPPILKLADSISLNVRSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLDG+FG LGSGS +Y++GG D  Q WH+Y AS+DS   E   YTL
Sbjct  121  AQSFPHRHFSEEVAVLDGFFGKLGSGSMAYILGGSDEAQNWHIYCASSDSVSPEGSVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_011008996.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Populus euphratica]
Length=406

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M + VSAIGFEGYEKRLEI++FEP IF +P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  52   MDLAVSAIGFEGYEKRLEITYFEPGIFDDPEGKGLRSLSKPQLDEILGPAECTIVDSLSN  111

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD L L V+SVRYTRGSFIF
Sbjct  112  DYVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPTILKLADTLSLNVRSVRYTRGSFIF  171

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FSEEV VLDG+FG LG  SK+Y+MGG+D  Q+WHVYSASADSA      Y
Sbjct  172  PGAQSYPHRSFSEEVAVLDGFFGKLGLASKAYIMGGLDKPQKWHVYSASADSALSHDLIY  231

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  232  TIEMCMT  238



>sp|Q9AXE3.1|DCAM_DAUCA RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Daucus carota]
 gb|AAG61146.1|AF334029_1 S-adenosyl-methionine decarboxylase [Daucus carota]
Length=361

 Score =   295 bits (755),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            MS  VSAIGFEG+EKRLEISFFEP  F +P+G+GL+ LSK QLD+ L PAECTIV+SL+N
Sbjct  1    MSSEVSAIGFEGFEKRLEISFFEPSFFADPEGKGLRVLSKNQLDEFLGPAECTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVY YKIIIKTCGTTKLL SIPPIL+LAD L L V+SVRYTRG FIF
Sbjct  61   EHVDSYVLSESSLFVYAYKIIIKTCGTTKLLKSIPPILKLADSLSLTVRSVRYTRGCFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FSEEV VLD YFG LGSGSK+Y+MGG D QQ+WHVYSA A S     P Y
Sbjct  121  PGAQSYPHRSFSEEVSVLDNYFGKLGSGSKAYIMGGSDKQQKWHVYSACAASTRTLDPVY  180

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  181  TMEMCMT  187



>gb|AAR84406.1| S-adenosylmethionine decarboxylase [Daucus carota]
 gb|AAR84408.1| S-adenosylmethionine decarboxylase [Daucus carota]
Length=361

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            MS  VSAIGFEG+EKRLEISFFEP  F +P+G+GL+ LSK QLD+ L PAECTIV+SL+N
Sbjct  1    MSSEVSAIGFEGFEKRLEISFFEPSFFADPEGKGLRVLSKNQLDEFLGPAECTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVY YKIIIKTCGTTKLL SIPPIL+LAD L L V+SVRYTRG FIF
Sbjct  61   EHVDSYVLSESSLFVYAYKIIIKTCGTTKLLKSIPPILKLADSLSLTVRSVRYTRGCFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FSEEV VLD YFG LGSGSK+Y+MGG D QQ+WHVYSA A S     P Y
Sbjct  121  PGAQSYPHRSFSEEVSVLDNYFGKLGSGSKAYIMGGSDKQQKWHVYSACAASTRTLDPVY  180

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  181  TMEMCMT  187



>gb|ADF81049.1| S-adenosylmethionine decarboxylase [Salvia miltiorrhiza]
Length=360

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEG+EKRLEISFFEP  F +P+G+GL+SLSK QLD++L PA+CTIV+SL+N
Sbjct  1    MALTASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVYPYKIIIK CGTTKLLLSIPPIL+LA  L L V+ V+YTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYPYKIIIKACGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLG-SGSKSYVMGGVDPQQQWHVYSASADSADDEHPT  728
            PGAQSFPHR+FSEEV VLDGYFG LG SGSK+YVMG  D +QQWH+YSASA S + + P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKRQQWHIYSASAGSVECDSPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|XP_009764781.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=362

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 165/189 (87%), Gaps = 3/189 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEI+FFE  +   P G GL+SLSK+QLD++L PA CTIVSSLAN
Sbjct  1    MAVPVSAIGFEGYEKRLEITFFELGMSDGP-GCGLRSLSKDQLDEILTPAACTIVSSLAN  59

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LAD L+LKVKSVRYTRGSFIF
Sbjct  60   DEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGSFIF  119

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS--ADDEHP  725
            PGAQ +PHR+FSEEV VLD YFG LG+GS +YVMG  D QQ WHVYSASA+S  A++ +P
Sbjct  120  PGAQPYPHRHFSEEVAVLDSYFGKLGAGSSAYVMGNADKQQSWHVYSASAESANANNPNP  179

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  180  VYTLEMCMT  188



>gb|ADD91751.1| S-adenosylmethionine decarboxylase proenzyme [Salvia miltiorrhiza]
Length=354

 Score =   294 bits (753),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEG+EKRLEISFFEP  F +P+G+GL+SLSK QLD++L PA+CTIV+SL+N
Sbjct  1    MALTASAIGFEGFEKRLEISFFEPSFFADPEGKGLRSLSKSQLDEILQPAQCTIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVYPYKIIIK CGTTKLLLSIPPIL+LA  L L V+ V+YTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYPYKIIIKACGTTKLLLSIPPILKLAGLLSLSVQDVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLG-SGSKSYVMGGVDPQQQWHVYSASADSADDEHPT  728
            PGAQSFPHR+FSEEV VLDGYFG LG SGSK+YVMG  D +QQWH+YSASA S + + P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYFGKLGSSGSKAYVMGSSDKRQQWHIYSASAGSVECDSPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>emb|CAN66014.1| hypothetical protein VITISV_041154 [Vitis vinifera]
Length=357

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISF EP IF++P+G+GL+SLS+ QLD++L PAECTIV SL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECTIVGSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LAD L L V  VRYTRGSF F
Sbjct  61   DIVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADTLSLSVSCVRYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHR+FSEEV VLD YFG LGSGSK+YVMG  D  Q+WHVYSASA+      P Y
Sbjct  121  PGAQPYPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDKSQKWHVYSASAEVRSACDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_009625495.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nicotiana 
tomentosiformis]
Length=402

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEG+EKRLEISFFEP +F +P G GL+SLSK QLD++L PAECTIV SL+N
Sbjct  51   MALPVSAIGFEGFEKRLEISFFEPGLFADPNGNGLRSLSKAQLDEILGPAECTIVDSLSN  110

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSFIF
Sbjct  111  DDVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAESLSLKVQDVRYTRGSFIF  170

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P Y
Sbjct  171  PGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVY  230

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  231  TLEMCMT  237



>ref|XP_002514534.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF47640.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=361

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            V M M VSAIGFEGYEKRLEISFFE  +F +P+G+GL+SLSK QLD +L PAECTIV SL
Sbjct  2    VNMEMAVSAIGFEGYEKRLEISFFELGMFVDPEGKGLRSLSKAQLDMILGPAECTIVDSL  61

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N  VDSYVLSESSLFVYPYKIIIKTCGTTKLLL+IPPIL+LAD L L VKSVRYTRGSF
Sbjct  62   SNENVDSYVLSESSLFVYPYKIIIKTCGTTKLLLAIPPILKLADALSLNVKSVRYTRGSF  121

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQS+PHR+FSEEV VLD YFG LG+GS +YVMGG+   Q+WHVYSASA S      
Sbjct  122  IFPGAQSYPHRSFSEEVAVLDDYFGKLGAGSTAYVMGGLHSPQKWHVYSASAHSTYCCDC  181

Query  726  TYTLEMCMT  752
             YT+EMCMT
Sbjct  182  VYTIEMCMT  190



>emb|CAD98785.2| S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera]
Length=358

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISF EP IF++P+G+GL+SLS+ QLD++L PAECTIV SL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECTIVGSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LAD L L V  VRYTRGSF F
Sbjct  61   DIVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADTLSLSVSCVRYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHR+FSEEV VLD YFG LGSGSK+YVMG  D  Q+WHVYSASA+      P Y
Sbjct  121  PGAQPYPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDKSQKWHVYSASAEVRSACDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_004490299.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
 gb|ACL14489.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
 gb|ACL14490.1| S-adenosylmethionine decarboxylase [Cicer arietinum]
Length=353

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEI F +P +F++P+G+GL+SL+K QLD++L PAECTIVSSLAN++
Sbjct  1    MAVSAIGFEGFEKRLEICFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLANDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA+ + LKV+SVRY+RGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAESISLKVRSVRYSRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQS+PHR+FSEEV VLDGYFG LGSGS +Y+MGG +  Q WHVYSASADS       YTL
Sbjct  121  AQSYPHRHFSEEVAVLDGYFGKLGSGSMAYIMGGSNEAQNWHVYSASADSVSPIDSVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_004233654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicum]
Length=417

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 162/190 (85%), Gaps = 3/190 (2%)
 Frame = +3

Query  189  KMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLA  368
            KM +PVSAIGFEGYEKRLEI FFE      P G GL+SLSK+QLD++L PA CTIVSSLA
Sbjct  55   KMELPVSAIGFEGYEKRLEICFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLA  113

Query  369  NNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFI  548
            N+EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LAD L+LKVKSVRYTRGSFI
Sbjct  114  NDEVDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLADSLNLKVKSVRYTRGSFI  173

Query  549  FPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD--DEH  722
            FPGAQ FPHR+FSEEV VLD YFG LG+GS SYVMG  D QQ WHVYSASA+ AD  + +
Sbjct  174  FPGAQPFPHRHFSEEVAVLDTYFGKLGAGSNSYVMGNADKQQNWHVYSASAEPADANNVN  233

Query  723  PTYTLEMCMT  752
            P YTLEMCMT
Sbjct  234  PVYTLEMCMT  243



>sp|O04009.1|DCAM_TOBAC RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAB51301.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            ++PVSAIGFEG+EKRLEISFFEP +F +P G+GL+SLSK QLD++L PAECTIV SL+N+
Sbjct  4    ALPVSAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSND  63

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
            +VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSFIFP
Sbjct  64   DVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFP  123

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYT  734
            GAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P YT
Sbjct  124  GAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVYT  183

Query  735  LEMCMT  752
            LEMCMT
Sbjct  184  LEMCMT  189



>emb|CDP02379.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEG+EKRLEISFFEP IF +P G+GL++LS  QLD++L PA CTIVSSL+N
Sbjct  1    MALPVSAIGFEGFEKRLEISFFEPGIFADPGGRGLRALSNYQLDEILKPAHCTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
             EVDSYVLSESSLF++PYKII+KTCGTTKLLLSIP IL+ A  L L VKSVRY+RGSFIF
Sbjct  61   GEVDSYVLSESSLFIFPYKIILKTCGTTKLLLSIPLILKFAGDLKLTVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHRNFSEEV VL+ YFG LG+GS++Y+MGG D QQ+WHVYSASA+  ++  P Y
Sbjct  121  PGAQPYPHRNFSEEVAVLNSYFGKLGAGSRAYLMGGADKQQKWHVYSASAEHMENMDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>dbj|BAF91878.1| S-adenosylmethionine decarboxylase [Nicotiana benthamiana]
Length=296

 Score =   291 bits (744),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            ++PVSAIGFEG+EKRLEISFFE  +F +P G+GL+SLSK QLD++L PAECTIV SL+N+
Sbjct  1    ALPVSAIGFEGFEKRLEISFFETGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSND  60

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
            +VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSFIFP
Sbjct  61   DVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFP  120

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYT  734
            GAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P YT
Sbjct  121  GAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|AAB88854.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=361

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            ++PVSAIGFEG+EKRLEISFFEP +F +P G+GL+SLSK QLD++L PAECTIV SL+N+
Sbjct  4    ALPVSAIGFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSND  63

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
            +VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSFIFP
Sbjct  64   DVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFP  123

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYT  734
            GAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P YT
Sbjct  124  GAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVYT  183

Query  735  LEMCMT  752
            LEMCMT
Sbjct  184  LEMCMT  189



>gb|ADH95190.1| S-adenosylmethionine decarboxylase [Arachis hypogaea]
Length=358

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            + M++PVSAIGFEGYEKRLEI F  P +F++P+G+GL+SL+K QLD++L PAECTIVSSL
Sbjct  1    MAMAVPVSAIGFEGYEKRLEICFSHPGLFSDPEGKGLRSLTKSQLDEILAPAECTIVSSL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            ++N+VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL LA+ L L VKSVRYTRGSF
Sbjct  61   SSNDVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILRLAETLSLNVKSVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVM-GGVDPQQQWHVYSASADSADDEH  722
            IFPGAQSFPHR+FSEEV +LD +FG LGSGS +Y+M GG+D  Q+WHVYSASA+S     
Sbjct  121  IFPGAQSFPHRSFSEEVAILDSHFGKLGSGSMAYIMGGGIDKPQKWHVYSASAESVSPCD  180

Query  723  PTYTLEMCMT  752
              YTLEMCMT
Sbjct  181  SVYTLEMCMT  190



>ref|XP_010654269.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X1 [Vitis vinifera]
Length=360

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISF EP IF++P+G+GL+SLS+ QLD++L PAEC IV SL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECIIVGSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LAD L L V  VRYTRGSF F
Sbjct  61   DIVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADALSLSVSCVRYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHR+FSEEV VLD YFG LGSGSK+YVMG  D  Q+WHVYSASA+      P Y
Sbjct  121  PGAQPYPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDKSQKWHVYSASAEVRSACDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_004490298.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
Length=411

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            ++M VSAIGFEG+EKRLEI F +P +F++P+G+GL+SL+K QLD++L PAECTIVSSLAN
Sbjct  57   LAMAVSAIGFEGFEKRLEICFSDPGLFSDPQGRGLRSLTKSQLDEILAPAECTIVSSLAN  116

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA+ + LKV+SVRY+RGSFIF
Sbjct  117  DDVDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLAESISLKVRSVRYSRGSFIF  176

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQS+PHR+FSEEV VLDGYFG LGSGS +Y+MGG +  Q WHVYSASADS       Y
Sbjct  177  PGAQSYPHRHFSEEVAVLDGYFGKLGSGSMAYIMGGSNEAQNWHVYSASADSVSPIDSVY  236

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  237  TLEMCMT  243



>ref|XP_006338297.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=362

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M +PVSAIGFEGYEKRLEI FFE      P G GL+SLSK+QLD++L PA CTIVSSLAN
Sbjct  1    MELPVSAIGFEGYEKRLEICFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLAN  59

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LAD L+LKVKSVRYTRG FIF
Sbjct  60   DEVDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLADALNLKVKSVRYTRGCFIF  119

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD--DEHP  725
            PGAQ +PHR+FSEEV VLD YFG LG+GS +YVMG  D QQ WHVYSASA+SAD  + +P
Sbjct  120  PGAQPYPHRHFSEEVAVLDTYFGKLGAGSNAYVMGNADKQQNWHVYSASAESADANNMNP  179

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  180  VYTLEMCMT  188



>sp|Q04694.1|DCAM_SOLTU RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; AltName: Full=Induced stolen tip 
protein TUB13; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA77742.1| induced stolon tip protein [Solanum tuberosum]
Length=360

 Score =   292 bits (747),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SLSK QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA S     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKTQKWHVYSASAGSVQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>emb|CDP00521.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP IF +P+G+GL+SL+K QLD++L PAECTIVS+L+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFFEPSIFADPEGKGLRSLTKTQLDEILEPAECTIVSTLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFV+PYKIIIKTCGTTKLLLSIPPIL+LA+ L L V++V+YT GSFIF
Sbjct  61   KYLDSYVLSESSLFVHPYKIIIKTCGTTKLLLSIPPILKLAESLSLTVRAVKYTHGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV +LD YFG LGSGSK++VMG     Q+WHVY ASA S     P Y
Sbjct  121  PGAQSFPHRSFSEEVALLDSYFGKLGSGSKAFVMGDSGQPQKWHVYYASAGSEQSSDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_004297173.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 2 [Fragaria vesca subsp. vesca]
 ref|XP_004297174.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 3 [Fragaria vesca subsp. vesca]
Length=359

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            MSM  SAIGFEGYEKRLEI+FFEP +F +P+G+GL+SLSK QLD+ L  AECTIVSSL+N
Sbjct  1    MSMAGSAIGFEGYEKRLEIAFFEPSVFRDPEGRGLRSLSKSQLDEFLGQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF+Y YK+IIKTCGTTKLLL+IPPIL+LA+ + L V+SVRYTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIYSYKLIIKTCGTTKLLLAIPPILKLAESIGLTVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHRNFSEEV  LD YFG LG GS++Y+MGG    Q+WHVYSASA+ A    P Y
Sbjct  121  PGAQSFPHRNFSEEVSTLDAYFGKLGGGSRAYMMGGSAGPQKWHVYSASAEPAHLVDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AAZ85231.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicoides]
Length=343

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKSQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_010325052.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum lycopersicum]
Length=364

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            +++PVSAIGFEGYEKRLEISFFEP +F +P+G+GL+SLSK QLD+ L PAECTIV SL+N
Sbjct  2    VALPVSAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSLSN  61

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLF+YPYKI+IKTCGTTKLLLSIP IL+LAD L LKV++V+YTRGSFIF
Sbjct  62   ECVDSYVLSESSLFIYPYKIVIKTCGTTKLLLSIPVILKLADTLSLKVQAVKYTRGSFIF  121

