BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c47549_g1_i1 len=720 path=[698:0-719]

Length=720
                                                                      Score     E

ref|XP_011018122.1|  PREDICTED: EG45-like domain containing protein     174   2e-51   
ref|XP_004152324.1|  PREDICTED: EG45-like domain containing prote...    173   1e-50   
ref|XP_008454153.1|  PREDICTED: EG45-like domain containing protein     171   4e-50   
ref|XP_002324498.1|  hypothetical protein POPTR_0018s10730g             168   7e-49   Populus trichocarpa [western balsam poplar]
emb|CDP02908.1|  unnamed protein product                                166   3e-48   
emb|CDP02909.1|  unnamed protein product                                162   2e-46   
ref|XP_008223553.1|  PREDICTED: EG45-like domain containing protein     160   9e-46   
ref|XP_010926573.1|  PREDICTED: EG45-like domain containing protein     159   4e-45   
gb|EAZ09461.1|  hypothetical protein OsI_31732                          159   4e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_006660734.1|  PREDICTED: EG45-like domain containing prote...    158   5e-45   
ref|NP_001063448.1|  Os09g0472900                                       158   5e-45   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD22245.1|  putative blight-associated protein p12 precursor       158   6e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175882.1|  Os09g0472700                                       158   8e-45   
ref|XP_008780464.1|  PREDICTED: putative EG45-like domain contain...    156   3e-44   
ref|XP_008780453.1|  PREDICTED: EG45-like domain containing protein     153   5e-43   
ref|XP_004302408.1|  PREDICTED: EG45-like domain containing prote...    153   8e-43   
ref|XP_010926571.1|  PREDICTED: EG45-like domain containing protein     152   1e-42   
ref|XP_007223500.1|  hypothetical protein PRUPE_ppa013544mg             150   4e-42   
ref|XP_010652416.1|  PREDICTED: EG45-like domain containing protein     150   7e-42   
ref|XP_008223552.1|  PREDICTED: EG45-like domain containing protein     150   8e-42   
ref|XP_010649023.1|  PREDICTED: EG45-like domain containing protein     148   4e-41   
emb|CBI37189.3|  unnamed protein product                                153   5e-41   
ref|XP_007224320.1|  hypothetical protein PRUPE_ppa020356mg             147   1e-40   
emb|CBI26795.3|  unnamed protein product                                147   2e-40   
emb|CDP02911.1|  unnamed protein product                                145   6e-40   
ref|XP_006661338.1|  PREDICTED: EG45-like domain containing prote...    145   7e-40   
ref|XP_011069851.1|  PREDICTED: EG45-like domain containing protein     144   2e-39   
ref|XP_007011622.1|  Barwin-related endoglucanase                       145   2e-39   
ref|XP_002462560.1|  hypothetical protein SORBIDRAFT_02g028190          146   2e-39   Sorghum bicolor [broomcorn]
ref|XP_002527539.1|  ATEXPB4, putative                                  144   3e-39   Ricinus communis
ref|XP_008384747.1|  PREDICTED: EG45-like domain containing protein     143   3e-39   
gb|KDP38161.1|  hypothetical protein JCGZ_04804                         142   4e-39   
ref|XP_002438913.1|  hypothetical protein SORBIDRAFT_10g028070          142   6e-39   Sorghum bicolor [broomcorn]
ref|XP_004959535.1|  PREDICTED: EG45-like domain containing prote...    142   1e-38   
gb|ABX46166.1|  blight-associated protein P12                           140   2e-38   Citrus trifoliata [hardy orange]
gb|ABX46128.1|  blight-associated protein P12                           140   3e-38   Citrus webberi
ref|XP_006474112.1|  PREDICTED: EG45-like domain containing prote...    140   8e-38   
gb|ABX46151.1|  blight-associated protein P12                           139   8e-38   Citrus sinensis [apfelsine]
gb|ABX46124.1|  blight-associated protein P12                           139   8e-38   Citrus medica [Buddha's hand]
gb|ABX46122.1|  blight-associated protein P12                           139   1e-37   Citrus medica [Buddha's hand]
gb|ABX46135.1|  blight-associated protein P12                           139   1e-37   Citrus unshiu [satsuma mandarin]
ref|XP_002271904.1|  PREDICTED: EG45-like domain containing protein     139   2e-37   Vitis vinifera
emb|CAN65920.1|  hypothetical protein VITISV_043455                     148   2e-37   Vitis vinifera
gb|ABX46123.1|  blight-associated protein P12                           138   2e-37   Citrus medica [Buddha's hand]
ref|XP_006453477.1|  hypothetical protein CICLE_v10010217mg             139   2e-37   
ref|NP_001148968.1|  blight-associated protein p12 precursor            139   2e-37   Zea mays [maize]
emb|CBI24005.3|  unnamed protein product                                140   2e-37   
gb|ABX46126.1|  blight-associated protein P12                           138   3e-37   Citrus halimii [limau kadangsa]
gb|ABX46148.1|  blight-associated protein P12                           138   3e-37   Citrus aurantium [bitter orange]
gb|ABX46130.1|  blight-associated protein P12                           137   3e-37   Citrus longispina [canniisan]
gb|ABX46134.1|  blight-associated protein P12                           137   3e-37   Citrus unshiu [satsuma mandarin]
ref|XP_007011620.1|  Barwin-related endoglucanase, putative             137   4e-37   
gb|ABX46121.1|  blight-associated protein P12                           137   5e-37   Atalantia ceylanica
ref|XP_010926572.1|  PREDICTED: putative EG45-like domain contain...    137   5e-37   
gb|EYU42474.1|  hypothetical protein MIMGU_mgv1a026027mg                136   6e-37   
gb|ABX46137.1|  blight-associated protein P12                           137   7e-37   Citrus limon [lemon]