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLD YFG L SGSK+ ++G  D  Q+WHVYSASA S   ++P Y
Sbjct  122  PGAQSFPHRHFSEEVAVLDSYFGNLSSGSKAVILGSHDNLQKWHVYSASAGSIQTKNPVY  181

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  182  TLEMCMT  188



>gb|AFV67665.1| S-adenosylmethionine decarboxylase [Capsicum annuum]
Length=364

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 161/189 (85%), Gaps = 3/189 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M +PVSAIGFEGYEKRLEI FFE      P G GL+SLSK+QLD++L PA CTIVSSLAN
Sbjct  1    MDLPVSAIGFEGYEKRLEIFFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLAN  59

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+ AD LDLKVKSVRYTRGSFIF
Sbjct  60   DEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKSADSLDLKVKSVRYTRGSFIF  119

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD--DEHP  725
            PGAQ +PHR+FSEEV VLD YFG LG+GS +YVMG  D QQ WHVYSASA+SAD  + +P
Sbjct  120  PGAQPYPHRHFSEEVAVLDSYFGKLGAGSSAYVMGSADKQQNWHVYSASAESADANNVNP  179

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  180  VYTLEMCMT  188



>ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=410

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISF EP IF++P+G+GL+SLS+ QLD++L PAEC IV SL+N
Sbjct  51   MALPVSAIGFEGYEKRLEISFSEPGIFSDPEGRGLRSLSRAQLDEILEPAECIIVGSLSN  110

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LAD L L V  VRYTRGSF F
Sbjct  111  DIVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLADALSLSVSCVRYTRGSFNF  170

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHR+FSEEV VLD YFG LGSGSK+YVMG  D  Q+WHVYSASA+      P Y
Sbjct  171  PGAQPYPHRHFSEEVAVLDSYFGKLGSGSKAYVMGSSDKSQKWHVYSASAEVRSACDPVY  230

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  231  TLEMCMT  237



>gb|ADV29171.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQRNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AEO52839.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD+VL PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEVLGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAZ85232.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85233.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85234.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85235.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85236.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85238.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85239.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85240.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29125.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29126.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
Length=343

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAZ85237.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
 gb|AAZ85241.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chmielewskii]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21876.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21912.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21873.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGAVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_006348617.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=360

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SLSK QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  +  Q+WHVYSASA S     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPNKTQKWHVYSASAGSVQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29140.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAX56884.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56888.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56893.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56895.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56901.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21894.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29169.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29175.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|AEO52833.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAX56882.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56883.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56885.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56887.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56891.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56892.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56894.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56896.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56897.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56898.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56899.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56900.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AAX56902.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56903.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56904.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56906.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56907.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56908.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|AAX56909.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
 gb|ABW21864.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21865.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21869.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21870.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21871.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21872.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21879.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21880.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21881.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21882.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21884.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21891.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21892.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21893.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21897.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21905.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21909.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21910.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21911.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21914.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21916.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21918.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21926.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21929.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ADV29115.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29116.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29117.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29118.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29119.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29120.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29121.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29122.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29123.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29124.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29127.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29128.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29129.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29130.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29131.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29132.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29133.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29134.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29135.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29136.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29137.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29138.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29139.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29141.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29142.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29143.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29144.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29145.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29146.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29147.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29148.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29149.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29150.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29151.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29152.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29153.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29154.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29155.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29156.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29157.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29158.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29159.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29160.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29161.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29162.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29163.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29164.1| S-adenosylmethionine decarboxylase proenzyme [Solanum habrochaites]
 gb|ADV29174.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|AEO52757.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52759.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52760.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52761.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52762.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52764.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52765.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52766.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
 gb|AEO52832.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52836.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52838.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52840.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52843.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52845.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21887.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21888.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21901.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21902.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21903.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21904.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21908.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21913.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|AEO52763.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29203.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29194.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21885.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21896.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29184.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21878.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AEO52837.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21925.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29165.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29166.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29167.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29168.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29172.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29173.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29179.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29180.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29182.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29183.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29187.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29188.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29189.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29190.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29191.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29192.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29195.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29196.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29197.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29201.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29204.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21900.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21906.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAZ85242.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85243.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85244.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85245.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85246.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85247.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85248.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85249.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85250.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
 gb|AAZ85251.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
pimpinellifolium]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29170.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>sp|Q96555.1|DCAM_DATST RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Datura stramonium]
 emb|CAA69076.1| S-adenosylmethionine decarboxylase [Datura stramonium]
Length=362

 Score =   290 bits (742),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F++P G+GL+SLSK QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFSDPNGKGLRSLSKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGPVQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAX56886.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AAX56890.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ADV29176.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29177.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29178.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29181.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21931.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21889.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=344

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21919.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21920.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21921.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21922.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21923.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21924.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21927.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21928.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21930.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29198.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29199.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29200.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29202.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   289 bits (740),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAX56905.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
habrochaites]
Length=343

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AAB32507.1| S-adenosylmethionine decarboxylase [Solanum tuberosum]
Length=360

 Score =   290 bits (741),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SLSK QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKTQKWHVYSASAGPVQSNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21898.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21899.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
 gb|ABW21907.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21917.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQFNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AEO52817.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum ochranthum]
Length=343

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKTQKWHVYSASAGTVQYNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABY55856.1| S-adenosylmethionine decarboxylase 3 [Solanum lycopersicum]
Length=364

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            +++PVSAIGFEGYEKRLEISFFEP +F +P+G+GL+SLSK QLD+ L PAECTIV SL N
Sbjct  2    VALPVSAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSLFN  61

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLF+YPYKI+IKTCGTTKLLLSIP IL+LAD L LKV++V+YTRGSFIF
Sbjct  62   ECVDSYVLSESSLFIYPYKIVIKTCGTTKLLLSIPVILKLADTLSLKVQAVKYTRGSFIF  121

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLD YFG L SGSK+ ++G  D  Q+WHVYSASA S   ++P Y
Sbjct  122  PGAQSFPHRHFSEEVAVLDSYFGNLSSGSKAVILGSHDNLQKWHVYSASAGSIQTKNPVY  181

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  182  TLEMCMT  188



>ref|NP_001234699.1| S-adenosylmethionine decarboxylase [Solanum lycopersicum]
 gb|ABQ42184.1| S-adenosylmethionine decarboxylase [Solanum lycopersicum]
 gb|ABY55854.1| S-adenosylmethionine decarboxylase 1 [Solanum lycopersicum]
Length=360

 Score =   289 bits (739),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AEO52841.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKPQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABW21863.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21866.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21867.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21868.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21874.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21875.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21877.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|ABW21883.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
 gb|AEO52834.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52835.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
 gb|AEO52844.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   288 bits (738),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY Y+IIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYRIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_004297172.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=409

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            MSM  SAIGFEGYEKRLEI+FFEP +F +P+G+GL+SLSK QLD+ L  AECTIVSSL+N
Sbjct  51   MSMAGSAIGFEGYEKRLEIAFFEPSVFRDPEGRGLRSLSKSQLDEFLGQAECTIVSSLSN  110

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF+Y YK+IIKTCGTTKLLL+IPPIL+LA+ + L V+SVRYTRGSFIF
Sbjct  111  DDVDSYVLSESSLFIYSYKLIIKTCGTTKLLLAIPPILKLAESIGLTVRSVRYTRGSFIF  170

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHRNFSEEV  LD YFG LG GS++Y+MGG    Q+WHVYSASA+ A    P Y
Sbjct  171  PGAQSFPHRNFSEEVSTLDAYFGKLGGGSRAYMMGGSAGPQKWHVYSASAEPAHLVDPVY  230

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  231  TLEMCMT  237



>gb|ABW21886.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  ++WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTRKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ADV29185.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
 gb|ADV29186.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTL+MCMT
Sbjct  181  VYTLDMCMT  189



>ref|XP_010091687.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXB44953.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=360

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLE++F+EP IF +P+G+GL+SLSK QLD++L PAECTIV++L+N  
Sbjct  1    MAVSAIGFEGYEKRLELTFYEPSIFLDPQGKGLRSLSKAQLDEILQPAECTIVATLSNEH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLL SIPPIL+L + L L VKSVRY+RGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLRSIPPILKLTETLSLAVKSVRYSRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ FPH +F EEV VLD YFG LGSGS++YVMG     Q+WHVYSASAD+A    P YTL
Sbjct  121  AQPFPHHSFVEEVAVLDSYFGKLGSGSRAYVMGNSQEPQKWHVYSASADTASSVDPVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>gb|AEO52842.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum peruvianum]
Length=343

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L  GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLADGSKAVIMGNPDKTQKWHVYSASAGTIQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|ABY55855.1| S-adenosylmethionine decarboxylase 2 [Solanum lycopersicum]
Length=362

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 160/189 (85%), Gaps = 3/189 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M +PVSAIGFEGYEKRLEI FFE      P G GL+SLSK+QLD++L PA CTIVSSLAN
Sbjct  1    MELPVSAIGFEGYEKRLEICFFELGNSYGP-GCGLRSLSKDQLDEILTPAACTIVSSLAN  59

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LAD L+LKVKSVRYTRGSFIF
Sbjct  60   DEVDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKLADSLNLKVKSVRYTRGSFIF  119

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD--DEHP  725
            PGAQ FPHR+FSEEV VLD YFG LG+GS SYVMG  D QQ WHVYSASA+ AD  + +P
Sbjct  120  PGAQPFPHRHFSEEVAVLDTYFGKLGAGSNSYVMGNADKQQNWHVYSASAEPADANNVNP  179

Query  726  TYTLEMCMT  752
             YTLEM MT
Sbjct  180  VYTLEMRMT  188



>gb|KDP31452.1| hypothetical protein JCGZ_11828 [Jatropha curcas]
Length=358

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEI+FFEP IF +P+G+GL++LSK QLD+ L PAECTIV SL N+ 
Sbjct  1    MAVSAIGFEGYEKRLEITFFEPGIFVDPEGKGLRALSKAQLDEFLGPAECTIVDSLKNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLF+YPYK+IIKTCGTTKLLL+IPPIL+L++ L LKVKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFIYPYKLIIKTCGTTKLLLAIPPILKLSNALSLKVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQ--QQWHVYSASADSADDEHPTY  731
            AQS+PHR+F+EEV VLD YFG LG GS +YVMGG D    Q+WHVYSA ADSA      Y
Sbjct  121  AQSYPHRSFTEEVAVLDDYFGKLGGGSMAYVMGGSDSDSPQKWHVYSAYADSAISRDLVY  180

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  181  TVEMCMT  187



>gb|ADV29193.1| S-adenosylmethionine decarboxylase proenzyme [Solanum arcanum]
Length=343

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GS + +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSMAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|AEO52758.1| putative S-adenosylmethionine decarboxylase proenzyme, partial 
[Solanum chilense]
Length=343

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRHFSEEVVVLDGYFGKLVAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica]
Length=309

 Score =   286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G GL+SLSK+QLD++L PAECTIVSSL+N
Sbjct  52   MAVPVSAIGFEGYEKRLEVSFFEPGLFADPAGMGLRSLSKDQLDEILKPAECTIVSSLSN  111

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LA+ L L VKSVRY+RGSFIF
Sbjct  112  DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVKSVRYSRGSFIF  171

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD------SAD  713
            PGAQ  PHR+FSEEV VLDG+FG LG  S++YVMG  D  Q+WH+YSASA+       A 
Sbjct  172  PGAQPSPHRSFSEEVAVLDGHFGKLGLVSRAYVMGSSDKTQKWHIYSASAELASLLWGAR  231

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  232  QSGPTYTLEMCMT  244



>gb|ABW21895.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQ FPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQLFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|KHG10311.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=355

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 160/185 (86%), Gaps = 1/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VS IGFEGYEKRLEISFFEP    +P+G+GL+SLS+ QLD++L PAECTIVSSL+N  
Sbjct  1    MAVSVIGFEGYEKRLEISFFEPGALVDPEGKGLRSLSRAQLDEILGPAECTIVSSLSNYH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+LA  L L VKSVRYTRGSFIFP 
Sbjct  61   LDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLAGSLSLTVKSVRYTRGSFIFPA  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ +PHR F+EEV +LD YFG LG+GSK+Y MGG+D +++WHVYSASA+S + + PTYTL
Sbjct  121  AQPYPHRYFTEEVVILDSYFGKLGAGSKAYEMGGLD-KEKWHVYSASAESVNTKAPTYTL  179

Query  738  EMCMT  752
            EMCMT
Sbjct  180  EMCMT  184



>gb|ABW21890.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
peruvianum]
Length=343

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQ FPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQLFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>gb|KDO70175.1| hypothetical protein CISIN_1g0194112mg, partial [Citrus sinensis]
Length=312

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 159/191 (83%), Gaps = 0/191 (0%)
 Frame = +3

Query  180  VQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVS  359
            V    +M VSAIGFEGYEKRLEISFFEP +F +P+G+GL+ L+K QLD++L PAECTIVS
Sbjct  2    VSADTTMAVSAIGFEGYEKRLEISFFEPSMFVDPEGKGLRRLTKAQLDEILGPAECTIVS  61

Query  360  SLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRG  539
            SL+N+EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA+ L L V+SVRYTRG
Sbjct  62   SLSNDEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLAETLSLNVRSVRYTRG  121

Query  540  SFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDE  719
            SFIFPG Q +PHRNFSEEV VLD YFG L SGS +Y++GG    Q+WHVYSASA+     
Sbjct  122  SFIFPGNQLYPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKPQKWHVYSASAEPLISS  181

Query  720  HPTYTLEMCMT  752
             P +T+EMC+T
Sbjct  182  DPVFTIEMCLT  192



>ref|XP_006367530.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Solanum tuberosum]
Length=363

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            +++++PVSAIGFEGYEKRLEISFFEP +F +P+G+GL+SLSK QLD+ L PAECTIV SL
Sbjct  1    MEVALPVSAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEFLGPAECTIVDSL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N  VDSYVLSESSLF++PYKIIIKTCGTTKLLLSIP IL+LAD L LKV++V+YTRGSF
Sbjct  61   SNECVDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIPVILKLADTLLLKVQAVKYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLD YFG L SGSK+ ++G  D  Q+WHVYSASA     ++P
Sbjct  121  IFPGAQSFPHRHFSEEVAVLDSYFGNLSSGSKAVILGSPDKLQKWHVYSASAGPIQTKNP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_006373494.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373495.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 ref|XP_006373496.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 ref|XP_006373497.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ABK95786.1| unknown [Populus trichocarpa]
 gb|ERP51291.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51292.1| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|ERP51293.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
 gb|ERP51294.1| hypothetical protein POPTR_0017s14280g [Populus trichocarpa]
Length=361

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISF EP  F++P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFLEPGFFSDPEGKGLRSLSKAQLDEILRPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+LAD L L V SVRYTRGSF+ 
Sbjct  61   DQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFLC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNF EEV VLD +F  LG  S +YVMGG+D  Q+WHVYSASAD      P Y
Sbjct  121  PGAQPFPHRNFCEEVAVLDDHFSKLGLNSVAYVMGGLDKTQKWHVYSASADIESHSGPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_010528023.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Tarenaya 
hassleriana]
Length=367

 Score =   287 bits (735),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISF EP +F +P+G+GL++LSK QLD+ L PAECTIVSSL+N  
Sbjct  1    MTVSAIGFEGFEKRLEISFHEPSVFLDPEGKGLRALSKSQLDEFLGPAECTIVSSLSNAY  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL LAD L L V+S RYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILRLADSLSLAVRSARYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQ-QQWHVYSA-SADSADDEHPTY  731
            AQS+PHR+FSEEV VLDGYFG LGSGSK++VMGG +   Q+WHVYSA SAD++    P Y
Sbjct  121  AQSYPHRSFSEEVSVLDGYFGKLGSGSKAFVMGGTESNPQRWHVYSATSADASVCCEPVY  180

Query  732  TLEMCMT  752
            TLE+CMT
Sbjct  181  TLEICMT  187



>gb|AER27717.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=249

 Score =   283 bits (724),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  216  GFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVL  395
            GFEG+EKRLEISFFEP +F +P G+GL+SLSK QLD++L PAECTIV SL+N++VDSYVL
Sbjct  1    GFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAECTIVDSLSNDDVDSYVL  60

Query  396  SESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPH  575
            SESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYTRGSFIFPGAQSFPH
Sbjct  61   SESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAETLSLKVQDVRYTRGSFIFPGAQSFPH  120

Query  576  RNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            R+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P YTLEMCMT
Sbjct  121  RHFSEEVAVLDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVYTLEMCMT  179



>gb|ABW21915.1| putative S-adenosylmethionine decarboxylase proenzyme [Solanum 
chilense]
Length=343

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            ++M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L
Sbjct  1    MEMDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNL  60

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N+ VDSYVLSESSLFVY Y IIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSF
Sbjct  61   SNDYVDSYVLSESSLFVYSYNIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSF  120

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P
Sbjct  121  IFPGAQSFPHRYFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDP  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>sp|Q38IY3.1|DCAM_SOLCI RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Solanum chilense]
 gb|ABB02530.1| S-adenosylmethionine decarboxylase [Solanum chilense]
Length=358

 Score =   286 bits (733),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L+N
Sbjct  1    MDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSFIF
Sbjct  61   DYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P Y
Sbjct  121  PGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDPVY  180

Query  732  TLEMCMT  752
            TLEMCM 
Sbjct  181  TLEMCMA  187



>ref|XP_010320542.1| PREDICTED: S-adenosylmethionine decarboxylase isoform X1 [Solanum 
lycopersicum]
Length=409

 Score =   288 bits (737),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M +PVSAIGFEG+EKRLEISF EP +F +P G+GL+SL+K QLD++L PAECTIV +L+N
Sbjct  52   MDLPVSAIGFEGFEKRLEISFVEPGLFADPNGKGLRSLTKAQLDEILGPAECTIVDNLSN  111

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL LA+ L LKV+ VRYTRGSFIF
Sbjct  112  DYVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILRLAETLSLKVQDVRYTRGSFIF  171

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLDGYFG L +GSK+ +MG  D  Q+WHVYSASA +     P Y
Sbjct  172  PGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAVIMGNPDKTQKWHVYSASAGTVQCNDPVY  231

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  232  TLEMCMT  238



>ref|XP_008230354.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Prunus mume]
Length=426

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 163/193 (84%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G GL+SLSK+QLD++L PAECTIVSSL+N
Sbjct  53   MAVPVSAIGFEGYEKRLEVSFFEPGLFADPAGMGLRSLSKDQLDEILKPAECTIVSSLSN  112

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LA+ L L VKSVRY+RGSFIF
Sbjct  113  DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVKSVRYSRGSFIF  172

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD------SAD  713
            PGAQ  PHR+FSEEV VLDG+FG LG  S++YVMGG D  Q+WH+YSASA+       A 
Sbjct  173  PGAQPSPHRSFSEEVAVLDGHFGKLGLASRAYVMGGSDKTQKWHIYSASAELASLLWGAR  232

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  233  QSGPTYTLEMCMT  245



>ref|XP_007215554.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
 gb|EMJ16753.1| hypothetical protein PRUPE_ppa007294mg [Prunus persica]
Length=374

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 162/193 (84%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G GL+SLSK+QLD++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPAGMGLRSLSKDQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LA+ L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD------SAD  713
            PGAQ  PHR+FSEEV VLDG+FG LG  S++YVMG  D  Q+WH+YSASA+       A 
Sbjct  121  PGAQPSPHRSFSEEVAVLDGHFGKLGLASRAYVMGSSDKTQKWHIYSASAELASLLWGAR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  QSGPTYTLEMCMT  193



>dbj|BAC55114.1| S-adenosylmethionine decarboxylase [Malus domestica]
Length=374

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +PKG GL+SLSK Q+D++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LAD L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADSLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD------  713
            PGA   PHR+FSEEV VLDG+FG LG  SK+YVMG  D  Q+WH+YSASA+ A       
Sbjct  121  PGAHPSPHRSFSEEVAVLDGHFGKLGLASKAYVMGSPDKTQKWHIYSASAELASLLWGSR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  QSGPTYTLEMCMT  193



>ref|XP_011070874.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=358

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++ +S+I FEG+EKRLEISFF+P IF++P+G+GL+SLSK +LD++L PAECTIV SL+N
Sbjct  1    MALSISSIVFEGFEKRLEISFFQPSIFSDPEGKGLRSLSKAKLDEILEPAECTIVGSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LA  L L V +VRYTRGSFIF
Sbjct  61   EHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPSILKLAGCLSLSVGTVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGS-KSYVMGGVDPQQQWHVYSASADSADDEHPT  728
            PGAQS+PHR+FSEEV VLD YFG LG GS K+YVMGG D +Q+WHVYSASA S +  +P 
Sbjct  121  PGAQSYPHRSFSEEVAVLDKYFGNLGPGSTKAYVMGGSDKRQKWHVYSASAASVEAFNPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|NP_001275865.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
 gb|ACQ91107.1| S-adenosylmethionine decarboxylase [Citrus sinensis]
Length=364

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = +3

Query  177  FVQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIV  356
             V    +M VSAIGFEGYEKRLEISFFEP IF +P+G+GL+ L+K QLD++L PAECTIV
Sbjct  1    MVSADTTMAVSAIGFEGYEKRLEISFFEPSIFVDPEGKGLRRLTKAQLDEILGPAECTIV  60

Query  357  SSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTR  536
            SSL+N+EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+LA+ L L V+SVRYTR
Sbjct  61   SSLSNDEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLAETLSLNVRSVRYTR  120

Query  537  GSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADD  716
            GSFIFPG Q +PHRNFSEEV VLD YFG L SGS +Y++GG    Q+WHVYSASA+    
Sbjct  121  GSFIFPGNQLYPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKPQKWHVYSASAEPLIS  180

Query  717  EHPTYTLEMCMT  752
              P +T+EMC+T
Sbjct  181  SDPVFTIEMCLT  192



>ref|XP_010032594.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Eucalyptus grandis]
 gb|KCW52007.1| hypothetical protein EUGRSUZ_J01447 [Eucalyptus grandis]
Length=361

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++ VSAIGFEGYEKRLE++F+EP IF +P+G GL+SLSK QLD+ L  AECTIVSSL+N
Sbjct  1    MALSVSAIGFEGYEKRLELTFYEPGIFADPEGMGLRSLSKSQLDEFLKLAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL LAD L L VKSVRYTRGSFIF
Sbjct  61   DFVDSYVLSESSLFVYPYKLIIKTCGTTKLLLSIPAILRLADSLSLSVKSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNFSEEV VLD YFG LG+GSK+Y+MG  +  Q+WHVYSASA+        +
Sbjct  121  PGAQHFPHRNFSEEVAVLDTYFGNLGAGSKAYLMGSPERAQKWHVYSASAEKTSLSDSVF  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_008353516.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +PKG GL+SLSK Q+D++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LAD L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADTLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD------  713
            PGAQ  PHR+FSEEV VLDG+F  LG  SK+YVMG  D  Q+WH+YSASA+ A       
Sbjct  121  PGAQPSPHRSFSEEVAVLDGHFSKLGLASKAYVMGSPDKTQKWHIYSASAELASLLWGSR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  QSGPTYTLEMCMT  193



>ref|NP_001236931.1| S-adenosylmethionine decarboxylase [Glycine max]
 gb|AAL89723.1|AF488307_1 S-adenosylmethionine decarboxylase [Glycine max]
 gb|KHN07743.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEG+EKRLEISFF+P +F +P+G+GL++L+K QL ++L PA CTIVSSL N
Sbjct  1    MAMAVSAIGFEGFEKRLEISFFQPGLFADPEGRGLRALTKSQLGEILTPAACTIVSSLKN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+ A+ L L VKSV YTRGSFIF
Sbjct  61   DNVDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKFAEMLSLNVKSVNYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P AQ +PHRNFSEEV +LDGYFG LG+GS +Y++GG D  Q WHVYSASADS       Y
Sbjct  121  PSAQPYPHRNFSEEVAILDGYFGKLGAGSNAYILGGQDKAQNWHVYSASADSVTQCDNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_009373729.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
 ref|XP_009373730.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Pyrus x bretschneideri]
Length=374

 Score =   286 bits (731),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P+G GL+SLSK Q+D++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPRGMGLRSLSKAQIDEILTPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+L D L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLVDSLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD----DE  719
            PGAQ  PHR+FSEEV VLDG+FG LG  SK+YVMG  D  Q+WH+YSASA+ A       
Sbjct  121  PGAQPSPHRSFSEEVAVLDGHFGKLGLASKAYVMGSPDKTQKWHIYSASAELASLLWGSR  180

Query  720  H--PTYTLEMCMT  752
            H  PTYTLEMCMT
Sbjct  181  HTGPTYTLEMCMT  193



>ref|XP_006573201.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Glycine max]
 gb|KHN07170.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=355

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEG+EKRLEISFF+P +F +P+G GL++L+K QLD++L PA CTIVSSL N
Sbjct  1    MAMAVSAIGFEGFEKRLEISFFQPGLFADPEGMGLRALAKSQLDEILTPAACTIVSSLRN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+ A+ L L V+SV YTRGSFIF
Sbjct  61   DHVDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPPILKFAEMLSLNVRSVNYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHRNFSEEV +LDGYFG L +GS +Y++GG D  Q WHVYSASADS       Y
Sbjct  121  PGAQPYPHRNFSEEVAILDGYFGKLSAGSNAYILGGQDKSQNWHVYSASADSVTPCDNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|KHG30390.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
 gb|KHG30391.1| S-adenosylmethionine decarboxylase proenzyme [Gossypium arboreum]
Length=369

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ PVSAIGFEG EKRLEISFF+P    +P+G GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MAFPVSAIGFEGCEKRLEISFFDPGFSVDPRGMGLRSLSKAQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            N VDSYVLSESSLFVYPYKIIIKTCGTTKLL SIP IL+LA+ L L V+SVRY+RGSFIF
Sbjct  61   NHVDSYVLSESSLFVYPYKIIIKTCGTTKLLFSIPAILKLANSLSLSVQSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNF EEV +LD +F  LGS  K+Y+MGG D  ++WHVYSASA +++  +P Y
Sbjct  121  PGAQPFPHRNFCEEVAILDRFFLKLGSHRKAYIMGGSDKTKKWHVYSASARTSNHSNPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_008362232.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=374

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +PKG GL+SLSK Q+D++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLSKAQIDEILTPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LAD L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADTLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD------  713
            PGAQ  PHR+FSEEV VLDG+F  LG  SK+YVMG  D  Q+WH+YSASA+ A       
Sbjct  121  PGAQPSPHRSFSEEVAVLDGHFSKLGLASKAYVMGSPDKTQKWHIYSASAELASLLWGSR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  QTGPTYTLEMCMT  193



>gb|ACZ73828.1| S-adenosylmethionine decarboxylase [Olea europaea]
Length=354

 Score =   285 bits (728),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEG++KRLEISF +P +F++P+G+GL+SL+K QLD++  PAECTIVSSLAN++
Sbjct  1    MRTSAIGFEGFKKRLEISFSDPGLFSDPQGRGLRSLTKSQLDEIFAPAECTIVSSLANDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLL SIPPIL+LA  L L V++VRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLRSIPPILKLAGSLSLSVQAVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQS+PHRNFSEEV VLD YFG LGSG K+YVMG    QQ+WHVYSA A S  + +P YTL
Sbjct  121  AQSYPHRNFSEEVAVLDSYFGELGSGGKAYVMGSSQKQQKWHVYSACAGSI-ETNPIYTL  179

Query  738  EMCMT  752
            EMCMT
Sbjct  180  EMCMT  184



>ref|XP_009801145.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=416

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            +++++PVSAIGFEGYEKRLEISFFEP +F +P+G+GL+SLSK QLD++L PAECTIV SL
Sbjct  55   MEVALPVSAIGFEGYEKRLEISFFEPGLFADPEGKGLRSLSKAQLDEILGPAECTIVDSL  114

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N  VDSYVLSESSLF+Y YKIIIKTCGTTKLLLSIP IL+LAD L L+V++V+YTRGSF
Sbjct  115  SNECVDSYVLSESSLFIYSYKIIIKTCGTTKLLLSIPAILKLADTLSLEVQAVKYTRGSF  174

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLD YFG L SGSK+ ++G  D  Q+WHVYSASA      +P
Sbjct  175  IFPGAQSFPHRHFSEEVAVLDSYFGKLTSGSKAVILGSPDKLQKWHVYSASAGPTQSMNP  234

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  235  VYTLEMCMT  243



>ref|XP_010549939.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96871.1| hypothetical protein [Cleome spinosa]
Length=363

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP +F +P+G+GL++L+K QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFFEPSLFLDPQGKGLRALAKSQLDEILQPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSVRYTRGSFI 
Sbjct  61   DQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLAVKSVRYTRGSFIC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD----SADDE  719
            PG Q FPHR+FSEEV VLDG+F  LG  S +YVMG  D  ++WHVYSASA+    SA   
Sbjct  121  PGGQPFPHRSFSEEVSVLDGHFAKLGLSSSAYVMGNADESKKWHVYSASANDVSRSAGGY  180

Query  720  HPTYTLEMCMT  752
               YTLEMCMT
Sbjct  181  KNVYTLEMCMT  191



>gb|AGI02585.1| S-adenosylmethionine decarboxylase [Pyrus x bretschneideri]
Length=374

 Score =   285 bits (728),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +PKG GL+SL K Q+D++L PAECTIVSSL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEVSFFEPGLFADPKGMGLRSLLKAQIDEILTPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LAD L L VKSVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLADSLSLAVKSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD------  713
            PGAQ  PHR FSEEV VLDG+FG LG  SK+YVMG  D  Q+WH+YSASA+ A       
Sbjct  121  PGAQPSPHRIFSEEVAVLDGHFGKLGLASKAYVMGSPDKTQKWHIYSASAELASLLWGSR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  QSGPTYTLEMCMT  193



>sp|P46255.1|DCAM_SPIOL RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA57170.1| adenosylmethionine decarboxylase [Spinacia oleracea]
Length=363

 Score =   284 bits (727),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEG+EKRLEI+FFEP IF +P+G+GL++L K QLD++L PAECTIV SLAN  
Sbjct  1    MAISAIGFEGFEKRLEITFFEPSIFVDPEGKGLRALCKAQLDEILGPAECTIVDSLANES  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLF+Y YKIIIKTCGTTKLL +IPPIL LA  L L VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFIYAYKIIIKTCGTTKLLRAIPPILRLAGKLSLDVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQS+ HR+FSEEV VLDGYFG L +GSK++VMG     Q+WHVYSASA++   E P YTL
Sbjct  121  AQSYAHRSFSEEVAVLDGYFGKLAAGSKAFVMGDPAKPQKWHVYSASAETISFEEPVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>gb|AFV92895.1| S-adenosylmethionine decarboxylase [Pyrus betulifolia]
Length=358

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP IF +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEITFFEPSIFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASLVEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>sp|Q39676.1|DCAM1_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC 1; Short=SAMDC 1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 1 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09839.1| S-adenosylmethionine decarboxylase 1 [Dianthus caryophyllus]
 gb|AAB70461.1| S-adenosylmethionine decarboxylase [Dianthus caryophyllus]
Length=381

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 160/186 (86%), Gaps = 1/186 (1%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            +M +SAIGFEG+EKRLEISFFEP IF +P+G+GL++LSK QLD++L PAECTIV SLAN 
Sbjct  24   TMALSAIGFEGFEKRLEISFFEPGIFVDPEGKGLRALSKAQLDEILGPAECTIVDSLANE  83

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
             VDSYVLSESSLFVY YKIIIKTCGTTKLL SI PIL LADGL L VKSVRYTRGSFIFP
Sbjct  84   SVDSYVLSESSLFVYSYKIIIKTCGTTKLLHSILPILTLADGLCLDVKSVRYTRGSFIFP  143

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYT  734
            GAQS+PHR+FSEEV VLD YFG LG+GSK++VMG     Q+WHVYSA+A+ + D+ P YT
Sbjct  144  GAQSYPHRSFSEEVAVLDKYFGNLGTGSKAFVMGSPAKPQKWHVYSATAEPSYDD-PVYT  202

Query  735  LEMCMT  752
            LEMCMT
Sbjct  203  LEMCMT  208



>ref|NP_001280825.1| uncharacterized protein LOC103451713 [Malus domestica]
 dbj|BAC55113.1| S-adenosylmethionine decarboxylase [Malus domestica]
Length=358

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP IF +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASFVEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|KEH20218.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=370

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++ VS+IGFEG+EKRLEISFFEP +F +P+G+ L+SL+K QLD++L PAEC IVSSL+N
Sbjct  1    MALAVSSIGFEGFEKRLEISFFEPGVFLDPEGKDLRSLTKSQLDEILAPAECIIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPIL+L++ L L V+SVRYTRGSF F
Sbjct  61   DKVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILKLSEALGLTVRSVRYTRGSFTF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P AQSFPHR+FSEEV VLD YF  LG+GS +YV+GG D  Q+WHVYSA+A S       Y
Sbjct  121  PSAQSFPHRSFSEEVAVLDSYFAKLGTGSVAYVLGGSDSTQKWHVYSAAAKSVSLFDSVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_008339774.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
 ref|XP_008352943.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=358

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP IF +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEITFFEPSIFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASLIEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_008360070.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Malus domestica]
Length=361

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP IF +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEIAFFEPSIFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASFVEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AIS20829.1| SAMDC3 [Pyrus x bretschneideri]
Length=358

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP +F +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEIAFFEPSVFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASFVEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_009356498.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Pyrus 
x bretschneideri]
Length=357

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFEP +F +P+G+GL+SLSK Q+D+ L+ AECTIVSSL+N
Sbjct  1    MAMEGSAIGFEGYEKRLEIAFFEPSVFLDPEGRGLRSLSKAQIDEFLDQAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF++PYK+IIKTCGTTKLL  IP +L+LA+ + L V+SV+YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFIHPYKMIIKTCGTTKLLRVIPTVLQLAETISLAVRSVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ++PHR+FSEEV VLD YFG LGSGS++YVMG  D  Q+WHVYSA+A+SA    P Y
Sbjct  121  PGAQTYPHRSFSEEVSVLDSYFGKLGSGSRAYVMGRSDGPQKWHVYSATAESASFVEPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_006602987.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006602988.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006602989.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 ref|XP_006602990.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X4 [Glycine max]
Length=359