gb|ABX46136.1|  blight-associated protein P12                           137   8e-37   Citrus limon [lemon]
ref|XP_011025167.1|  PREDICTED: EG45-like domain containing protein     137   1e-36   
gb|ABX46169.1|  blight-associated protein P12                           136   1e-36   Citrus australasica [Australian finger-lime]
gb|ABX46138.1|  blight-associated protein P12                           136   1e-36   Citrus amblycarpa [djerook leemo]
gb|ABX46160.1|  blight-associated protein P12                           135   2e-36   Citrus cavaleriei [Ichang papeda]
ref|XP_002271870.1|  PREDICTED: EG45-like domain containing protein     137   2e-36   Vitis vinifera
emb|CBI24004.3|  unnamed protein product                                138   2e-36   
ref|XP_006450200.1|  hypothetical protein CICLE_v10010575mg             135   2e-36   
gb|ADG29118.1|  gamma-expansin natriuretic peptide                      134   7e-36   
ref|XP_008648924.1|  PREDICTED: EG45-like domain containing protein     133   3e-35   
ref|XP_010687707.1|  PREDICTED: EG45-like domain containing protein     132   1e-34   
ref|XP_002530854.1|  conserved hypothetical protein                     131   2e-34   Ricinus communis
gb|EYU42472.1|  hypothetical protein MIMGU_mgv1a016234mg                130   5e-34   
ref|XP_011070161.1|  PREDICTED: putative EG45-like domain contain...    129   1e-33   
dbj|BAD45610.1|  putative blight-associated protein p12 precursor       129   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02158.1|  hypothetical protein OsI_24247                          129   2e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_007227631.1|  hypothetical protein PRUPE_ppa022885mg             128   2e-33   
ref|XP_010108656.1|  hypothetical protein L484_017889                   129   2e-33   
ref|XP_009757659.1|  PREDICTED: putative EG45-like domain contain...    128   2e-33   
ref|XP_009625075.1|  PREDICTED: putative EG45-like domain contain...    128   2e-33   
ref|XP_002304006.1|  hypothetical protein POPTR_0003s21270g             129   2e-33   Populus trichocarpa [western balsam poplar]
gb|EYU42471.1|  hypothetical protein MIMGU_mgv1a016269mg                128   3e-33   
ref|XP_009790201.1|  PREDICTED: putative EG45-like domain contain...    127   4e-33   
ref|XP_009591860.1|  PREDICTED: putative EG45-like domain contain...    127   4e-33   
ref|XP_009625073.1|  PREDICTED: putative EG45-like domain contain...    127   4e-33   
ref|XP_009591861.1|  PREDICTED: putative EG45-like domain contain...    127   4e-33   
ref|XP_009625074.1|  PREDICTED: putative EG45-like domain contain...    127   5e-33   
ref|XP_009630751.1|  PREDICTED: putative EG45-like domain contain...    127   5e-33   
ref|NP_001148288.1|  blight-associated protein p12 precursor            127   7e-33   Zea mays [maize]
ref|XP_006343715.1|  PREDICTED: putative EG45-like domain contain...    125   2e-32   
gb|EYU42473.1|  hypothetical protein MIMGU_mgv1a025603mg                124   8e-32   
ref|XP_010525751.1|  PREDICTED: putative EG45-like domain contain...    123   2e-31   
gb|KHG03416.1|  Putative EG45-like domain containing protein 1          123   2e-31   
ref|XP_010447724.1|  PREDICTED: putative EG45-like domain contain...    122   3e-31   
ref|XP_007013995.1|  Barwin-related endoglucanase                       123   4e-31   
gb|EEC84740.1|  hypothetical protein OsI_31733                          121   5e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_006284971.1|  hypothetical protein CARUB_v10006278mg             122   6e-31   
ref|XP_010447725.1|  PREDICTED: putative EG45-like domain contain...    122   6e-31   
ref|XP_006451651.1|  hypothetical protein CICLE_v10010346mg             122   7e-31   
ref|XP_006490753.1|  PREDICTED: putative EG45-like domain contain...    121   7e-31   
gb|EYU42470.1|  hypothetical protein MIMGU_mgv1a025943mg                120   8e-31   
ref|XP_010438186.1|  PREDICTED: putative EG45-like domain contain...    121   1e-30   
ref|XP_011069852.1|  PREDICTED: EG45-like domain containing protein     120   2e-30   
dbj|BAD22249.1|  putative blight-associated protein p12 precursor       120   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010323233.1|  PREDICTED: putative EG45-like domain contain...    120   2e-30   
ref|XP_002309385.1|  Expansin-related protein 2 precursor               119   4e-30   Populus trichocarpa [western balsam poplar]
gb|EPS68012.1|  hypothetical protein M569_06763                         119   4e-30   
ref|XP_010432992.1|  PREDICTED: putative EG45-like domain contain...    119   7e-30   
gb|KHG04714.1|  Putative EG45-like domain containing protein 1          118   1e-29   
ref|XP_011009944.1|  PREDICTED: putative EG45-like domain contain...    118   1e-29   
ref|XP_009334181.1|  PREDICTED: putative EG45-like domain contain...    117   2e-29   
ref|XP_006450199.1|  hypothetical protein CICLE_v10010585mg             115   9e-29   
ref|XP_002460385.1|  hypothetical protein SORBIDRAFT_02g027360          114   1e-28   Sorghum bicolor [broomcorn]
emb|CDX68653.1|  BnaC01g08000D                                          115   1e-28   
ref|XP_011069850.1|  PREDICTED: EG45-like domain containing protein     115   3e-28   
ref|XP_006845496.1|  hypothetical protein AMTR_s00019p00151500          113   4e-28   
ref|XP_002869381.1|  hypothetical protein ARALYDRAFT_328678             114   4e-28   
ref|NP_001288929.1|  putative EG45-like domain containing protein...    114   4e-28   
ref|XP_009127860.1|  PREDICTED: putative EG45-like domain contain...    114   4e-28   
gb|KCW85998.1|  hypothetical protein EUGRSUZ_B02703                     115   5e-28   
ref|XP_006412713.1|  hypothetical protein EUTSA_v10026568mg             113   8e-28   
ref|XP_007013992.1|  Plant natriuretic peptide A                        113   1e-27   
ref|NP_194767.1|  plant natriuretic peptide                             112   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010591.1|  PREDICTED: EG45-like domain containing protein     112   4e-27   
gb|EAZ02159.1|  hypothetical protein OsI_24248                          110   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010046465.1|  PREDICTED: EG45-like domain containing protein     112   1e-26   
gb|KDO62908.1|  hypothetical protein CISIN_1g044897mg                   108   2e-26   
gb|KDP45911.1|  hypothetical protein JCGZ_15471                         108   5e-26   
ref|XP_006845497.1|  hypothetical protein AMTR_s00019p00152080          106   2e-25   
ref|XP_006343714.1|  PREDICTED: uncharacterized protein LOC102581938    109   2e-25   
ref|XP_011018086.1|  PREDICTED: EG45-like domain containing protein     107   3e-25   
ref|XP_007013994.1|  Plant natriuretic peptide A                        106   4e-25   
ref|XP_008385952.1|  PREDICTED: putative EG45-like domain contain...    106   4e-25   
ref|XP_004309960.1|  PREDICTED: putative EG45-like domain contain...    106   4e-25   
ref|XP_002309373.1|  Expansin-related protein 3 precursor               106   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010047025.1|  PREDICTED: EG45-like domain containing protein     105   1e-24   
ref|XP_010046492.1|  PREDICTED: EG45-like domain containing protein     105   1e-24   
ref|XP_002325108.2|  hypothetical protein POPTR_0018s11050g             105   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009792892.1|  PREDICTED: putative EG45-like domain contain...    102   4e-24   
gb|KDP38770.1|  hypothetical protein JCGZ_04123                         103   9e-24   
dbj|BAD09315.1|  putative blight-associated protein p12 precursor       100   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010548629.1|  PREDICTED: EG45-like domain containing prote...  99.0    4e-22   
ref|XP_006453480.1|  hypothetical protein CICLE_v10009878mg           98.6    4e-22   
ref|XP_007023861.1|  Plant natriuretic peptide A                      98.6    5e-22   
gb|EAZ45086.1|  hypothetical protein OsJ_29725                        97.4    5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175636.1|  Os08g0485800                                     98.6    5e-22   
gb|KDO62378.1|  hypothetical protein CISIN_1g032886mg                 98.2    6e-22   
ref|XP_006453478.1|  hypothetical protein CICLE_v10009872mg           97.8    8e-22   
gb|KHG03669.1|  EG45-like domain containing protein 2                 97.8    8e-22   
gb|KDO67327.1|  hypothetical protein CISIN_1g045975mg                 95.9    2e-21   
gb|KDO62377.1|  hypothetical protein CISIN_1g032956mg                 95.9    4e-21   
gb|KDP33609.1|  hypothetical protein JCGZ_07180                       94.0    2e-20   
ref|XP_010254377.1|  PREDICTED: EG45-like domain containing protein   94.0    3e-20   
ref|XP_007013846.1|  Plant natriuretic peptide A                      93.6    3e-20   
ref|XP_008219481.1|  PREDICTED: EG45-like domain containing protein   93.6    4e-20   
ref|XP_010050243.1|  PREDICTED: EG45-like domain containing protein   93.2    4e-20   
ref|XP_010050244.1|  PREDICTED: EG45-like domain containing prote...  92.0    1e-19   
ref|XP_008394066.1|  PREDICTED: EG45-like domain containing prote...  92.4    1e-19   
ref|XP_002979843.1|  hypothetical protein SELMODRAFT_153548           92.0    1e-19   
ref|XP_008350393.1|  PREDICTED: EG45-like domain containing prote...  91.7    2e-19   
ref|XP_010250071.1|  PREDICTED: EG45-like domain containing protein   92.0    2e-19   
gb|KCW78772.1|  hypothetical protein EUGRSUZ_C00206                   91.7    2e-19   
gb|ABS87382.1|  putative expansin                                     91.7    2e-19   Lactuca sativa [cultivated lettuce]
ref|XP_009348609.1|  PREDICTED: EG45-like domain containing prote...  91.7    2e-19   
ref|XP_010681100.1|  PREDICTED: EG45-like domain containing prote...  90.9    3e-19   
emb|CDP13494.1|  unnamed protein product                              90.9    4e-19   
ref|XP_008350392.1|  PREDICTED: EG45-like domain containing prote...  90.5    4e-19   
ref|XP_010648653.1|  PREDICTED: EG45-like domain containing prote...  90.5    4e-19   
ref|XP_010648654.1|  PREDICTED: EG45-like domain containing protein   90.5    4e-19   
emb|CBI21023.3|  unnamed protein product                              90.1    5e-19   
ref|XP_009626738.1|  PREDICTED: EG45-like domain containing prote...  90.9    5e-19   
ref|XP_007224872.1|  hypothetical protein PRUPE_ppa022706mg           90.1    5e-19   
ref|XP_009348610.1|  PREDICTED: EG45-like domain containing prote...  90.5    5e-19   
ref|XP_010250070.1|  PREDICTED: EG45-like domain containing protein   90.1    6e-19   
ref|XP_009114707.1|  PREDICTED: EG45-like domain containing prote...  89.7    7e-19   
ref|XP_009797602.1|  PREDICTED: EG45-like domain containing prote...  90.1    8e-19   
ref|XP_009114708.1|  PREDICTED: EG45-like domain containing prote...  89.7    8e-19   
emb|CBI21024.3|  unnamed protein product                              89.4    1e-18   
ref|XP_011026456.1|  PREDICTED: EG45-like domain containing prote...  89.0    1e-18   
ref|XP_009782997.1|  PREDICTED: putative EG45-like domain contain...  88.6    2e-18   
ref|XP_009355724.1|  PREDICTED: EG45-like domain containing protein   89.0    2e-18   
ref|XP_004245324.2|  PREDICTED: EG45-like domain containing protein   88.2    3e-18   
gb|KCW85963.1|  hypothetical protein EUGRSUZ_B02666                   86.7    3e-18   
gb|AAO85279.1|  immuno-reactant natriuretic peptide-like protein ...  87.4    3e-18   Hedera helix [English ivy]