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEGYEKRLEISFFE  +F +P G GL++LSK+QLD++L PAECTIV+SL+N+ 
Sbjct  1    MAGSAIGFEGYEKRLEISFFENGVFADPGGLGLRALSKDQLDEILKPAECTIVASLSNDY  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD LD+ VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLD YF  LGSGSK+YVMG     Q WH+YSASA +       Y L
Sbjct  121  AQSFPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDPSKSQIWHIYSASAQTKGSSEAVYGL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>gb|KHN13794.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEGYEKRLEISFFE  +F +P G GL++LSK+QLD++L PAECTIV+SL+N+ 
Sbjct  1    MAGSAIGFEGYEKRLEISFFENGVFADPGGLGLRALSKDQLDEILKPAECTIVASLSNDY  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD LD+ VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLD YF  LGSGSK+YVMG     Q WH+YSASA +       Y L
Sbjct  121  AQSFPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDPSKSQIWHIYSASAQTKGSSEAVYGL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_010681340.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=372

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 158/187 (84%), Gaps = 1/187 (1%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            +M +SAIGFEGYEKRLEI+FFEP IF +  G+GL++LSK+QLD++L PAECTIV SLAN 
Sbjct  13   NMTISAIGFEGYEKRLEITFFEPGIFVDSDGKGLRALSKDQLDEILGPAECTIVDSLANE  72

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
             VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA  L L +K+VRYTRGSFIFP
Sbjct  73   SVDSYVLSESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAASLSLDIKAVRYTRGSFIFP  132

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD-SADDEHPTY  731
            GAQSFPHR+FSEEV VLDGYFG L +GS ++VMG     Q+WHVY ASA+ +A  + P Y
Sbjct  133  GAQSFPHRSFSEEVAVLDGYFGKLAAGSNAFVMGNPSKPQKWHVYCASAETTASYDDPVY  192

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  193  TLEMCMT  199



>ref|XP_011021158.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P+SAIGFEGYEKRLEISF EP  F++P+G+GL+SLSK QLD++L PAECTIV  L+N
Sbjct  1    MALPISAIGFEGYEKRLEISFLEPGFFSDPEGKGLRSLSKAQLDEILRPAECTIVDLLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+LAD L L V SVRYTRGSF+ 
Sbjct  61   DQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFLC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHR+F EEV VLD +F  LG  S +YVMGG+D  Q+WHVYSASAD      P Y
Sbjct  121  PGAQPFPHRSFCEEVAVLDDHFSKLGLNSVAYVMGGLDKTQKWHVYSASADIESHSGPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_007033428.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
 gb|EOY04354.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
Length=417

 Score =   284 bits (726),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +3

Query  177  FVQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIV  356
            +   KM+ PVSAIGFEGYEKRLE+SFF+P  F +P+G GL+SLSK QLD++L PAECTIV
Sbjct  43   YSNAKMAFPVSAIGFEGYEKRLEVSFFDPGSFVDPRGMGLRSLSKIQLDEILKPAECTIV  102

Query  357  SSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTR  536
            SSL+N+ VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL  A+ L L V+SVRYT 
Sbjct  103  SSLSNDHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRFANNLSLSVRSVRYTH  162

Query  537  GSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADD  716
            GSFIFPGAQ FPHRNFSEEV +LD +F  LGS  K+Y+MG  D  ++WHVYSA A+ +  
Sbjct  163  GSFIFPGAQPFPHRNFSEEVAILDRFFLKLGSRRKAYIMGSSDKTKKWHVYSAYAERSGH  222

Query  717  EHPTYTLEMCMT  752
              P YTLEMCMT
Sbjct  223  SDPVYTLEMCMT  234



>gb|EYU44271.1| hypothetical protein MIMGU_mgv1a008754mg [Erythranthe guttata]
Length=363

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 159/188 (85%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M MP SAIGFEGYEKRLEISF EP +F +P G GL+SLSK QLD++L+PA+CTIVSSL N
Sbjct  1    MEMPASAIGFEGYEKRLEISFSEPGVFADPSGSGLRSLSKCQLDEILDPAQCTIVSSLKN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYKII+KTCGTT+LLLSIPPIL++AD L L V SVRYTRGSFIF
Sbjct  61   DDVDSYVLSESSLFVYPYKIIVKTCGTTRLLLSIPPILKMADTLGLTVSSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSA-SADSADDEHPT  728
            PGAQ FPHR+F+EEV VLD +F  LG  SK+YVMGG D  ++WHVYSA +A SA +  P 
Sbjct  121  PGAQPFPHRSFTEEVVVLDEHFTKLGLISKAYVMGGADEYEKWHVYSACAATSATETVPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|XP_004491770.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
 ref|XP_004491771.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Cicer arietinum]
Length=360

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  S IGFEGYEKRLE+SFFE  +F++P G GL++LSK+QLD++L PAECTIV SL+N
Sbjct  1    MTMTSSPIGFEGYEKRLEVSFFENGVFSDPAGLGLRALSKDQLDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLFVY YK+IIKTCGTTKLLLSIP IL+LADGL++ VKSVRYTRGSFIF
Sbjct  61   GYVDSYVLSESSLFVYAYKVIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLDGYFG LGSGS++Y+MG     Q WH+YSASA         Y
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYFGKLGSGSQAYMMGDAKNSQIWHIYSASAKPEASSEAVY  180

Query  732  TLEMCMT  752
             LEMCMT
Sbjct  181  GLEMCMT  187



>ref|XP_009588870.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=415

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +3

Query  186  VKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSL  365
            +++++P SAIGFEGYEKRLEISF EP +F +P+G+GL+SLSK QLD++L PAECTIV SL
Sbjct  54   MEVALPASAIGFEGYEKRLEISFVEPGLFADPEGKGLRSLSKAQLDEILGPAECTIVDSL  113

Query  366  ANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSF  545
            +N  VDSYVLSESSLF+Y YKIIIKTCGTTKLLLSIP IL+LAD L L+V++V+YTRGSF
Sbjct  114  SNEFVDSYVLSESSLFIYSYKIIIKTCGTTKLLLSIPAILKLADTLSLEVQAVKYTRGSF  173

Query  546  IFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP  725
            IFPGAQSFPHR+FSEEV VLD YFG L SGSK+ ++G  D  Q+WHVYSASA     ++P
Sbjct  174  IFPGAQSFPHRHFSEEVAVLDSYFGKLTSGSKAVILGSPDKLQKWHVYSASAGPTQSKNP  233

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  234  VYTLEMCMT  242



>ref|XP_011008131.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
 ref|XP_011008132.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Populus euphratica]
Length=361

 Score =   281 bits (720),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEI FFEP  F++P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MALPVSAIGFEGYEKRLEICFFEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+LAD L L V SVRYTRGSFI 
Sbjct  61   DEVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILKLADALSLTVCSVRYTRGSFIC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNF EEV VLDG+F   G  S +YVMG  +  Q+WHVYSA+A       P Y
Sbjct  121  PGAQPFPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNSTQKWHVYSAAAGMKSHSGPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_011099087.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=410

 Score =   283 bits (724),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P+SAIGFEGYEKRLEISF EP +F +P G GL+SLSK QLD++L PA+CTIVSSL N
Sbjct  52   MALPISAIGFEGYEKRLEISFSEPGVFADPGGCGLRSLSKGQLDEILEPAQCTIVSSLKN  111

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVY YKII+KTCGTTKLLLSIPPIL++AD L L V SVRYTRGSFIF
Sbjct  112  DEVDSYVLSESSLFVYSYKIILKTCGTTKLLLSIPPILKMADSLGLTVCSVRYTRGSFIF  171

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHR+FSEEV VLD +F VLG  SK+YVMGG D  ++WHVYSA A ++ +  P Y
Sbjct  172  PGAQPFPHRSFSEEVAVLDSHFTVLGLSSKAYVMGGDDEHEKWHVYSACAKTS-ELAPVY  230

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  231  TLEMCMT  237



>sp|Q42679.1|DCAM_CATRO RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Catharanthus roseus]
 gb|AAC48989.1| S-adenosyl-L-methionine decarboxylase proenzyme [Catharanthus 
roseus]
 prf||2106177A Met(S-adenosyl) decarboxylase [Catharanthus roseus]
Length=357

 Score =   281 bits (720),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P SAIGFEGYEKRLEISFFE   F +P G+GL++L+K Q+D++L PAECTIV SL+N
Sbjct  1    MALPASAIGFEGYEKRLEISFFESSFFADPDGKGLRALNKSQIDEILEPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LA+ L L V++V+YTRGSFIF
Sbjct  61   QYLDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILKLAESLSLSVRNVKYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV++LD YFG LG  S +++MG  D  Q+WHVYSAS  S     PTY
Sbjct  121  PGAQSFPHRSFSEEVELLDNYFGKLGLESNAFIMGNPDQPQKWHVYSASVGSEQSSDPTY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_006437789.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
 gb|ESR51029.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
Length=476

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = +3

Query  180  VQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVS  359
            V    +M VSAIGFEGYEKRLEISFFEP IF +P+G+GL+ L+K QLD++L PAECTIVS
Sbjct  114  VSADTTMAVSAIGFEGYEKRLEISFFEPSIFVDPEGKGLRRLTKAQLDEILGPAECTIVS  173

Query  360  SLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRG  539
            SL+N+EVDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+L + L L V+SVRYTRG
Sbjct  174  SLSNDEVDSYVLSESSLFVYSYKIIIKTCGTTKLLLSIPPILKLVETLSLNVRSVRYTRG  233

Query  540  SFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDE  719
            SFIFPG Q +PHRNFSEEV VLD YFG L SGS +Y++GG    Q+WHVYSASA+     
Sbjct  234  SFIFPGNQLYPHRNFSEEVAVLDSYFGKLVSGSNAYIIGGSGKPQKWHVYSASAEPLISS  293

Query  720  HPTYTLEMCMT  752
             P +T+EMC+T
Sbjct  294  DPVFTIEMCLT  304



>gb|KEH21805.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=360

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFE   F++P G GL++LSK+Q+D++L PAECTIV SL+N
Sbjct  1    MTMTNSAIGFEGYEKRLEITFFENGFFSDPAGLGLRALSKDQIDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+Y YK+IIKTCGTTKLLLSIP IL+LADGL++ VKSVRYTRGSFIF
Sbjct  61   DCVDSYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLD YFG LGSGS++Y+MG  D  Q WH+YSASA         Y
Sbjct  121  PGAQSFPHRSFSEEVAVLDSYFGKLGSGSQAYMMGNADKSQIWHIYSASAKLEASPEAVY  180

Query  732  TLEMCMT  752
             LEMCMT
Sbjct  181  GLEMCMT  187



>ref|XP_007033429.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
 gb|EOY04355.1| S-adenosylmethionine decarboxylase proenzyme isoform 2 [Theobroma 
cacao]
Length=370

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ PVSAIGFEGYEKRLE+SFF+P  F +P+G GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MAFPVSAIGFEGYEKRLEVSFFDPGSFVDPRGMGLRSLSKIQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL  A+ L L V+SVRYT GSFIF
Sbjct  61   DHVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRFANNLSLSVRSVRYTHGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNFSEEV +LD +F  LGS  K+Y+MG  D  ++WHVYSA A+ +    P Y
Sbjct  121  PGAQPFPHRNFSEEVAILDRFFLKLGSRRKAYIMGSSDKTKKWHVYSAYAERSGHSDPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AAM44307.1|AF512545_1 S-adenosylmethionine decarboxylase [Citrus x microcarpa]
Length=361

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G+GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+LA+ L L V+SVR+TRGSFIF
Sbjct  61   EYLDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLAESLSLSVRSVRFTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
             GAQ FPHR+FSEEV VLDG+FG  G  S ++VMG  D  ++WHVYSASA++    +  Y
Sbjct  121  AGAQPFPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKRWHVYSASAEAGSHVNLVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_006585825.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Glycine max]
 ref|XP_006585826.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Glycine max]
 ref|XP_006585827.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Glycine max]
 gb|KHN14467.1| S-adenosylmethionine decarboxylase proenzyme [Glycine soja]
Length=359

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEGYEKRLEISFFE  +F +P+G GL++LSK+QLD++L PAEC+IV+SL+N+ 
Sbjct  1    MAGSAIGFEGYEKRLEISFFEHGVFADPEGIGLRALSKDQLDEILKPAECSIVASLSNDY  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLF+YPYKIIIKTCGTTKLLLSIP IL+LAD LD+ VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFIYPYKIIIKTCGTTKLLLSIPVILKLADALDIAVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQSFPHR+FSEEV VLD YF  LGSGSK+YVMG     Q WH+YSASA +       Y L
Sbjct  121  AQSFPHRSFSEEVSVLDSYFSNLGSGSKAYVMGDPSKSQIWHIYSASAQTKGSSEVVYGL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>sp|Q39677.1|DCAM2_DIACA RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC 2; Short=SAMDC 2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 2 beta chain; 
Flags: Precursor [Dianthus caryophyllus]
 gb|AAD09840.1| S-adenosylmethionine decarboxylase 2 [Dianthus caryophyllus]
Length=377

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            +M +SAIGFEG+EKRLEISFFEP IF +P+G+GL++LSK  LD++L PAECTIV SLAN 
Sbjct  15   NMTISAIGFEGFEKRLEISFFEPGIFVDPEGKGLRALSKAHLDEILGPAECTIVDSLANE  74

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
             VDSYVLSESSLFVY YKIIIKTCGTTKLL SIPPIL LA+ L L VKSVRYTRGSFIFP
Sbjct  75   SVDSYVLSESSLFVYSYKIIIKTCGTTKLLNSIPPILRLAETLFLDVKSVRYTRGSFIFP  134

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYT  734
            GAQSFPHR+FSEEV VLD YF  LG+GSK+ VMG     Q+WHVYSA+A++  D+ P YT
Sbjct  135  GAQSFPHRSFSEEVAVLDNYFAKLGAGSKAIVMGSPGKPQKWHVYSATAETNYDD-PVYT  193

Query  735  LEMCMT  752
            LEMCMT
Sbjct  194  LEMCMT  199



>ref|XP_002305295.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
 gb|EEE85806.2| S-adenosylmethionine decarboxylase family protein [Populus trichocarpa]
Length=361

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ PVSAIGFEGYEKRLEI F EP  F++P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MAQPVSAIGFEGYEKRLEICFLEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP ILELAD L L V SVRYTRGSFI 
Sbjct  61   DEVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILELADALSLTVCSVRYTRGSFIC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNF EEV VLDG+F   G  S +YVMG  +  Q+WHVYSA+A       P Y
Sbjct  121  PGAQPFPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNSTQKWHVYSAAAGMKSHSGPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_010044331.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Eucalyptus 
grandis]
 gb|KCW86415.1| hypothetical protein EUGRSUZ_B03086 [Eucalyptus grandis]
Length=348

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M + VSAIGFEGYEKRLEISF+EP +F +P G+GL+SLS+ QLD+++ PAECTIVSSL+N
Sbjct  1    MDLEVSAIGFEGYEKRLEISFYEPGLFGDPDGRGLRSLSRAQLDEIIKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYKI+IKTCGTT+LL SIPPIL LA  L L V+S +YTRG F+ 
Sbjct  61   DHVDSYVLSESSLFVYPYKIVIKTCGTTRLLKSIPPILNLAGSLSLTVRSAKYTRGCFLC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ +PHRNFSEEV VLD YFG LGSG K+Y++GG +  ++WHVYSASAD  +   P Y
Sbjct  121  PGAQPYPHRNFSEEVYVLDRYFGNLGSGRKAYLLGGSNKTKRWHVYSASADEVESVSPVY  180

Query  732  TLEMCMT  752
            T+E+CMT
Sbjct  181  TMEICMT  187



>gb|AGZ90156.1| S-adenosylmethionine decarboxylase, partial [Litsea cubeba]
Length=358

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP IF +P+G+GL+ LSK QLD++L PAECTIV+SL+N
Sbjct  1    MAVPVSAIGFEGYEKRLEISFFEPSIFADPEGKGLRMLSKAQLDEILRPAECTIVTSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL++AD L L+VK+VRYTRGSF F
Sbjct  61   HDVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPSILKMADVLSLRVKAVRYTRGSFNF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P  Q FPHR+F EEV +LD +FG LGSGSK+YV+      Q+WH+YSA A+SA      Y
Sbjct  121  PAVQPFPHRSFLEEVSILDSHFGKLGSGSKAYVLDSHVKSQKWHIYSACAESAS--CSVY  178

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  179  TLEMCMT  185



>ref|XP_004304166.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 1 [Fragaria vesca subsp. vesca]
 ref|XP_004304167.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=371

 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 160/193 (83%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+ FFEP +F +PKG GL+SLS+ Q++++LNPAECTIVSSL N
Sbjct  1    MAVPVSAIGFEGYEKRLEVCFFEPGLFADPKGMGLRSLSRAQINEILNPAECTIVSSLLN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLFVYPYK+IIKTCGTTKLL SIP IL+LA+ L L V+SVRY+RGSFIF
Sbjct  61   DDLDSYVLSESSLFVYPYKVIIKTCGTTKLLRSIPAILKLAETLSLAVRSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD------  713
            PGAQ  PHR+FSEEV VLDG+F  LG  S++Y+MG  D  Q+WHVYSASA+ A       
Sbjct  121  PGAQPSPHRSFSEEVAVLDGHFSKLGLASRAYIMGSPDNSQKWHVYSASAELASLFWGTR  180

Query  714  DEHPTYTLEMCMT  752
               PTYTLEMCMT
Sbjct  181  SSGPTYTLEMCMT  193



>ref|XP_006291363.1| hypothetical protein CARUB_v10017502mg [Capsella rubella]
 gb|EOA24261.1| hypothetical protein CARUB_v10017502mg [Capsella rubella]
Length=362