ref|XP_006371737.1|  hypothetical protein POPTR_0018s01570g           87.8    4e-18   
ref|XP_007011890.1|  Plant natriuretic peptide A                      87.8    4e-18   
ref|XP_008792053.1|  PREDICTED: EG45-like domain containing protein   87.8    4e-18   
ref|XP_002269641.1|  PREDICTED: EG45-like domain containing protein   87.4    5e-18   Vitis vinifera
ref|NP_849979.1|  plant natriuretic peptide A                         87.4    5e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAD08935.1|  hypothetical protein                                  87.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414521.1|  PREDICTED: EG45-like domain containing prote...  87.0    7e-18   
ref|XP_010414536.1|  PREDICTED: EG45-like domain containing prote...  86.7    1e-17   
gb|AFK48209.1|  unknown                                               87.0    1e-17   
ref|XP_002979711.1|  hypothetical protein SELMODRAFT_153550           86.7    1e-17   
ref|XP_002308659.2|  hypothetical protein POPTR_0006s26840g           86.7    1e-17   Populus trichocarpa [western balsam poplar]
gb|AAM18791.1|  immuno-reactant natriuretic peptide-like protein      86.7    1e-17   Erucastrum strigosum
gb|AFK33398.1|  unknown                                               86.7    1e-17   
gb|KFK40256.1|  hypothetical protein AALP_AA3G350600                  86.7    1e-17   
ref|XP_011039706.1|  PREDICTED: EG45-like domain containing protein   86.7    1e-17   
ref|XP_006298812.1|  hypothetical protein CARUB_v10014916mg           86.7    1e-17   
ref|XP_002886189.1|  hypothetical protein ARALYDRAFT_319814           86.3    2e-17   
emb|CDP13495.1|  unnamed protein product                              87.0    2e-17   
ref|XP_008388276.1|  PREDICTED: EG45-like domain containing prote...  85.9    2e-17   
ref|XP_002979710.1|  hypothetical protein SELMODRAFT_111663           85.9    2e-17   
ref|XP_008388280.1|  PREDICTED: EG45-like domain containing prote...  85.5    2e-17   
ref|XP_008388279.1|  PREDICTED: EG45-like domain containing prote...  85.5    2e-17   
ref|XP_003603417.1|  EG45-like domain containing protein              86.3    2e-17   
ref|XP_010688162.1|  PREDICTED: EG45-like domain containing protein   85.5    2e-17   
ref|XP_009626732.1|  PREDICTED: EG45-like domain containing prote...  86.3    2e-17   
ref|XP_006450462.1|  hypothetical protein CICLE_v10009837mg           85.5    3e-17   
ref|XP_009797601.1|  PREDICTED: EG45-like domain containing prote...  85.9    3e-17   
ref|XP_006361730.1|  PREDICTED: EG45-like domain containing prote...  85.5    3e-17   
tpg|DAA61898.1|  TPA: hypothetical protein ZEAMMB73_297023            84.0    3e-17   
ref|XP_003619769.1|  EG45-like domain containing protein              85.5    3e-17   
ref|XP_006409125.1|  hypothetical protein EUTSA_v10022910mg           85.1    3e-17   
ref|XP_008792052.1|  PREDICTED: EG45-like domain containing protein   85.5    3e-17   
ref|XP_006483331.1|  PREDICTED: EG45-like domain containing prote...  85.5    3e-17   
gb|KDP34255.1|  hypothetical protein JCGZ_07826                       84.0    4e-17   
ref|XP_007137033.1|  hypothetical protein PHAVU_009G094000g           85.1    4e-17   
ref|XP_002524475.1|  conserved hypothetical protein                   85.1    5e-17   Ricinus communis
ref|XP_009626720.1|  PREDICTED: EG45-like domain containing protein   84.0    9e-17   
gb|KCW81415.1|  hypothetical protein EUGRSUZ_C02792                   83.2    1e-16   
ref|XP_010914875.1|  PREDICTED: EG45-like domain containing protein   83.6    2e-16   
ref|XP_010059598.1|  PREDICTED: EG45-like domain containing protein   83.6    2e-16   
ref|XP_010519943.1|  PREDICTED: EG45-like domain containing protein   83.2    2e-16   
gb|KDP33631.1|  hypothetical protein JCGZ_07202                       83.2    2e-16   
gb|KCW81417.1|  hypothetical protein EUGRSUZ_C02797                   82.4    2e-16   
ref|XP_008344354.1|  PREDICTED: EG45-like domain containing prote...  83.2    3e-16   
ref|XP_006854924.1|  hypothetical protein AMTR_s00052p00109070        82.4    3e-16   
ref|XP_004501316.1|  PREDICTED: EG45-like domain containing prote...  82.4    3e-16   
gb|KCW80453.1|  hypothetical protein EUGRSUZ_C01794                   82.8    4e-16   
ref|XP_006450476.1|  hypothetical protein CICLE_v10010610mg           82.0    4e-16   
ref|XP_010325216.1|  PREDICTED: uncharacterized protein LOC104648879  84.3    4e-16   
ref|XP_010048249.1|  PREDICTED: EG45-like domain containing protein   82.4    4e-16   
ref|XP_011082209.1|  PREDICTED: EG45-like domain containing protein   82.0    5e-16   
gb|KHN07086.1|  EG45-like domain containing protein 2                 82.0    5e-16   
ref|XP_006361729.1|  PREDICTED: EG45-like domain containing prote...  82.0    6e-16   
ref|XP_009782998.1|  PREDICTED: putative EG45-like domain contain...  81.6    7e-16   
ref|XP_009797600.1|  PREDICTED: EG45-like domain containing prote...  81.6    8e-16   
ref|XP_011026494.1|  PREDICTED: EG45-like domain containing prote...  81.6    8e-16   
gb|ENH89000.1|  avirulent on Ve1-like protein                         81.3    8e-16   
ref|XP_002976316.1|  hypothetical protein SELMODRAFT_38740            81.3    8e-16   
dbj|BAD45611.1|  hypothetical protein                                 80.5    8e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006483307.1|  PREDICTED: EG45-like domain containing prote...  81.6    9e-16   
ref|XP_011026493.1|  PREDICTED: EG45-like domain containing prote...  83.2    1e-15   
ref|XP_002976317.1|  hypothetical protein SELMODRAFT_38741            80.9    1e-15   
ref|XP_010914876.1|  PREDICTED: EG45-like domain containing protein   80.9    1e-15   
ref|XP_002324844.2|  hypothetical protein POPTR_0018s01330g           81.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009610346.1|  PREDICTED: EG45-like domain containing prote...  80.9    2e-15   
ref|XP_009381120.1|  PREDICTED: EG45-like domain containing protein   80.5    2e-15   
ref|XP_009797599.1|  PREDICTED: EG45-like domain containing prote...  80.5    2e-15   
gb|KDP32388.1|  hypothetical protein JCGZ_13313                       80.1    2e-15   
gb|EYU20273.1|  hypothetical protein MIMGU_mgv1a019531mg              81.3    2e-15   
ref|XP_007013332.1|  Uncharacterized protein TCM_037991               80.1    3e-15   
ref|XP_007013803.1|  Plant natriuretic peptide A                      80.1    3e-15   
ref|XP_008359801.1|  PREDICTED: EG45-like domain containing prote...  80.1    3e-15   
gb|KDP38771.1|  hypothetical protein JCGZ_04124                       80.5    3e-15   
ref|XP_008344353.1|  PREDICTED: EG45-like domain containing prote...  80.1    3e-15   
ref|XP_002988416.1|  hypothetical protein SELMODRAFT_427072           79.7    3e-15   
ref|XP_006450505.1|  hypothetical protein CICLE_v10010291mg           79.7    3e-15   
ref|XP_008445199.1|  PREDICTED: EG45-like domain containing protein   79.3    4e-15   
ref|XP_009768611.1|  PREDICTED: EG45-like domain containing protein   79.0    7e-15   
gb|AEZ51610.1|  avirulent on Ve1                                      78.6    7e-15   
ref|XP_009337746.1|  PREDICTED: EG45-like domain containing protein   78.6    8e-15   
ref|XP_002979846.1|  hypothetical protein SELMODRAFT_111579           77.8    8e-15   
ref|XP_002979844.1|  hypothetical protein SELMODRAFT_111614           77.4    9e-15   
ref|XP_009589109.1|  PREDICTED: EG45-like domain containing prote...  78.6    1e-14   
ref|XP_009388522.1|  PREDICTED: EG45-like domain containing protein   78.6    1e-14   
gb|KGN62941.1|  hypothetical protein Csa_2G381670                     77.8    1e-14   
ref|NP_001235227.1|  uncharacterized protein LOC100306194 precursor   78.2    2e-14   
ref|XP_009389492.1|  PREDICTED: EG45-like domain containing protein   77.8    2e-14   
ref|XP_011019755.1|  PREDICTED: EG45-like domain containing protein   78.2    2e-14   
ref|XP_002284999.1|  PREDICTED: EG45-like domain containing protein   77.8    2e-14   Vitis vinifera
ref|XP_002529370.1|  conserved hypothetical protein                   78.6    2e-14   Ricinus communis
ref|XP_006361536.1|  PREDICTED: EG45-like domain containing prote...  77.4    3e-14   
ref|XP_004138860.1|  PREDICTED: EG45-like domain containing prote...  77.0    3e-14   
gb|KDP23824.1|  hypothetical protein JCGZ_00113                       77.4    3e-14   
ref|XP_001766379.1|  predicted protein                                77.0    4e-14   
ref|XP_006854926.1|  hypothetical protein AMTR_s00052p00111370        76.6    5e-14   
ref|XP_004245213.1|  PREDICTED: EG45-like domain containing protein   76.6    6e-14   
ref|XP_009408972.1|  PREDICTED: EG45-like domain containing protein   77.0    6e-14   
gb|KFK21882.1|  hypothetical protein AALP_AAs48851U000100             76.3    6e-14   
ref|XP_006387309.1|  hypothetical protein POPTR_1294s00200g           76.3    7e-14   
ref|XP_003603445.1|  EG45-like domain containing protein              75.9    9e-14   
ref|XP_010046494.1|  PREDICTED: putative EG45-like domain contain...  74.7    1e-13   
ref|XP_003603443.1|  EG45-like domain containing protein              76.3    1e-13   
ref|XP_004287373.1|  PREDICTED: EG45-like domain containing prote...  75.9    1e-13   
ref|XP_010057651.1|  PREDICTED: EG45-like domain containing prote...  75.5    1e-13   
ref|XP_001767856.1|  predicted protein                                76.6    1e-13   
ref|NP_001235774.1|  uncharacterized protein LOC100306489 precursor   75.5    1e-13   
ref|XP_006837814.1|  hypothetical protein AMTR_s00104p00129530        75.1    1e-13   
ref|XP_010057653.1|  PREDICTED: EG45-like domain containing prote...  75.5    1e-13   
ref|XP_010051187.1|  PREDICTED: EG45-like domain containing protein   75.9    1e-13   
gb|KCW81418.1|  hypothetical protein EUGRSUZ_C02798                   75.1    1e-13   
ref|XP_002309602.2|  hypothetical protein POPTR_0006s26560g           75.1    1e-13   
ref|XP_010048996.1|  PREDICTED: EG45-like domain containing protein   75.1    2e-13   
ref|XP_006450463.1|  hypothetical protein CICLE_v10009837mg           75.1    2e-13   
ref|XP_010057650.1|  PREDICTED: EG45-like domain containing prote...  76.3    2e-13   
ref|XP_004291491.1|  PREDICTED: EG45-like domain containing prote...  75.1    2e-13   
emb|CDP04805.1|  unnamed protein product                              75.1    2e-13   
ref|XP_010092009.1|  hypothetical protein L484_006263                 73.6    2e-13   
ref|XP_010648598.1|  PREDICTED: EG45-like domain containing protein   74.3    3e-13   
ref|XP_006361535.1|  PREDICTED: EG45-like domain containing prote...  74.7    3e-13   
ref|XP_007154948.1|  hypothetical protein PHAVU_003G160600g           74.3    3e-13   
ref|XP_002962308.1|  hypothetical protein SELMODRAFT_38723            73.6    3e-13   
ref|XP_006581362.1|  PREDICTED: EG45-like domain containing prote...  73.9    4e-13   
ref|XP_004241810.2|  PREDICTED: EG45-like domain containing prote...  74.3    4e-13   
ref|XP_010249970.1|  PREDICTED: EG45-like domain containing protein   73.9    4e-13   
gb|EYU21943.1|  hypothetical protein MIMGU_mgv1a015893mg              73.9    4e-13   
ref|XP_010322749.1|  PREDICTED: EG45-like domain containing prote...  73.9    4e-13   
ref|XP_007204753.1|  hypothetical protein PRUPE_ppa013075mg           73.9    4e-13   
ref|XP_010047778.1|  PREDICTED: EG45-like domain containing protein   73.9    5e-13   
emb|CBI20962.3|  unnamed protein product                              73.6    5e-13   