 Score =   279 bits (713),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 159/190 (84%), Gaps = 5/190 (3%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEG+EKRLEISFFEP +F +P+G+GL++L+K QLD++L PAECTIVSSL+N+ 
Sbjct  1    MAISAIGFEGFEKRLEISFFEPSVFLDPEGKGLRALTKSQLDEILTPAECTIVSSLSNSL  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLL SIP IL LA+ L + VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLFSIPHILRLAESLSITVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQ--WHVYSASA---DSADDEH  722
            AQS+PHR+FSEEV +LDGYFG L +GSK++VMGG D      WHVYSASA    +   + 
Sbjct  121  AQSYPHRSFSEEVALLDGYFGKLNAGSKAFVMGGSDNNNTHGWHVYSASAAYESALVCDK  180

Query  723  PTYTLEMCMT  752
            P YTLEMCMT
Sbjct  181  PVYTLEMCMT  190



>ref|XP_010525150.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Tarenaya hassleriana]
 gb|ABD96954.1| hypothetical protein [Cleome spinosa]
Length=365

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 158/191 (83%), Gaps = 4/191 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLEISFFEP +F +PKG G ++L+K QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEISFFEPSLFLDPKGMGFRALAKSQLDEILQPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVYPYK+IIKTCGTTKLL SIPP+LELA  L L VKSVRYTRGSFI 
Sbjct  61   DQVDSYVLSESSLFVYPYKVIIKTCGTTKLLFSIPPLLELAGELSLVVKSVRYTRGSFIC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMG--GVDPQQQWHVYSASAD--SADDE  719
            PGAQ FPHR+FSEEV VLD +F  LG  S +YVMG  G D  ++WHVY+ASA   S  D 
Sbjct  121  PGAQPFPHRSFSEEVAVLDAHFAKLGLSSSAYVMGNDGADETRKWHVYAASAKGTSRSDY  180

Query  720  HPTYTLEMCMT  752
            +  YTLEMCMT
Sbjct  181  NNVYTLEMCMT  191



>gb|ABK95104.1| unknown [Populus trichocarpa]
Length=361

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ PVSAIGFEG+EKRLEI F EP  F++P+G+GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MAQPVSAIGFEGFEKRLEICFLEPGFFSDPEGKGLRSLSKAQLDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +EVDSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP ILELAD L L V SVRYTRGSFI 
Sbjct  61   DEVDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPVILELADALSLTVCSVRYTRGSFIC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNF EEV VLDG+F   G  S +YVMG  +  Q+WHVYSA+A       P Y
Sbjct  121  PGAQPFPHRNFCEEVTVLDGHFSKFGLESVAYVMGSPNSTQKWHVYSAAAGMKSHSGPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_010100905.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
 gb|EXB85829.1| S-adenosylmethionine decarboxylase proenzyme [Morus notabilis]
Length=369

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 158/193 (82%), Gaps = 6/193 (3%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEG+EKRLE+SFFEP +F +P G GL+SLSK Q+D++L PAECTIV SL+N
Sbjct  1    MAVPVSAIGFEGFEKRLEVSFFEPGMFADPGGMGLRSLSKSQVDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + +DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LA  + L V+SVRYTRGSFIF
Sbjct  61   DHLDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILKLASSISLAVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD------SAD  713
            PGAQSFPHRNF+EEV VLD +FG LG  SK+Y+MG  + +Q+WHVYSA A+       A 
Sbjct  121  PGAQSFPHRNFAEEVAVLDSHFGKLGLASKAYMMGSPNQKQKWHVYSAHAELASLVWGAR  180

Query  714  DEHPTYTLEMCMT  752
                 YTLEMCMT
Sbjct  181  QLGSVYTLEMCMT  193



>ref|XP_010257836.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nelumbo 
nucifera]
Length=405

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = +3

Query  177  FVQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIV  356
            +   +M++  SAIGFEGYEKRLE+SFFEP IF +P G+GL+SLSK QLD++L PAECTIV
Sbjct  41   YSNAEMALSASAIGFEGYEKRLEVSFFEPGIFADPDGKGLRSLSKTQLDEILKPAECTIV  100

Query  357  SSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTR  536
            +S +N  +DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL LA+ L L V++V+YTR
Sbjct  101  ASQSNAHLDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPAILRLANSLSLSVRAVKYTR  160

Query  537  GSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADD  716
            G+F FPGAQ +PHR+F+EE+ VLD YFG LGSGS +YVMG +   Q+WHVYSASA+  + 
Sbjct  161  GTFTFPGAQPYPHRSFTEEIAVLDSYFGNLGSGSNAYVMGNLTKSQKWHVYSASAE-VNH  219

Query  717  EHPTYTLEMCMT  752
              P YTLEMCMT
Sbjct  220  SGPIYTLEMCMT  231



>gb|KEH17677.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=406

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M  SAIGFEGYEKRLEI+FFE  +F++P G G ++LSK+Q+D++L PAECTIV SL+N
Sbjct  47   MAMTNSAIGFEGYEKRLEITFFENGVFSDPAGLGFRALSKDQIDEILKPAECTIVDSLSN  106

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+Y YK+IIKTCGTTKLLLSIP IL+LADGL++ VKSVRYTRGSFIF
Sbjct  107  DYVDSYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADGLNIAVKSVRYTRGSFIF  166

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLD YFG LGSGS++Y+MG  D  Q WH+YSASA         Y
Sbjct  167  PGAQSFPHRSFSEEVVVLDSYFGKLGSGSQAYMMGDADKSQIWHIYSASAKLEASPEAVY  226

Query  732  TLEMCMT  752
             LEMCMT
Sbjct  227  GLEMCMT  233



>gb|AGL95795.1| S-adenosylmenthionine decarboxylase [Momordica charantia]
Length=358

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ P SAIGFEGYEKRLE+SFFEP +F++P+G GL++LSK QLD++L  AECTIV SL+N
Sbjct  1    MTFPTSAIGFEGYEKRLEVSFFEPGVFSDPRGMGLRALSKAQLDEILTLAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + +DS VLSESSLFVYPYK IIKTCGTTKLLLSIP +L+LAD L L V+SVRYTRGSFIF
Sbjct  61   DYLDSCVLSESSLFVYPYKFIIKTCGTTKLLLSIPALLKLADSLSLTVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD-SADDEHPT  728
            PGAQSFPHR+FSEEV VLDGY G LG  S +YVMG  D  ++WHVYSA A+  +   +P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYLGKLGLDSTAYVMGSPDETKKWHVYSACANMGSKSNNPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|NP_189184.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 ref|NP_001189972.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 sp|Q9LSU6.1|DCAM3_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 3; 
Short=AdoMetDC3; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 beta chain [Arabidopsis thaliana]
 dbj|BAB01327.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAT06473.1| At3g25570 [Arabidopsis thaliana]
 gb|AEE77029.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE77030.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=349

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSA GFEG+EKRLEISFFE   F +P+G+ L+SL+K QLD++L PAECTIVSSL N+ 
Sbjct  1    MAVSATGFEGFEKRLEISFFETTDFLDPQGKSLRSLTKSQLDEILTPAECTIVSSLTNSF  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL LAD L L VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPHILRLADSLCLTVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQ-QQWHVYSASA--DSADDEHPT  728
            AQS+PHR+FSEEV +LD YFG L +GSK++VMGG D   Q+WHVYSAS+  +SA  + P 
Sbjct  121  AQSYPHRSFSEEVALLDDYFGKLNAGSKAFVMGGSDNNPQRWHVYSASSTEESAVCDKPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>gb|KGN57743.1| hypothetical protein Csa_3G271360 [Cucumis sativus]
Length=364

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ P SAIGFEGYEKRLE+SFFEP +F +P+G GL++LSK QLD++L  AECTIV SL+N
Sbjct  1    MTCPTSAIGFEGYEKRLEVSFFEPSVFVDPRGMGLRALSKAQLDEILTLAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + +DSYVLSESSLFVYPYK IIKTCGTTKLLLSIP +L+LAD L L VKSVRYTRGSFIF
Sbjct  61   DYLDSYVLSESSLFVYPYKFIIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD-DEHPT  728
            PGAQSFPHR+FSEEV VLDGY   LG    +YVMG  D  ++WHVY+A A   +   +P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYLARLGLNGSAYVMGSPDETRKWHVYAACASMGNQSNNPV  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>dbj|BAP47514.1| S-adenosylmethionine decarboxylase [Gentiana triflora]
Length=363

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            MPVSAIGFEG+EKRLEISFFEP +F++P G GL+SL+K QLD++L PAECTIV+SL+N +
Sbjct  4    MPVSAIGFEGFEKRLEISFFEPNMFSDPNGFGLRSLTKAQLDEILEPAECTIVASLSNKQ  63

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLFVYPYKII+KTCGTTKLLLSIP IL+LA  L L VK+V YTRGSFIFPG
Sbjct  64   LDSYVLSESSLFVYPYKIIMKTCGTTKLLLSIPVILKLAKSLSLDVKAVNYTRGSFIFPG  123

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHP--TY  731
            AQSFPHR+F EE  +LDGYFG LG  SK++VMG    QQ+WHVY+A+A+  D+ +    Y
Sbjct  124  AQSFPHRSFFEEASLLDGYFGNLGMRSKAFVMGDGGQQQKWHVYTATAEYVDEPNSDCVY  183

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  184  TLEMCMT  190



>gb|KDP24344.1| hypothetical protein JCGZ_25640 [Jatropha curcas]
Length=359

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P SAIGFEGYEKRLE+SF EP  F +P G GL+SLSK Q+D++L PAECTIV SL+N
Sbjct  1    MALPTSAIGFEGYEKRLEVSFSEPGFFADPGGMGLRSLSKAQIDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+YPYK+IIKTCGTTKLLLSIP IL+LA  L L V SVRY+RGSFIF
Sbjct  61   DHVDSYVLSESSLFIYPYKVIIKTCGTTKLLLSIPAILKLAGTLSLTVHSVRYSRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQSFPHR+FSEEV VLDG+FG LG  S +YVMG  D  Q+WHVYSAS D+        
Sbjct  121  PGAQSFPHRSFSEEVAVLDGHFGKLGLESVAYVMGSPDKTQKWHVYSASLDTGRHSSSVQ  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AER27716.1| S-adenosylmethionine decarboxylase [Nicotiana tabacum]
Length=249

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = +3

Query  216  GFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVL  395
            GFEG+EKRLEISFFEP +F +P G+GL+SLSK QLD++L PA CTIV SL+N++VDSYVL
Sbjct  1    GFEGFEKRLEISFFEPGLFADPNGKGLRSLSKAQLDEILGPAGCTIVDSLSNDDVDSYVL  60

Query  396  SESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPH  575
            SESSLFVY YKIIIKTCGTTKLLL+IPPIL+LA+ L LKV+ VRYT GSFIFPGAQSFPH
Sbjct  61   SESSLFVYSYKIIIKTCGTTKLLLAIPPILKLAESLSLKVQDVRYTCGSFIFPGAQSFPH  120

Query  576  RNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            R+FSEEV  LDGYFG L +GSK+ +MG  D  Q+WHVYSASA       P YTL +CMT
Sbjct  121  RHFSEEVAALDGYFGKLAAGSKAVIMGSPDKAQKWHVYSASAGPIQSNDPVYTLVICMT  179



>gb|AGV68760.1| S-adenosylmethionine decarboxylase [Cucumis melo]
Length=364

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ P SAIGFEGYEKRLE+SFFEP +F +P+G GL++LSK QLD++L  AECTIV SL+N
Sbjct  1    MTCPTSAIGFEGYEKRLEVSFFEPSVFVDPRGMGLRALSKAQLDEILTLAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + +DSYVLSESSLFVYPYK +IKTCGTTKLLLSIP +L+LAD L L VKSVRYTRGSFIF
Sbjct  61   DYLDSYVLSESSLFVYPYKFVIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD-DEHPT  728
            PGAQSFPHR+FSEEV VLDGY   LG    +YVMG  D  ++WHVYSA A+  +   +P 
Sbjct  121  PGAQSFPHRSFSEEVAVLDGYLAKLGLHGSAYVMGSPDETRKWHVYSACANMGNQSNNPV  180

Query  729  YTLEMCMT  752
            YTLE+CMT
Sbjct  181  YTLEICMT  188



>ref|XP_010261810.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme [Nelumbo nucifera]
Length=347

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P+S  GF+GYEKRLEISFFEP IF +P G+GL+SL K QLD++L PAECTIV+  +N
Sbjct  1    MALPISPFGFKGYEKRLEISFFEPSIFADPGGEGLRSLFKAQLDEILKPAECTIVALQSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSY+LSESSLF+YPYKIIIKTCGTTKLLLSIP IL+LA+ L L V++V+YTRG+F  
Sbjct  61   ANVDSYILSESSLFIYPYKIIIKTCGTTKLLLSIPSILKLANSLSLTVRAVKYTRGTFTV  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            PGAQ FPHRNFSEE+ VLD YFG LGSGSK+YV+G +   Q+WHVYSASA+  +   P Y
Sbjct  121  PGAQPFPHRNFSEEIVVLDKYFGNLGSGSKAYVVGNLIKSQKWHVYSASAEVVNHYEPVY  180

Query  732  TLEMCMT  752
            TLEMC T
Sbjct  181  TLEMCRT  187



>gb|EPS62258.1| s-adenosylmethionine decarboxylase proenzyme, partial [Genlisea 
aurea]
Length=357

 Score =   274 bits (700),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 161/190 (85%), Gaps = 3/190 (2%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQG-LQSLSKEQLDQVLNPAECTIVSSLA  368
            M++ VSAIGFEGYEKRLEISFFE + FT P+G+G L+SL+K QLD++L PAECTIVSSL+
Sbjct  1    MALSVSAIGFEGYEKRLEISFFESDAFTGPRGKGGLRSLTKSQLDEILKPAECTIVSSLS  60

Query  369  NNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFI  548
            N  +DSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+LA  L L VK VRYTRGSFI
Sbjct  61   NEHLDSYVLSESSLFVYPYKMIIKTCGTTKLLLSIPAILKLAQSLALSVKDVRYTRGSFI  120

Query  549  FPGAQSFPHRNFSEEVDVLDGYFGVLGS-GSKSYVMGGVDPQQQWHVYSASADSADDE-H  722
            FPGAQ++PHR+FSEE  VL+GYFG L S GS++YVMG  D  Q+WHVYSASA++A +  +
Sbjct  121  FPGAQTYPHRDFSEEFVVLEGYFGKLSSNGSRAYVMGSPDTPQKWHVYSASAETATESPN  180

Query  723  PTYTLEMCMT  752
            P  T+EMCMT
Sbjct  181  PVVTVEMCMT  190



>gb|KDO58885.1| hypothetical protein CISIN_1g039582mg [Citrus sinensis]
Length=361

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G+GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+L++ L L V+SVRYTRGSFIF
Sbjct  61   EHLDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLSESLSLSVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
             GAQ FPHR+FSEEV VLDG+FG  G  S ++VMG  D  ++WHVYSASA++    +P Y
Sbjct  121  AGAQPFPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKRWHVYSASAEAGSHVNPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|ABY81906.1| S-adenosylmethionine decarboxylase [Vigna radiata]
Length=348

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEGYEKRLEI F +P IF +P+G+GL+ L+K QLD++L PA CTIVSSL+N
Sbjct  1    MAMAVSAIGFEGYEKRLEICFSQPGIFADPEGRGLKVLTKSQLDEILTPAACTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLFVY YKIIIKTCGTTKLLL+IP IL+ AD L LKV+SV YTRGSFIF
Sbjct  61   DDVDSYVLSESSLFVYAYKIIIKTCGTTKLLLAIPHILKFADMLSLKVRSVTYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSA-DDEHPT  728
            PGAQ +PHR F+EEV +L+ YFG LG GS +Y+MG  D +Q+WH+YSASADS    +   
Sbjct  121  PGAQPYPHRCFTEEVAILNDYFGKLGLGSMAYIMGSPDKKQKWHIYSASADSVMSSDKNI  180

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  181  YTLEMCMT  188



>ref|XP_008461582.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Cucumis melo]
Length=418

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 154/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+ P SAIGFEGYEKRLE+SFFEP +F +P+G GL++LSK QLD++L  AECTIV SL+N
Sbjct  55   MTCPTSAIGFEGYEKRLEVSFFEPSVFVDPRGLGLRALSKAQLDEILTLAECTIVDSLSN  114

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + +DSYVLSESSLFVYPYK +IKTCGTTKLLLSIP +L+LAD L L VKSVRYTRGSFIF
Sbjct  115  DYLDSYVLSESSLFVYPYKFVIKTCGTTKLLLSIPALLKLADSLSLTVKSVRYTRGSFIF  174

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD-DEHPT  728
            PGAQSFPHR+FSEEV VLDGY   LG    +YVMG  D  ++WHVYSA A+  +   +P 
Sbjct  175  PGAQSFPHRSFSEEVAVLDGYLVKLGLHGSAYVMGSPDETRKWHVYSACANMGNQSNNPV  234

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  235  YTLEMCMT  242



>ref|XP_006430871.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
 gb|ESR44111.1| hypothetical protein CICLE_v10013866mg [Citrus clementina]
Length=361

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++PVSAIGFEGYEKRLE+SFFEP +F +P G+GL+SLSK QLD++L PAECTIVSSL+N
Sbjct  1    MALPVSAIGFEGYEKRLEVSFFEPGVFADPGGRGLRSLSKHQLDEILKPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              +DSYVLSESSLFVYPYK+IIKTCGTTKLLLSIP IL+L++ L L V+SVRYTRGSFIF
Sbjct  61   EYLDSYVLSESSLFVYPYKVIIKTCGTTKLLLSIPAILKLSESLSLSVRSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
             GAQ FPHR+FSEEV VLDG+FG  G  S ++VMG  D  ++WHVYSASA++    +P Y
Sbjct  121  AGAQPFPHRSFSEEVAVLDGHFGKFGMDSTAFVMGSPDNTKRWHVYSASAEAGSHVNPVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_002525956.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
 gb|EEF36380.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis]
Length=359

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++ V  IGFEGYEKRLE+SF EP  F +P G GL+SLSK QLD++L PAECTIV SL+N
Sbjct  1    MALSVPPIGFEGYEKRLEVSFSEPGFFADPGGMGLRSLSKSQLDEILKPAECTIVDSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLFVYPYK++IKTCGTTKLLLSIP IL+LAD L L V SVRYTRGSFIF
Sbjct  61   DHVDSYVLSESSLFVYPYKLMIKTCGTTKLLLSIPAILKLADTLSLSVSSVRYTRGSFIF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P AQ+FPHR+FSEEV VLDG+FG LG  S +YVMG  D  ++WH YSA+ D      P Y
Sbjct  121  PSAQTFPHRSFSEEVAVLDGHFGKLGLESVAYVMGSPDETRKWHAYSAAIDERCHSSPIY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_007139351.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
 gb|ESW11345.1| hypothetical protein PHAVU_008G022100g [Phaseolus vulgaris]
Length=356

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 152/185 (82%), Gaps = 2/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEGYEKRLEISF E  +     G GL++LS++QLD++LNPAECTIVSSL+N+ 
Sbjct  1    MAGSAIGFEGYEKRLEISFSEDGVLAG--GLGLRALSRDQLDEILNPAECTIVSSLSNDY  58

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD +D+ VKSVRYTRGSFIFPG
Sbjct  59   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADAIDISVKSVRYTRGSFIFPG  118

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ+FPHR+FSEEV VLD YFG LG+GSK+Y MG     Q WH+YSASA + +     Y L
Sbjct  119  AQTFPHRSFSEEVSVLDSYFGNLGNGSKAYAMGDPSKSQLWHIYSASAQAKESLDSVYGL  178

Query  738  EMCMT  752
            EMCMT
Sbjct  179  EMCMT  183



>ref|XP_006288009.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
 gb|EOA20907.1| hypothetical protein CARUB_v10001243mg [Capsella rubella]
Length=362

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP +F +P+G+GL++L+K Q+D++L PAECTIVSSL+N++
Sbjct  1    MAMSAIGFEGYEKRLEVSFFEPGLFLDPQGKGLRALAKSQIDEILQPAECTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLSI P+L LA  L L+VK+VRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLAAELSLEVKAVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHRNFSEEV VLD +F  LG  S +Y+MG  D  ++WHVYSASA + ++    YTL
Sbjct  121  GQPFPHRNFSEEVSVLDAHFAKLGLSSVAYLMGNDDETKKWHVYSASAKNDNNNKNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_009121534.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme 1 [Brassica rapa]
Length=368

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP +F +  G+GL++LSK Q+D++L PAECTIVSSL+N+E
Sbjct  1    MSLSAIGFEGYEKRLEVSFFEPSLFLDTHGKGLRALSKSQIDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L LA G+ L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLAGGVSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSAS--ADSADDEHPTY  731
             Q FPHRNFSEEV VLDG+F  +G  S +Y+MG  D  ++WHVYSAS  A +++ ++  Y
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDETKKWHVYSASAPAKNSNGDNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_008811197.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Phoenix 
dactylifera]
Length=354

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P+SA GFEG EKRLEISFFEP IF +P G GLQSLS+ Q+D +L PAEC IV+SL+N
Sbjct  1    MALPISAPGFEGCEKRLEISFFEPSIFADPGGNGLQSLSRAQIDGILKPAECRIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLF+Y YKIIIKTCGTTKLL S+PPILELA  L L VKSVRYT GSF F
Sbjct  61   KIVDSYVLSESSLFIYSYKIIIKTCGTTKLLSSVPPILELAKELSLSVKSVRYTHGSFKF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P AQ FP+ +FSEEV +LD +FG LG GSK+YVM  +   Q+WHVYSASA SAD  HP Y
Sbjct  121  PQAQPFPYHSFSEEVAILDSHFGRLGLGSKAYVMSSLVKSQKWHVYSASAKSAD--HPLY  178

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  179  TVEMCMT  185



>gb|ABU55003.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=319

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 151/185 (82%), Gaps = 2/185 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M  SAIGFEGYEKRLEISF E  +     G GL++LS++QLD++LNPAECTIVSSL+N+ 
Sbjct  1    MAGSAIGFEGYEKRLEISFSEDGVLAG--GLGLRALSRDQLDEILNPAECTIVSSLSNDY  58

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL+LAD +D+ VKSVRYTRGSFIFPG
Sbjct  59   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPVILKLADAIDISVKSVRYTRGSFIFPG  118

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
            AQ+ PHR+FSEEV VLD YFG LG+GSK+Y MG     Q WH+YSASA + +     Y L
Sbjct  119  AQTXPHRSFSEEVSVLDSYFGNLGNGSKAYAMGDPSKSQLWHIYSASAQAKESLDSVYGL  178

Query  738  EMCMT  752
            EMCMT
Sbjct  179  EMCMT  183



>emb|CDX69487.1| BnaA10g18360D [Brassica napus]
Length=368

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 157/187 (84%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP +F +  G+GL++LSK Q+D++L PAECTIVSSL+N+E
Sbjct  1    MSLSAIGFEGYEKRLEVSFFEPSLFLDTHGKGLRALSKSQIDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L L+ G+ L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLSGGVSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSAS--ADSADDEHPTY  731
             Q FPHRNFSEEV VLDG+F  +G  S +Y+MG  D  ++WHVYSAS  A +++ ++  Y
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDETKKWHVYSASAPAKNSNSDNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_002876918.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH53177.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=307

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISFFEP +F +PKG GL++L+K  LD++L PAECTIVSSL+N+ 
Sbjct  1    MAVSAIGFEGFEKRLEISFFEPSVFLDPKGNGLRALTKSHLDEILTPAECTIVSSLSNSL  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLL SIP IL LAD L L VKSVRYTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLFSIPHILSLADSLCLTVKSVRYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQ-QQWHVYSASADSADD  716
            AQS+PHR+FSEEV +LDGYFG L +GSK++VMGG D   Q+WHVYS  +    D
Sbjct  121  AQSYPHRSFSEEVALLDGYFGKLNAGSKAFVMGGSDNNPQRWHVYSTCSAYESD  174



>ref|XP_007153542.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
 gb|ESW25536.1| hypothetical protein PHAVU_003G044200g [Phaseolus vulgaris]
Length=354

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEI F +P +F +P+G+GL+ L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MAVSAIGFEGYEKRLEICFSQPGLFADPEGRGLRVLTKSQLDEILTPAACTIVSSLSNDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+ AD L LKVKSV YTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLKVKSVTYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS-ADDEHPTYT  734
            AQ  PHR F+EEV +L+ YFG LGSGS +++MG  D +Q+WH+YSASAD     +    T
Sbjct  121  AQPHPHRCFTEEVAILNDYFGKLGSGSMAFIMGSPDKKQKWHIYSASADPLISSDTNVCT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>emb|CDY57536.1| BnaA05g33510D [Brassica napus]
Length=364

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SF EP IF + KG GL++L++ QLDQ+L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFLEPSIFQDSKGLGLRALTRSQLDQILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+LELA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA S  D +  YTL
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASAQSFSDNNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_010463654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
 ref|XP_010463655.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 1 [Camelina 
sativa]
Length=366

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP IF + KG GL++L+K QLD +L PA CTIVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTKSQLDDILTPAACTIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  +QWHVY+ASA DS +  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKQWHVYAASAQDSGNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>emb|CAA69073.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA DS++  +  YT
Sbjct  121  GQLFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKKWHVYAASAQDSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|AAL06846.1| AT3g02470/F16B3_10 [Arabidopsis thaliana]
Length=366

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA DS++  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKKWHVYAASAQDSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|NP_186896.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001078093.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 ref|NP_001154585.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 sp|Q96286.2|DCAM1_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 beta chain; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL16237.1|AF428468_1 AT3g02470/F16B3_10 [Arabidopsis thaliana]
 gb|AAF32454.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAK68764.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AAM10008.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 dbj|BAH19598.1| AT3G02470 [Arabidopsis thaliana]
 gb|AEE73812.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73813.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 gb|AEE73814.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA DS++  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKKWHVYAASAQDSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|XP_002882231.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58490.1| S-adenosylmethionine decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDK  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA DS++  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKKWHVYAASAQDSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|XP_010904619.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Elaeis 
guineensis]
Length=356

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++P+ A GFEG EKRLEISFFEP IFT+  G GLQSLS+ ++D +LNPAEC IV+SL+N
Sbjct  1    MALPIPATGFEGCEKRLEISFFEPSIFTDSGGNGLQSLSRAKIDGILNPAECRIVASLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
              VDSYVLSESSLF+Y YKIIIKTCGTTKLLLSIP ILELA  L L VKSVRYT GSF F
Sbjct  61   KIVDSYVLSESSLFIYSYKIIIKTCGTTKLLLSIPSILELAKELSLSVKSVRYTHGSFKF  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTY  731
            P AQ FPH++FSEEV +LD +F  LG GSK+YVM  +   Q+WHVYSASA SADD  P Y
Sbjct  121  PLAQPFPHQSFSEEVAILDNHFRNLGLGSKAYVMSSLVKSQKWHVYSASAKSADD--PLY  178

Query  732  TLEMCMT  752
            T+EMCMT
Sbjct  179  TVEMCMT  185



>ref|XP_006408415.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
 dbj|BAJ33801.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49868.1| hypothetical protein EUTSA_v10022357mg [Eutrema salsugineum]
Length=366

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRL++SFFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLKVSFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADD-EHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA S+ +  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFSKLGLNSVAYLMGNDDETKKWHVYAASAQSSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>dbj|BAB83763.1| S-adenosylmethionine decarboxylase [Phaseolus lunatus]
Length=354

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEI F +P IF +P+G+GL+ L+K QLD++L PA CTIVSSL+N +
Sbjct  1    MAVSAIGFEGYEKRLEICFSQPGIFADPEGRGLRVLTKSQLDEILTPAACTIVSSLSNED  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+ AD L L V+SV YTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLTVRSVTYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD---SADDEHPT  728
            AQ  PH +F+EEV +L+ YFG LGSGS +Y+MG  D +Q+WH+YSASAD   S+D     
Sbjct  121  AQPHPHCSFTEEVAILNDYFGKLGSGSMAYIMGSPDKKQKWHIYSASADPLISSDTN--V  178

Query  729  YTLEMCMT  752
             TLEMCMT
Sbjct  179  CTLEMCMT  186



>sp|O65354.1|DCAM_HELAN RecName: Full=S-adenosylmethionine decarboxylase proenzyme; Short=AdoMetDC; 
Short=SAMDC; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase beta chain; Flags: Precursor 
[Helianthus annuus]
 gb|AAC17449.1| S-adenosylmethionine decarboxylase [Helianthus annuus]
Length=361

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +3

Query  204  VSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVD  383
             SAIGFEG+EKRLEISFF P    +P  +GL+SL+K QLD+ L PAECTIVSSL+N+ +D
Sbjct  2    TSAIGFEGFEKRLEISFFNPGPSVDPVARGLRSLTKNQLDKFLAPAECTIVSSLSNDLLD  61

Query  384  SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQ  563
            SYVLSESSLFVYPYKIIIKTCGTTKLLLSIP ILEL+  L L V+SVRYTRGSFIFPGAQ
Sbjct  62   SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPHILELSGELSLTVQSVRYTRGSFIFPGAQ  121

Query  564  SFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSAD---DEHPTYT  734
            +FPHR+F+EEV VLD +FG LG  S +YVMGG +  Q+WHVYSASA+SA+      P YT
Sbjct  122  TFPHRSFTEEVMVLDSHFGKLGMCSNAYVMGGAEKDQKWHVYSASAESANLVTQTAPVYT  181

Query  735  LEMCMT  752
            LEM MT
Sbjct  182  LEMSMT  187



>ref|XP_006395646.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 ref|XP_006395647.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32932.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
 gb|ESQ32933.1| hypothetical protein EUTSA_v10004463mg [Eutrema salsugineum]
Length=362

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 158/190 (83%), Gaps = 5/190 (3%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEG+EKRLEISFF+P +F +P+G+GL++L+K QLD++L PA C+IVSSL+N+ 
Sbjct  1    MAVSAIGFEGFEKRLEISFFKPSVFLDPEGKGLRALTKAQLDEILTPAACSIVSSLSNSF  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIP IL LAD L L VKSVRYTRGSFIF  
Sbjct  61   VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPHILNLADSLSLTVKSVRYTRGSFIFSV  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSASADSADD----EH  722
            AQS+PHR FSEEV +LDGYFG L SGSK+ VMGG  +  Q+WHVYSAS+ S +     + 
Sbjct  121  AQSYPHRCFSEEVALLDGYFGNLKSGSKALVMGGSANNPQRWHVYSASSSSDEAAAACDK  180

Query  723  PTYTLEMCMT  752
            P YTLEMCMT
Sbjct  181  PVYTLEMCMT  190



>gb|AAB17665.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=366

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S + +MG  D  ++WHVY+ASA DS++  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTQLGLNSVATLMGNDDETKKWHVYAASAQDSSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|XP_006299023.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
 gb|EOA31921.1| hypothetical protein CARUB_v10015160mg [Capsella rubella]
Length=426

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = +3

Query  174  PFVQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTI  353
            P +  +  M +SAIGFEGYEKRLE++FFEP IF + KG GL++L+K QLD++L PA CTI
Sbjct  53   PSLTQQGEMALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTI  112

Query  354  VSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYT  533
            VSSL+N+++DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YT
Sbjct  113  VSSLSNDQLDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYT  172

Query  534  RGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSA  710
            RGSF+ PG Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA DS+
Sbjct  173  RGSFLCPGGQPFPHRSFSEEVSVLDGHFSQLGLNSVAYLMGNDDETKKWHVYAASAQDSS  232

Query  711  DDEHPTYTLEMCMT  752
            +  +  +TLEMCMT
Sbjct  233  NCNNNVFTLEMCMT  246



>ref|XP_009147351.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=364

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SF EP IF + KG GL++L++ QLDQ+L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFLEPSIFQDTKGLGLRALTRSQLDQILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKT GTTKLLLSIPP+LELA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTSGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA S  D +  YTL
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASAQSFSDNNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>gb|KEH21806.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=385

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  SAIGFEGYEKRLEI+FFE   F++P G GL++LSK+Q+D++L PAECTIV SL+N
Sbjct  47   MTVTNSAIGFEGYEKRLEITFFENGFFSDPAGLGLRALSKDQIDEILKPAECTIVDSLSN  106

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            ++VDSYVLSESSLF+Y YK+IIKTCGTTKLLLSIP IL+LAD +++ VKSVRYTRGSFIF
Sbjct  107  DDVDSYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADCVNIAVKSVRYTRGSFIF  166

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSA  710
            PGAQSFPHR+FSEEV VLD YFG LGSGS++Y+MG  D  Q WH+YSA+ + A
Sbjct  167  PGAQSFPHRSFSEEVAVLDSYFGKLGSGSQAYMMGDADKSQIWHIYSANKEKA  219



>ref|XP_010492454.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2 [Camelina 
sativa]
 ref|XP_010492455.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2 [Camelina 
sativa]
Length=363

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP +F + +G+GL++LSK Q+D++L PAECTIVSSL+N++
Sbjct  1    MAMSAIGFEGYEKRLEVTFFEPGLFLDTQGKGLRALSKSQIDEILQPAECTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLSI P+L LA  L L+VK+VRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLAVELSLEVKAVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSA-DDEHPTYT  734
             Q FPHRNFSEEV VLDG+F  LG  S +++MG  D  ++WHVYSASA+ A ++ +  YT
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKLGLSSVAHLMGNDDETKKWHVYSASAEKANNNNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>emb|CDX70666.1| BnaC03g07500D [Brassica napus]
Length=363

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VS+IGFEGYEKRLE++FFEP IF + +G GL++L+K Q+D++L PAECTIVSSL+N+ 
Sbjct  1    MSVSSIGFEGYEKRLEVTFFEPSIFLDTQGLGLRALTKSQIDEILQPAECTIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L LA+ L L V+SVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLANELSLDVESVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPT-YT  734
             Q FPHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVYSAS+ + +  +   YT
Sbjct  121  GQPFPHRNFSEEVSVLDGHFTKLGLSSVAYLMGKDDETKKWHVYSASSPAKNSNNSNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>sp|Q9SDM8.1|DCAM3_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 3; 
Short=AdoMetDC 3; Short=SAMDC 3; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 3 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 3 beta chain; 
Flags: Precursor [Brassica juncea]
 gb|AAF20160.1|AF215665_1 S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=367