ref|XP_010648597.1|  PREDICTED: EG45-like domain containing protein   73.6    5e-13   
ref|XP_008388282.1|  PREDICTED: EG45-like domain containing protein   73.6    5e-13   
ref|XP_008445151.1|  PREDICTED: EG45-like domain containing prote...  73.6    5e-13   
ref|XP_010648591.1|  PREDICTED: EG45-like domain containing protein   73.6    5e-13   
gb|KHG30504.1|  EG45-like domain containing protein                   73.6    5e-13   
ref|XP_010648593.1|  PREDICTED: EG45-like domain containing protein   73.6    6e-13   
ref|XP_004291492.1|  PREDICTED: EG45-like domain containing prote...  73.6    6e-13   
gb|KHG13671.1|  EG45-like domain containing protein                   73.6    6e-13   
ref|XP_010102814.1|  hypothetical protein L484_004667                 73.6    6e-13   
ref|XP_008352046.1|  PREDICTED: EG45-like domain containing protein   73.6    6e-13   
ref|XP_010051191.1|  PREDICTED: EG45-like domain containing protein   73.6    7e-13   
gb|AEZ51498.1|  avirulent on Ve1                                      72.8    9e-13   
gb|KDO62380.1|  hypothetical protein CISIN_1g041264mg                 71.6    9e-13   
ref|XP_008242711.1|  PREDICTED: EG45-like domain containing protein   72.8    1e-12   
ref|XP_006353643.1|  PREDICTED: EG45-like domain containing prote...  72.8    1e-12   
ref|XP_010057652.1|  PREDICTED: EG45-like domain containing prote...  73.2    1e-12   
ref|XP_009334785.1|  PREDICTED: EG45-like domain containing prote...  73.2    1e-12   
ref|XP_010254308.1|  PREDICTED: EG45-like domain containing protein   72.8    1e-12   
ref|XP_009334786.1|  PREDICTED: EG45-like domain containing prote...  72.4    2e-12   
ref|XP_010098978.1|  hypothetical protein L484_025638                 72.0    2e-12   
ref|XP_002960899.1|  hypothetical protein SELMODRAFT_437354           72.8    2e-12   
ref|XP_010648590.1|  PREDICTED: EG45-like domain containing protein   71.6    3e-12   
ref|XP_002282162.2|  PREDICTED: EG45-like domain containing prote...  71.6    3e-12   
emb|CBI20964.3|  unnamed protein product                              72.0    3e-12   
ref|XP_004160798.1|  PREDICTED: EG45-like domain containing prote...  71.2    3e-12   
ref|XP_002967113.1|  hypothetical protein SELMODRAFT_144759           72.4    3e-12   
gb|KGN62912.1|  hypothetical protein Csa_2G379920                     71.2    3e-12   
ref|XP_010648596.1|  PREDICTED: EG45-like domain containing prote...  71.2    4e-12   
ref|XP_008378348.1|  PREDICTED: EG45-like domain containing protein   70.9    4e-12   
ref|XP_009348195.1|  PREDICTED: EG45-like domain containing protein   70.9    5e-12   
ref|XP_008811083.1|  PREDICTED: EG45-like domain containing protein   70.9    6e-12   
emb|CBI20966.3|  unnamed protein product                              72.4    7e-12   
ref|XP_008809456.1|  PREDICTED: EG45-like domain containing protein   70.1    8e-12   
ref|XP_006387254.1|  hypothetical protein POPTR_1408s00200g           72.4    8e-12   
ref|XP_009374068.1|  PREDICTED: EG45-like domain containing protein   70.1    9e-12   
ref|XP_010051185.1|  PREDICTED: EG45-like domain containing protein   69.7    1e-11   
ref|XP_006475778.1|  PREDICTED: EG45-like domain containing prote...  70.1    1e-11   
ref|XP_007226022.1|  hypothetical protein PRUPE_ppa013081mg           70.1    1e-11   
ref|XP_006451009.1|  hypothetical protein CICLE_v10010791mg           69.7    1e-11   
ref|XP_010925142.1|  PREDICTED: EG45-like domain containing protein   69.7    1e-11   
ref|XP_011081916.1|  PREDICTED: EG45-like domain containing protein   69.7    1e-11   
gb|KDP32351.1|  hypothetical protein JCGZ_13276                       69.7    1e-11   
ref|XP_010105559.1|  hypothetical protein L484_019302                 68.6    1e-11   
ref|XP_008354384.1|  PREDICTED: EG45-like domain containing protein   69.7    1e-11   
ref|XP_002514363.1|  conserved hypothetical protein                   69.7    1e-11   
gb|AEZ51807.1|  avirulent on Ve1                                      68.9    1e-11   
ref|XP_010048999.1|  PREDICTED: EG45-like domain containing protein   68.9    2e-11   
ref|XP_003526426.1|  PREDICTED: EG45-like domain containing prote...  68.9    2e-11   
ref|XP_009388532.1|  PREDICTED: EG45-like domain containing protein   68.9    2e-11   
ref|XP_008219891.1|  PREDICTED: EG45-like domain containing protein   68.9    3e-11   
ref|XP_002309240.2|  hypothetical protein POPTR_0006s15980g           68.9    3e-11   
gb|KDO80359.1|  hypothetical protein CISIN_1g032308mg                 68.6    3e-11   
ref|XP_011013547.1|  PREDICTED: EG45-like domain containing prote...  68.2    5e-11   
emb|CDP02913.1|  unnamed protein product                              66.2    5e-11   
ref|XP_007137054.1|  hypothetical protein PHAVU_009G096000g           67.8    6e-11   
ref|XP_010039889.1|  PREDICTED: EG45-like domain containing protein   67.8    6e-11   
gb|KHN07103.1|  EG45-like domain containing protein                   67.4    8e-11   
ref|XP_008337418.1|  PREDICTED: EG45-like domain containing protein   67.0    9e-11   
ref|XP_010910803.1|  PREDICTED: EG45-like domain containing protein   66.2    2e-10   
ref|XP_010918333.1|  PREDICTED: EG45-like domain containing prote...  66.6    2e-10   
ref|XP_011013549.1|  PREDICTED: EG45-like domain containing prote...  66.6    2e-10   
ref|XP_004501297.1|  PREDICTED: LOW QUALITY PROTEIN: EG45-like do...  65.9    2e-10   
ref|XP_006412712.1|  hypothetical protein EUTSA_v10027279mg           65.1    3e-10   
ref|XP_010918407.1|  PREDICTED: EG45-like domain containing prote...  65.9    4e-10   
ref|XP_010039890.1|  PREDICTED: putative EG45-like domain contain...  65.5    4e-10   
emb|CDP02914.1|  unnamed protein product                              63.9    4e-10   