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD-SADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA  S+D  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDENKKWHVYAASAQTSSDCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|AGV54395.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=354

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSA+ FEGYEKRLEI F +P +F +P+ +GL+ L+K QLD++L PA CTIVSSL+N++
Sbjct  1    MAVSALRFEGYEKRLEICFSQPGLFADPERRGLRVLTKSQLDEILTPAACTIVSSLSNDD  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVY YKIIIKTCGTTKLLLSIPPIL+ AD L LKVKSV YTRGSFIFPG
Sbjct  61   VDSYVLSESSLFVYAYKIIIKTCGTTKLLLSIPPILKFADMLSLKVKSVTYTRGSFIFPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD---SADDEHPT  728
            AQ  PHR F+EEV +L+ YFG LGSGS +++MG  D +Q+WH+YSASAD   S+D     
Sbjct  121  AQPHPHRCFTEEVAILNDYFGKLGSGSMAFIMGSPDKKQKWHIYSASADPLISSDTN--V  178

Query  729  YTLEMCMT  752
             TLEMCMT
Sbjct  179  CTLEMCMT  186



>emb|CDY26478.1| BnaC09g41900D [Brassica napus]
Length=367

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP +F +  G+GL++L K  +D++L PAECTIVSSL+N+E
Sbjct  1    MSLSAIGFEGYEKRLEVSFFEPSLFLDTHGKGLRALPKSHVDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L LA  L L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLAGELSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSAS--ADSADDEHPTY  731
             Q FPHRNFSEEV VLDG F  +G  S +Y+MG  D  ++WHVYSAS  A + +  +  Y
Sbjct  121  GQPFPHRNFSEEVSVLDGLFAKMGLSSVAYLMGDDDETKKWHVYSASAPAKNTNSNNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>gb|AAS45435.1| S-adenosylmethionine decarboxylase [Brassica juncea]
Length=366

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP IF + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS-ADDEHPTYT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA + ++  +  YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFSKLGLNSVAYLMGNDDETRKWHVYAASAQAPSNCNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|XP_010453744.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Camelina sativa]
Length=364

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP +F + +G+GL++L+K Q+D++L PAECTIVSSL+N +
Sbjct  1    MAMSAIGFEGYEKRLEVTFFEPGLFLDTQGKGLRALAKSQIDEILQPAECTIVSSLSNEQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLSI P+L LA  L L+VK+VRYTRG+F+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLAGDLSLEVKAVRYTRGNFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSA--DDEHPTY  731
             Q FPHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVYSASA  A  ++ +  Y
Sbjct  121  GQPFPHRNFSEEVSVLDGHFIKLGLSSVAYLMGNDDETKKWHVYSASAKKANNNNNNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>emb|CDX74257.1| BnaA03g27900D [Brassica napus]
Length=368

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA--DSADDEHPTY  731
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+   S+D  +  Y
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDENKKWHVYAASSAQTSSDCNNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_009134671.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3 [Brassica 
rapa]
Length=368

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA--DSADDEHPTY  731
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+   S+D  +  Y
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLSSVAYLMGNDDENKKWHVYAASSAQTSSDCNNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>ref|XP_010420276.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 2-like 
[Camelina sativa]
Length=364

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 156/186 (84%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP +F + +G+GL++L+K Q+D++L PAECTIVSSL+N++
Sbjct  1    MAMSAIGFEGYEKRLEVTFFEPGLFLDTQGKGLRALAKSQIDEILQPAECTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLS+ P+L LA  L L+VK+VRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSVEPLLRLAAELSLEVKAVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSA-DDEHPTYT  734
             Q FPHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVYSAS + A ++ +  YT
Sbjct  121  GQPFPHRNFSEEVSVLDGHFVKLGLSSVAYLMGKDDETKKWHVYSASVEKANNNNNNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|ADG57793.1| S-adenosyl-l-methionine decarboxylase 3-2 [Brassica napus]
Length=368

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA--DSADDEHPTY  731
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+   S+D  +  Y
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDENKKWHVYAASSAQTSSDCNNNVY  180

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  181  TLEMCMT  187



>emb|CDY43235.1| BnaC05g48280D [Brassica napus]
Length=463

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 152/187 (81%), Gaps = 1/187 (1%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            +M +SAIGFEGYEKRLE+SF EP IF + KG GL++L++ QLDQ+L PA C IVSSL+N+
Sbjct  98   TMALSAIGFEGYEKRLEVSFLEPSIFQDSKGLGLRALTRSQLDQILTPAACEIVSSLSND  157

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
             +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+LELA  L L VKSV+YTRGSF+ P
Sbjct  158  HLDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLELAGELSLSVKSVKYTRGSFLCP  217

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASA-DSADDEHPTY  731
            G Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+  S+ D +  Y
Sbjct  218  GGQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASSPQSSGDNNNVY  277

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  278  TLEMCMT  284



>emb|CDX91992.1| BnaC03g32940D [Brassica napus]
Length=367

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELYLNVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPT-YT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA ++ D +   YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETRKWHVYAASAQTSSDCNSNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|ADG57791.1| S-adenosyl-l-methionine decarboxylase 3-1 [Brassica napus]
Length=367

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP  F + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSFFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L VKSV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELYLNVKSVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPT-YT  734
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+ASA ++ D +   YT
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETRKWHVYAASAQTSSDCNSNVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>gb|AAR15894.1| S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=369

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 153/189 (81%), Gaps = 4/189 (2%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLE+SFFEP +F +  G+GL++L K Q+D++L PAECTIVSSL+N+E
Sbjct  1    MSVSAIGFEGYEKRLEVSFFEPSLFVDTHGKGLRALPKSQIDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLL SI P+L LA  L L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLPSIEPLLRLAGELSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS----ADDEHP  725
             Q FPHRNFSEEV VLDG+F  +G  S +Y+MG  D  ++WHVYSASA +     ++ + 
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDETKKWHVYSASAPARNGNGNNNNN  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>sp|O49972.1|DCAM2_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC 2; Short=SAMDC 2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 2 beta chain; 
Flags: Precursor [Brassica juncea]
 gb|AAB88273.1| S-adenosyl-L-methionine decarboxylase [Brassica juncea]
Length=369

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 153/189 (81%), Gaps = 4/189 (2%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLE+SFFEP +F +  G+GL++L K Q+D++L PAECTIVSSL+N+E
Sbjct  1    MSVSAIGFEGYEKRLEVSFFEPSLFVDTHGKGLRALPKSQIDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLL SI P+L LA  L L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLPSIEPLLRLAGELSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADS----ADDEHP  725
             Q FPHRNFSEEV VLDG+F  +G  S +Y+MG  D  ++WHVYSASA +     ++ + 
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKMGLSSVAYLMGDDDETKKWHVYSASAPARNGNGNNNNN  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|NP_197099.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 ref|NP_001031888.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 sp|Q9S7T9.1|DCAM2_ARATH RecName: Full=S-adenosylmethionine decarboxylase proenzyme 2; 
Short=AdoMetDC2; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 alpha chain; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 2 beta chain; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL32007.1|AF436825_1 AT5g15950/F1N13_90 [Arabidopsis thaliana]
 emb|CAB63805.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 emb|CAB64672.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
 emb|CAC01794.1| S-adenosylmethionine decarboxylase (adoMetDC2) [Arabidopsis thaliana]
 gb|AAL47397.1| AT5g15950/F1N13_90 [Arabidopsis thaliana]
 gb|AED92227.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
 gb|AED92228.1| S-adenosylmethionine decarboxylase proenzyme 2 [Arabidopsis thaliana]
Length=362

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP +F + +G+GL++L+K Q+D++L PAECTIVSSL+N++
Sbjct  1    MAMSAIGFEGYEKRLEVTFFEPGLFLDTQGKGLRALAKSQIDEILQPAECTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLSI P+L LA  L L VK+VRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLAGELSLDVKAVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVYSAS+ ++++++  YTL
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKLGLSSVAYLMGNDDETKKWHVYSASSANSNNKNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_006400122.1| hypothetical protein EUTSA_v10015260mg [Eutrema salsugineum]
 gb|ESQ41575.1| hypothetical protein EUTSA_v10015260mg [Eutrema salsugineum]
Length=369

 Score =   257 bits (656),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M+M VSAIGFEGYEKRLE+SFFEP +F + +G+GL++L+K Q+D++L PAECTIVSSL+N
Sbjct  1    MAMSVSAIGFEGYEKRLEVSFFEPSLFLDTQGRGLRALAKSQIDEILQPAECTIVSSLSN  60

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            +++DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L LA  L L VKSVRYTRGSF+ 
Sbjct  61   DQLDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLASELSLDVKSVRYTRGSFLC  120

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVY--SASADSADDEHP  725
            PG Q  PHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY  S+ A S    + 
Sbjct  121  PGGQPCPHRNFSEEVSVLDGHFAKLGLSSVAYLMGNDDETKKWHVYSASSPAKSYSSSNN  180

Query  726  TYTLEMCMT  752
             YTLEMCMT
Sbjct  181  VYTLEMCMT  189



>ref|XP_002871694.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH47953.1| adenosylmethionine decarboxylase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=363

 Score =   256 bits (654),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE++FFEP +F + +G+GL++L+K Q+D++L PAECTIVSSL+N++
Sbjct  1    MAMSAIGFEGYEKRLEVTFFEPGLFLDTQGKGLRALTKSQIDEILQPAECTIVSSLSNDQ  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKI+IKTCGTTKLLLSI P+L LA  L L VK+VRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIVIKTCGTTKLLLSIEPLLRLACELSLDVKAVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHRNFSEEV VLDG+F  LG  S +Y+MG  D  ++WHVYSAS+ ++++ +  YTL
Sbjct  121  GQPFPHRNFSEEVSVLDGHFAKLGLSSVAYLMGNDDETKKWHVYSASSANSNNNNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>sp|Q42613.1|DCAM1_BRAJU RecName: Full=S-adenosylmethionine decarboxylase proenzyme 1; 
Short=AdoMetDC 1; Short=SAMDC 1; Contains: RecName: Full=S-adenosylmethionine 
decarboxylase 1 alpha chain; Contains: RecName: 
Full=S-adenosylmethionine decarboxylase 1 beta chain; 
Flags: Precursor [Brassica juncea]
 emb|CAA65044.1| S-adenosylmethionine decarboxylase [Brassica juncea]
Length=368

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 153/187 (82%), Gaps = 2/187 (1%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEG  +RLE+SFFEP +F +  G+GL++LSK Q+D++L PAECTIVSSL+N+E
Sbjct  1    MSLSAIGFEGLRERLEVSFFEPSLFLDTHGKGLRALSKSQIDEILAPAECTIVSSLSNDE  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLF++PYKIIIKTCGTTKLLLSI P+L LA G+ L+VKSVRYTRGSF+ PG
Sbjct  61   LDSYVLSESSLFIFPYKIIIKTCGTTKLLLSIEPLLRLAGGVSLEVKSVRYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSAS--ADSADDEHPTY  731
             Q FP RN SEEV VLDG+F  +G  S +Y+MG  D  ++WHVYSAS  A +++ ++  Y
Sbjct  121  GQPFPQRNLSEEVSVLDGHFAKMGLSSVAYLMGDDDETKKWHVYSASAPAKNSNGDNNVY  180

Query  732  TLEMCMT  752
            TLEMCM+
Sbjct  181  TLEMCMS  187



>emb|CDY71278.1| BnaAnng36830D [Brassica napus]
Length=363

 Score =   256 bits (653),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP IF + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L V+SV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+  +   +  YTL
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASSGQSSSSNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>ref|XP_009118044.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme 3-like 
[Brassica rapa]
Length=363

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +SAIGFEGYEKRLE+SFFEP IF + KG GL++L++ QLD++L PA C IVSSL+N+ 
Sbjct  1    MALSAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAACEIVSSLSNDH  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L V+SV+YTRGSF+ PG
Sbjct  61   LDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESVKYTRGSFLCPG  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEHPTYTL  737
             Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+  +   +  YTL
Sbjct  121  GQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASSAQSSSNNNVYTL  180

Query  738  EMCMT  752
            EMCMT
Sbjct  181  EMCMT  185



>emb|CDY71710.1| BnaAnng38530D [Brassica napus]
Length=429

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = +3

Query  165  NRTPFVQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAE  344
            NR+  + ++  M +SAIGFEGYEKRLE+SFFEP IF + KG GL++L++ QLD++L PA 
Sbjct  57   NRS-LLLLQGDMALSAIGFEGYEKRLEVSFFEPSIFQDSKGLGLRALTRSQLDEILTPAA  115

Query  345  CTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSV  524
            C IVSSL+N+ +DSYVLSESS FVYPYK+IIKTCGTTKLLLSIPP+L+LA  L L V+SV
Sbjct  116  CEIVSSLSNDHLDSYVLSESSFFVYPYKVIIKTCGTTKLLLSIPPLLKLAGELSLSVESV  175

Query  525  RYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD  704
            +YTRGSF+ PG Q FPHR+FSEEV VLDG+F  LG  S +Y+MG  D  ++WHVY+AS+ 
Sbjct  176  KYTRGSFLCPGGQPFPHRSFSEEVSVLDGHFTKLGLNSVAYLMGNDDETKKWHVYAASSA  235

Query  705  SADDEHPTYTLEMCMT  752
             +   +  YTLEMCMT
Sbjct  236  QSSSNNNVYTLEMCMT  251



>ref|XP_010692003.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Beta vulgaris subsp. vulgaris]
Length=358

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 144/188 (77%), Gaps = 7/188 (4%)
 Frame = +3

Query  192  MSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            M++  S IGFEGYEKRLEI FF      N  G GL+SL+K QLD++L PAECTIV SL+N
Sbjct  1    MALVSSPIGFEGYEKRLEICFF------NSAGNGLRSLTKNQLDKILEPAECTIVDSLSN  54

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
            + VDSYVLSESSLF+YP+KIIIKTCGTTKLLLSIP IL LA+ L L ++SVRYTRGSFIF
Sbjct  55   DHVDSYVLSESSLFIYPHKIIIKTCGTTKLLLSIPVILHLAETLALTIRSVRYTRGSFIF  114

Query  552  PGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD-SADDEHPT  728
            P  Q FPHRNFSEEV  LD YF  LG GS++ VMG +   Q+WHVYSA+ +    D H  
Sbjct  115  PSVQPFPHRNFSEEVATLDSYFSKLGLGSEACVMGSLKSPQKWHVYSATVEPPCYDSHQN  174

Query  729  YTLEMCMT  752
            +TLEMCMT
Sbjct  175  FTLEMCMT  182



>gb|AAR00210.1| S-adenosylmethionine decarboxylase [Phaseolus vulgaris]
Length=312

 Score =   246 bits (629),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 145/176 (82%), Gaps = 5/176 (3%)
 Frame = +3

Query  234  KRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLF  413
            KRLEISF +P +F +P+G+GL+ L+K QLD++L PA CTIVSSL+N++VDSYVLSESSLF
Sbjct  1    KRLEISFSQPGLFADPEGRGLRVLTKSQLDEILTPAACTIVSSLSNDDVDSYVLSESSLF  60

Query  414  VYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEE  593
            VY YKIIIKTCGTTKLLLSIPPIL+ AD L LKVKSV YTRGSFIFPGAQ  PHR F+EE
Sbjct  61   VYAYKIIIKTCGTTKLLLSIPPILKFADMLSLKVKSVTYTRGSFIFPGAQPHPHRCFTEE  120

Query  594  VDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASAD---SADDEHPTYTLEMCMT  752
            V +L+ YFG LGSGS +++MG  D +Q+WH+YSASAD   S+D      TLEMCMT
Sbjct  121  VAILNDYFGKLGSGSMAFIMGSPDKKQKWHIYSASADPLISSDTN--VCTLEMCMT  174



>ref|XP_010430714.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Camelina sativa]
Length=320

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 145/171 (85%), Gaps = 9/171 (5%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M +S IGFEG+E RLEISFFEP +F       L++L+K QLD++L PAECTIVSSL+N+ 
Sbjct  1    MAISTIGFEGFEXRLEISFFEPSVFX------LRALTKSQLDEILTPAECTIVSSLSNSL  54

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            VDSYVLSESSLFVYPYKIIIKTCGTTKLL  IP IL LA+ L LKVKSVRYTRGSFIFPG
Sbjct  55   VDSYVLSESSLFVYPYKIIIKTCGTTKLLFLIPHILRLAESLSLKVKSVRYTRGSFIFPG  114

Query  558  AQSFPHRNFSEEVDVLDGYFG-VLGSGSKSYVMGGVD--PQQQWHVYSASA  701
            AQS+PHR+FSEEV +LDGYFG +L +GSK++V+GG+D  PQ+ WHVYSAS+
Sbjct  115  AQSYPHRSFSEEVALLDGYFGKLLNAGSKAFVLGGLDNNPQRGWHVYSASS  165



>gb|KEH21807.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=356

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  189  KMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLA  368
             M+M  SAIGFEGYEKRLEI+FFE  +F++P G GL++LS++Q+D++L PAECTIV SL+
Sbjct  46   NMTMTNSAIGFEGYEKRLEITFFENGVFSDPSGLGLRALSRDQIDEILKPAECTIVDSLS  105

Query  369  NNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFI  548
            N+ VDSYVLSESSLF+Y YK+IIKTCGTTKLLLSIP IL+LADGL++ VKSVRYTRGSFI
Sbjct  106  NDYVDSYVLSESSLFIYAYKLIIKTCGTTKLLLSIPAILKLADGLNITVKSVRYTRGSFI  165