ref|XP_008796423.1|  PREDICTED: EG45-like domain containing protein   65.5    5e-10   
ref|XP_010057649.1|  PREDICTED: EG45-like domain containing protein   64.7    7e-10   
gb|AEZ51611.1|  avirulent on Ve1                                      63.9    1e-09   
ref|XP_010533187.1|  PREDICTED: EG45-like domain containing prote...  63.9    1e-09   
ref|XP_010533188.1|  PREDICTED: EG45-like domain containing prote...  63.5    1e-09   
ref|XP_010533186.1|  PREDICTED: EG45-like domain containing prote...  63.9    2e-09   
ref|XP_010670710.1|  PREDICTED: EG45-like domain containing protein   63.5    2e-09   
ref|XP_010039903.1|  PREDICTED: EG45-like domain containing prote...  63.2    3e-09   
ref|XP_010039900.1|  PREDICTED: EG45-like domain containing prote...  63.2    4e-09   
ref|XP_010025635.1|  PREDICTED: EG45-like domain containing prote...  63.2    4e-09   
ref|XP_004139328.1|  PREDICTED: EG45-like domain containing prote...  62.8    4e-09   
ref|XP_010066275.1|  PREDICTED: EG45-like domain containing prote...  62.8    4e-09   
ref|XP_008457905.1|  PREDICTED: EG45-like domain containing prote...  62.0    7e-09   
ref|XP_009610347.1|  PREDICTED: putative EG45-like domain contain...  61.6    8e-09   
gb|KDR78242.1|  hypothetical protein GALMADRAFT_209653                60.8    1e-08   
ref|XP_009589117.1|  PREDICTED: putative EG45-like domain contain...  61.2    1e-08   
gb|KGN60653.1|  hypothetical protein Csa_2G005990                     61.2    2e-08   
emb|CDY71226.1|  BnaCnng71940D                                        59.7    2e-08   
ref|XP_010025656.1|  PREDICTED: EG45-like domain containing prote...  61.6    3e-08   
emb|CEA10060.1|  putative EG45-like domain containing protein         59.3    3e-08   
ref|XP_010025623.1|  PREDICTED: uncharacterized protein LOC104415...  62.8    4e-08   
ref|XP_010025639.1|  PREDICTED: putative EG45-like domain contain...  60.1    4e-08   
ref|XP_010027383.1|  PREDICTED: EG45-like domain containing prote...  60.1    4e-08   
ref|XP_006598429.1|  PREDICTED: EG45-like domain containing prote...  60.1    4e-08   
ref|XP_010025622.1|  PREDICTED: uncharacterized protein LOC104415...  62.8    4e-08   
gb|KDO61650.1|  hypothetical protein CISIN_1g038362mg                 59.3    4e-08   
gb|KHN04674.1|  EG45-like domain containing protein 2                 59.3    5e-08   
gb|KDP20206.1|  hypothetical protein JCGZ_10651                       59.3    6e-08   
ref|XP_010039891.1|  PREDICTED: putative EG45-like domain contain...  59.3    6e-08   
ref|XP_006453476.1|  hypothetical protein CICLE_v10010417mg           58.5    7e-08   
gb|KCW74816.1|  hypothetical protein EUGRSUZ_E03548                   58.9    9e-08   
ref|XP_010025637.1|  PREDICTED: EG45-like domain containing prote...  60.1    9e-08   
ref|XP_010025634.1|  PREDICTED: uncharacterized protein LOC104415...  61.2    9e-08   
ref|XP_010103706.1|  hypothetical protein L484_001893                 57.8    1e-07   
ref|XP_010025633.1|  PREDICTED: uncharacterized protein LOC104415...  61.2    1e-07   
ref|XP_010057654.1|  PREDICTED: putative EG45-like domain contain...  58.2    1e-07   
ref|WP_009327266.1|  lipoprotein A-like protein                       60.1    1e-07   
ref|XP_010039894.1|  PREDICTED: uncharacterized protein LOC104428...  60.8    1e-07   
ref|XP_010039892.1|  PREDICTED: uncharacterized protein LOC104428...  60.8    1e-07   
ref|XP_002967305.1|  hypothetical protein SELMODRAFT_18782            57.0    1e-07   
ref|XP_010042979.1|  PREDICTED: EG45-like domain containing prote...  58.5    1e-07   
ref|XP_004337001.1|  riboflavin aldehydeforming enzyme, putative      57.8    1e-07   
ref|XP_004337680.1|  betaexpansin 1 precursor, putative               60.5    2e-07   
ref|WP_011553599.1|  hypothetical protein                             59.7    2e-07   
ref|WP_037705213.1|  lipoprotein                                      58.9    2e-07   
ref|XP_003603444.1|  EG45-like domain containing protein              56.6    2e-07   
emb|CDY63619.1|  BnaC07g48010D                                        56.6    3e-07   
gb|KDO61699.1|  hypothetical protein CISIN_1g039202mg                 55.8    5e-07   
ref|WP_013940167.1|  hypothetical protein                             58.2    6e-07   
ref|XP_002988415.1|  hypothetical protein SELMODRAFT_427070           58.5    8e-07   
ref|XP_002960415.1|  hypothetical protein SELMODRAFT_73783            55.1    8e-07   
ref|XP_006427241.1|  hypothetical protein CICLE_v10027031mg           55.1    1e-06   
ref|WP_033529125.1|  lipoprotein                                      56.2    2e-06   
emb|CDI52388.1|  uncharacterized protein BN887_05348                  57.8    3e-06   
ref|WP_033433882.1|  lipoprotein                                      55.5    3e-06   
ref|WP_037681693.1|  lipoprotein                                      55.5    4e-06   
ref|WP_015349954.1|  hypothetical protein                             55.8    4e-06   
ref|WP_002639643.1|  hypothetical protein                             55.5    6e-06   
gb|AFW86388.1|  hypothetical protein ZEAMMB73_174082                  55.1    7e-06   
ref|XP_010046391.1|  PREDICTED: EG45-like domain containing prote...  54.3    8e-06   
ref|XP_007881595.1|  hypothetical protein PFL1_05868                  56.2    9e-06   
gb|AFW86447.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...  55.1    1e-05   
ref|NP_001132023.1|  hypothetical protein precursor                   55.1    1e-05   
gb|EYU32435.1|  hypothetical protein MIMGU_mgv1a021782mg              54.7    1e-05   
ref|XP_010688094.1|  PREDICTED: EG45-like domain containing protein   53.1    1e-05   
gb|EMT16315.1|  Putative expansin-B14                                 54.3    2e-05   