Query  549  FPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMG  656
            FPGAQSFPHR+FSEEV VLD YFG LGSGS++Y+MG
Sbjct  166  FPGAQSFPHRSFSEEVAVLDSYFGKLGSGSQAYMMG  201



>gb|AEW43295.1| putative S-adenosylmethionine decarboxylase, partial [Hevea brasiliensis]
Length=252

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +3

Query  276  NPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTT  455
            +P+G+GL++LSK  LD++L PAECTIV SL+N+ VDSYVLSESSLFVYPYKIIIKTCGTT
Sbjct  2    DPEGKGLRTLSKAHLDEILGPAECTIVDSLSNDHVDSYVLSESSLFVYPYKIIIKTCGTT  61

Query  456  KLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSG  635
            KLLL+IPPIL+LAD L L VKSVRYTRGSFIFPGAQS+PHR+FSEEV VLD YFG LG+ 
Sbjct  62   KLLLAIPPILKLADALSLAVKSVRYTRGSFIFPGAQSYPHRSFSEEVCVLDSYFGKLGAE  121

Query  636  SKSYVMGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            SK+ VM G D   +WH+YSASAD A      YT+EMCMT
Sbjct  122  SKACVMVGYDSPHKWHIYSASADPAISCDHAYTIEMCMT  160



>gb|ADQ37302.1| putative S-adenosyl methionine decarboxylase [Pinus sylvestris]
Length=386

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 146/188 (78%), Gaps = 3/188 (2%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            +P++AIGFEG+EKRLE+ FF P IF +P+G+GL++L++  LD++L+ A+CTIVS L+N  
Sbjct  10   VPMTAIGFEGFEKRLEVEFFAPSIFNDPEGRGLRALTRADLDEMLDAAQCTIVSELSNEH  69

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
            +DSYVLSESSLFVYPYK+++KTCGTTKLLLSIP IL+ A  L L VK+V+YTRG+FIF G
Sbjct  70   LDSYVLSESSLFVYPYKLVLKTCGTTKLLLSIPLILKNASKLSLSVKNVKYTRGTFIFAG  129

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEH---PT  728
             Q FPHR+F EE+  LD YFG LGSG K+YVMG       WHVYSASA     E    P 
Sbjct  130  VQPFPHRSFGEEISYLDKYFGKLGSGGKAYVMGDSGKGYNWHVYSASAVDTSFEGNAPPV  189

Query  729  YTLEMCMT  752
            YTLEMCMT
Sbjct  190  YTLEMCMT  197



>gb|ABK25576.1| unknown [Picea sitchensis]
Length=373

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = +3

Query  204  VSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVD  383
            ++AIGFEG+EKRLE+ FF P IF +P+ +GL++L++ +LD++L+ A+CTIVS L+N  +D
Sbjct  1    MTAIGFEGFEKRLEVEFFAPSIFNDPERRGLRALTRAELDEMLDAAQCTIVSELSNEHLD  60

Query  384  SYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQ  563
            SYVLSESSLFVYPYK ++KTCGTTKLLLSIP IL+ A  L L VK+V+YTRG+FIF G Q
Sbjct  61   SYVLSESSLFVYPYKFVLKTCGTTKLLLSIPLILKNASKLSLSVKNVKYTRGTFIFAGVQ  120

Query  564  SFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEH---PTYT  734
             FPHR+F EEV  LD YFG LGSG K+YVMG       WHVY+ASA+ A  E    P YT
Sbjct  121  PFPHRSFGEEVSYLDKYFGKLGSGGKAYVMGDSGKAYNWHVYTASAEDASFEGNAPPVYT  180

Query  735  LEMCMT  752
            LEMCMT
Sbjct  181  LEMCMT  186



>ref|XP_009765510.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme, partial 
[Nicotiana sylvestris]
Length=327

 Score =   243 bits (619),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  288  QGLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLL  467
            +GL+SLSK QLD++L PAECTIV SL+N++VDSYVLSESSLFVY YKIIIKTCGTTKLLL
Sbjct  1    KGLRSLSKAQLDEILGPAECTIVDSLSNDDVDSYVLSESSLFVYSYKIIIKTCGTTKLLL  60

Query  468  SIPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSY  647
            +IPPIL+LA+ L LKV+ VRYTRGSFIFPGAQSFPHR+FSEEV VLDGYFG L +GSK+ 
Sbjct  61   AIPPILKLAETLSLKVQDVRYTRGSFIFPGAQSFPHRHFSEEVAVLDGYFGKLAAGSKAV  120

Query  648  VMGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            +MG  D  Q+WHVYSASA       P YTLEMCMT
Sbjct  121  IMGSPDKAQKWHVYSASAGPIQSNDPVYTLEMCMT  155



>gb|ABR17745.1| unknown [Picea sitchensis]
Length=384

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  201  PVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEV  380
            P++AIGFEG+EKRLE+ FF P IF +P+ +GL++L++ +LD++L+ A+CTIVS L+N  +
Sbjct  11   PMTAIGFEGFEKRLEVEFFAPSIFNDPERRGLRALTRAELDEMLDAAQCTIVSELSNEHL  70

Query  381  DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGA  560
            DSYVLSESSLFVYPYK ++KTCGTTKLLLSIP IL+ A  L L VK+V+YTRG+FIF G 
Sbjct  71   DSYVLSESSLFVYPYKFVLKTCGTTKLLLSIPLILKNASKLSLSVKNVKYTRGTFIFAGV  130

Query  561  QSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGVDPQQQWHVYSASADSADDEH---PTY  731
            Q FPHR+F EEV  LD YFG LGSG K+YVMG       W VY+ASA+ A  E    P Y
Sbjct  131  QPFPHRSFGEEVSYLDKYFGKLGSGGKAYVMGDSGKAYNWQVYTASAEDASFEGNAPPVY  190

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  191  TLEMCMT  197



>ref|XP_010277986.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nelumbo nucifera]
Length=391

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 147/187 (79%), Gaps = 5/187 (3%)
 Frame = +3

Query  207  SAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDS  386
            SAIGFEG+EKRLEI+F E  +F +P+G GL++L++ QLD +L PA+CTIV+ L+N+E DS
Sbjct  16   SAIGFEGFEKRLEITFSEAPVFVDPQGLGLRALTRAQLDSILEPAKCTIVAQLSNSEFDS  75

Query  387  YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQS  566
            YVLSESSLFVYP KII+KTCGTTKLLLSIPPILELA+ L L V SV+Y+RGSFIFP AQ 
Sbjct  76   YVLSESSLFVYPLKIILKTCGTTKLLLSIPPILELANSLSLSVYSVKYSRGSFIFPTAQP  135

Query  567  FPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSA----SADSADDEHPTY  731
             PHR FSEEV VL+G+FG L SG ++YV+G    P + WHVY+A    S  S +D+    
Sbjct  136  APHRGFSEEVSVLNGFFGNLASGGQAYVIGDPAVPNRNWHVYAACQNPSTSSRNDQTVVV  195

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  196  TLEMCMT  202



>gb|EPS67756.1| hypothetical protein M569_07018, partial [Genlisea aurea]
Length=411

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKG--QGLQSLSKEQLDQVLNPAECTIVSSLAN  371
            +PVSAIGFEGYEKRLEISF +  +F++  G  +GL+SLS+ QLDQ+L+ A+CTIVSSL N
Sbjct  48   IPVSAIGFEGYEKRLEISFSKLGLFSSDLGNSRGLRSLSRAQLDQILDAAQCTIVSSLKN  107

Query  372  NEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIF  551
             EVDSYVLSESSLFVYPYKII+KTCGTTKLLLSIPP+L +A  + L   SVRYTRGSFIF
Sbjct  108  EEVDSYVLSESSLFVYPYKIILKTCGTTKLLLSIPPVLGMAREIGLTPSSVRYTRGSFIF  167

Query  552  PGAQSFPHRNFSEEVDVLDGYFGV-LGSGSKSYVMGGVDPQQQWHVYSASADSADD--EH  722
            PGAQ FPHR+FSEEV VLD +F   LG  S+++++GG D  ++WHVYSA+A S  +    
Sbjct  168  PGAQPFPHRSFSEEVSVLDHHFTAELGLTSQAFIVGG-DDSEKWHVYSAAAPSEINSISS  226

Query  723  PTYTLEMCMT  752
            P YTLEMCMT
Sbjct  227  PVYTLEMCMT  236



>gb|ACE97512.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97516.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97518.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSAPVYTLEMCMT  154



>gb|ACE97514.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSAPVYTLEMCMT  154



>gb|ACE97515.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSAPVYTLEMCMT  154



>gb|ACE97508.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSAPVYTLEMCMT  154



>gb|ACE97505.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSAPVYTLEMCMT  154



>gb|ACE97491.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97493.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97494.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97506.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSGPVYTLEMCMT  154



>gb|ACE97522.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSGPVYTLEMCMT  154



>gb|ACE97499.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97503.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97521.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97527.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97528.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSGPVYTLEMCMT  154



>gb|ACE97495.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97497.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97498.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97500.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97504.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97509.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97519.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97524.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97525.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSGPVYTLEMCMT  154



>gb|ACE97520.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSELGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSGPVYTLEMCMT  154



>gb|ACE97501.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97511.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97523.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97526.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSGPVYTLEMCMT  154



>gb|ACE97513.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97517.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSGPVYTLEMCMT  154



>gb|ACE97496.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97502.1| S-adenosylmethionine decarboxylase [Populus tremula]
 gb|ACE97510.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILRPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSELGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIESHSGPVYTLEMCMT  154



>gb|ACE97492.1| S-adenosylmethionine decarboxylase [Populus tremula]
Length=242

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  291  GLQSLSKEQLDQVLNPAECTIVSSLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLS  470
            GL+SLSK QLD++L PAECTIV  L+N++VDSYVLSESSLFVYPYK+IIKTCGTTKLLLS
Sbjct  1    GLRSLSKAQLDEILKPAECTIVDLLSNDQVDSYVLSESSLFVYPYKVIIKTCGTTKLLLS  60

Query  471  IPPILELADGLDLKVKSVRYTRGSFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYV  650
            IP IL+LAD L L V SVRYTRGSF+ PGAQ FPHRNF EEV VLDG+F  LG  S +YV
Sbjct  61   IPVILKLADALSLTVCSVRYTRGSFLCPGAQPFPHRNFCEEVAVLDGHFSKLGLNSVAYV  120

Query  651  MGGVDPQQQWHVYSASADSADDEHPTYTLEMCMT  752
            MGG+D  Q+WHVYSASAD      P YTLEMCMT
Sbjct  121  MGGLDKTQKWHVYSASADIERHSGPVYTLEMCMT  154



>ref|NP_001047404.1| Os02g0611200 [Oryza sativa Japonica Group]
 emb|CAB64600.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19232.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAD19677.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa Japonica Group]
 dbj|BAF09318.1| Os02g0611200 [Oryza sativa Japonica Group]
 gb|AFI71861.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
 gb|AGH17542.1| S-adenosylmethionine decarboxylase 2 [Oryza sativa]
Length=395

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 147/192 (77%), Gaps = 4/192 (2%)
 Frame = +3

Query  180  VQVKMSMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVS  359
            + V  S PVSAIGFEGYEKRLEI+F E  +F +P G+GL++LS+ Q+D VL+ A CTIVS
Sbjct  4    LSVADSPPVSAIGFEGYEKRLEITFSEAPVFADPNGRGLRALSRAQIDSVLDLARCTIVS  63

Query  360  SLANNEVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRG  539
             L+N   DSYVLSESSLFVYPYKI+IKTCGTTKLLL+IP ILELA+ L L +++V+Y+RG
Sbjct  64   ELSNEVFDSYVLSESSLFVYPYKIVIKTCGTTKLLLAIPRILELAEELSLPLEAVKYSRG  123

Query  540  SFIFPGAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSASADSADD  716
            +FIFP AQ  PH+NFSEEV VL+ YFG L SG  +YV+G    P Q+WHVY A+      
Sbjct  124  TFIFPEAQPSPHKNFSEEVAVLNRYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQHP---  180

Query  717  EHPTYTLEMCMT  752
            E P  TLEMCMT
Sbjct  181  EQPVVTLEMCMT  192



>ref|XP_002462403.1| hypothetical protein SORBIDRAFT_02g025110 [Sorghum bicolor]
 gb|EER98924.1| hypothetical protein SORBIDRAFT_02g025110 [Sorghum bicolor]
Length=395

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 144/187 (77%), Gaps = 4/187 (2%)
 Frame = +3

Query  195  SMPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANN  374
            S P S IGFEGYEKRLEI+F +  +F +P G GL++LS+EQ+D  L+ A CTIVS L+N 
Sbjct  11   SSPTSPIGFEGYEKRLEITFSDAPVFEDPCGLGLRALSREQIDSFLDLARCTIVSQLSNK  70

Query  375  EVDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFP  554
              DSYVLSESSLFVYP+K+++KTCGTTKLLLSIP ILELA GL L V S +Y+RG+FIFP
Sbjct  71   NFDSYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAGLSLPVLSAKYSRGTFIFP  130

Query  555  GAQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGGV-DPQQQWHVYSASADSADDEHPTY  731
            GAQ  PHR+FSEEV VL+G+FG L SG  +YV+G    P ++WHVY A+ +    EHP  
Sbjct  131  GAQPAPHRSFSEEVSVLNGFFGNLKSGGNAYVIGDTFKPNKKWHVYYATEEP---EHPMV  187

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  188  TLEMCMT  194



>gb|EMS62883.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=388

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = +3

Query  198  MPVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNE  377
            M VSAIGFEGYEKRLEI+F E  +FT+P G+GL++LS+ Q+D VL+ A+CTIVS L+N++
Sbjct  1    MAVSAIGFEGYEKRLEITFSEAPVFTDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNDK  60

Query  378  VDSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPG  557
             DSYVLSESSLF+YPYK++IKTCGTTKLLL+IP ILELA+ L L + +V+Y+RG+FIFP 
Sbjct  61   FDSYVLSESSLFIYPYKVVIKTCGTTKLLLAIPRILELAEELSLPLAAVKYSRGTFIFPE  120

Query  558  AQSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSASADSADDEHPTYT  734
            AQ  PH+NFS+EV  L+GYFG L SG  +YV+G    P Q+WHVY A+      E P   
Sbjct  121  AQPSPHKNFSDEVAFLNGYFGGLKSGGNAYVIGDPAKPGQKWHVYYATQQP---EQPMVN  177

Query  735  LEMCMT  752
            LEMCMT
Sbjct  178  LEMCMT  183



>ref|XP_010235689.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Brachypodium distachyon]
Length=399

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 145/185 (78%), Gaps = 4/185 (2%)
 Frame = +3

Query  201  PVSAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEV  380
            PVSAIGFEG+EKRLEI+F E  +F++P G+GL++LS+ Q+D VL+ A+CTIVS L+N + 
Sbjct  11   PVSAIGFEGFEKRLEITFSEAPVFSDPNGRGLRALSRAQIDSVLDLAKCTIVSELSNEDF  70

Query  381  DSYVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGA  560
            DSYVLSESSLFVYPYK++IKTCGTTKLLL+IP ILELA+ L L + +V+Y+RG+FIFP A
Sbjct  71   DSYVLSESSLFVYPYKVVIKTCGTTKLLLAIPRILELAEELSLPLSAVKYSRGTFIFPEA  130

Query  561  QSFPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSASADSADDEHPTYTL  737
            Q  PH+NF++EV  L+GYFG L SG  +YV+G    P Q WHVY A+      EHP   L
Sbjct  131  QPAPHKNFADEVAFLNGYFGNLKSGGNAYVIGDPAKPGQNWHVYYATQQP---EHPVVNL  187

Query  738  EMCMT  752
            EMCMT
Sbjct  188  EMCMT  192



>ref|XP_010268432.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nelumbo nucifera]
Length=390

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 5/187 (3%)
 Frame = +3

Query  207  SAIGFEGYEKRLEISFFEPEIFTNPKGQGLQSLSKEQLDQVLNPAECTIVSSLANNEVDS  386
            SAIGFEG+EKRLEI+F E  +F +P+G GL++L++ QLD +L PA CTIV  L+N+E DS
Sbjct  16   SAIGFEGFEKRLEITFTEAPVFVDPQGLGLRALTRAQLDSILEPARCTIVDQLSNSEFDS  75

Query  387  YVLSESSLFVYPYKIIIKTCGTTKLLLSIPPILELADGLDLKVKSVRYTRGSFIFPGAQS  566
            YVLSESSLFVYP KII+KTCGTTKLLLSIPPILELA+ L L V SV+Y+RGSFIFP AQ 
Sbjct  76   YVLSESSLFVYPLKIILKTCGTTKLLLSIPPILELANSLTLSVYSVKYSRGSFIFPNAQP  135

Query  567  FPHRNFSEEVDVLDGYFGVLGSGSKSYVMGG-VDPQQQWHVYSAS----ADSADDEHPTY  731
             PH +FSEEV VL+G+FG L SG ++YV G    P + WHVY+AS      S +D+    
Sbjct  136  APHTSFSEEVAVLNGFFGNLPSGGQAYVTGDPAVPNRNWHVYAASQKPPMSSMNDQTAAV  195

Query  732  TLEMCMT  752
            TLEMCMT
Sbjct  196  TLEMCMT  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1296918549570