gb|AFW86448.1|  hypothetical protein ZEAMMB73_163456                  54.3    2e-05   
ref|XP_006647630.1|  PREDICTED: putative expansin-B14-like            53.9    2e-05   
ref|WP_012349372.1|  rare lipoprotein A                               53.9    3e-05   
ref|WP_030351432.1|  hypothetical protein                             52.0    3e-05   
ref|XP_002454533.1|  hypothetical protein SORBIDRAFT_04g032840        53.5    3e-05   
gb|EMT25044.1|  hypothetical protein F775_42751                       53.5    4e-05   
ref|XP_010097932.1|  hypothetical protein L484_009367                 50.1    4e-05   
emb|CDM81207.1|  unnamed protein product                              53.1    4e-05   
ref|WP_035198138.1|  lipoprotein                                      52.4    4e-05   
ref|XP_008678905.1|  PREDICTED: expansin-B15-like                     53.1    5e-05   
gb|EAZ24074.1|  hypothetical protein OsJ_07809                        53.1    5e-05   
gb|EMS57928.1|  Expansin-B5                                           53.5    5e-05   
gb|EAY86959.1|  hypothetical protein OsI_08348                        53.1    5e-05   
gb|EPS68266.1|  beta expansin 1                                       52.8    6e-05   
ref|WP_010459029.1|  rare lipoprotein A                               52.8    6e-05   
ref|NP_001047637.1|  Os02g0658600                                     52.8    6e-05   
ref|XP_010227220.1|  PREDICTED: uncharacterized protein LOC100836606  53.1    6e-05   
ref|XP_002436887.1|  hypothetical protein SORBIDRAFT_10g010580        52.4    8e-05   
ref|WP_015793549.1|  Rare lipoprotein A                               52.8    8e-05   
ref|WP_030742178.1|  hypothetical protein                             50.1    8e-05   
ref|XP_004337679.1|  expansin family protein                          52.4    9e-05   
ref|WP_003999539.1|  putative Rare lipoprotein A                      52.4    9e-05   
ref|XP_007145394.1|  hypothetical protein PHAVU_007G235300g           52.4    1e-04   
dbj|BAC05513.1|  expansin 4                                           50.4    1e-04   
gb|KCW81075.1|  hypothetical protein EUGRSUZ_C02445                   49.3    1e-04   
ref|XP_010066273.1|  PREDICTED: EG45-like domain containing prote...  50.1    1e-04   
ref|XP_010041193.1|  PREDICTED: EG45-like domain containing prote...  50.1    1e-04   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg           51.6    1e-04   
ref|XP_002438262.1|  hypothetical protein SORBIDRAFT_10g010740        51.6    2e-04   
ref|XP_002446906.1|  hypothetical protein SORBIDRAFT_06g024650        51.6    2e-04   
gb|KDP34254.1|  hypothetical protein JCGZ_07825                       49.7    2e-04   
dbj|BAK03724.1|  predicted protein                                    51.6    2e-04   
ref|WP_030294700.1|  lipoprotein                                      51.6    2e-04   
gb|EEE66249.1|  hypothetical protein OsJ_22431                        52.0    2e-04   
ref|XP_008230781.1|  PREDICTED: expansin-A15                          51.2    2e-04   
ref|XP_006653655.1|  PREDICTED: expansin-B5-like                      51.2    2e-04   
ref|XP_009389774.1|  PREDICTED: expansin-B15-like                     50.1    2e-04   
gb|EMS47467.1|  Expansin-B18                                          50.8    3e-04   
ref|XP_010035950.1|  PREDICTED: EG45-like domain containing prote...  49.7    3e-04   
ref|XP_010035951.1|  PREDICTED: EG45-like domain containing prote...  49.7    4e-04   
ref|WP_037738130.1|  lipoprotein                                      50.8    4e-04   
ref|XP_003570031.2|  PREDICTED: expansin-B18-like                     50.4    4e-04   
gb|KDO45225.1|  hypothetical protein CISIN_1g041115mg                 47.8    4e-04   
gb|EYU32438.1|  hypothetical protein MIMGU_mgv1a020729mg              50.4    4e-04   
ref|XP_004337075.1|  expansin family protein                          48.1    5e-04   
ref|XP_008803823.1|  PREDICTED: expansin-B11-like                     50.1    5e-04   
gb|ACR38895.1|  expansin                                              50.1    5e-04   
ref|XP_004953359.1|  PREDICTED: expansin-B15-like                     50.1    5e-04   
gb|KDO61698.1|  hypothetical protein CISIN_1g047990mg                 47.8    5e-04   
ref|XP_002320708.1|  beta-expansin 4 precursor family protein         50.1    6e-04   
emb|CDS08752.1|  hypothetical protein LRAMOSA10113                    47.8    6e-04   
gb|EMS67855.1|  Expansin-B15                                          49.7    6e-04   
ref|XP_008443790.1|  PREDICTED: expansin-A10                          49.7    6e-04   
gb|KCW47461.1|  hypothetical protein EUGRSUZ_K01244                   48.9    6e-04   
gb|EPB82748.1|  hypothetical protein HMPREF1544_10495                 49.3    7e-04   
ref|XP_002466755.1|  hypothetical protein SORBIDRAFT_01g013550        50.1    7e-04   
ref|XP_011033870.1|  PREDICTED: putative expansin-B2                  49.7    7e-04   
ref|WP_030709164.1|  lipoprotein                                      50.1    7e-04   
ref|XP_008663530.1|  PREDICTED: expansin-B18-like                     49.7    7e-04   



>ref|XP_011018122.1| PREDICTED: EG45-like domain containing protein [Populus euphratica]
Length=130

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 93/106 (88%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+Y   YVPSACYGFQ+QG +IAAASD +YANG ACGRMYRV C GPTNAGVPQPC+
Sbjct  26   GTATYYNV-YVPSACYGFQDQGVMIAAASDALYANGAACGRMYRVTCQGPTNAGVPQPCK  84

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             G VTVKIVDRCPSPGCQATIDLSQEAF+ IAD NAGK+NIDY QV
Sbjct  85   GGSVTVKIVDRCPSPGCQATIDLSQEAFSQIADLNAGKINIDYTQV  130



>ref|XP_004152324.1| PREDICTED: EG45-like domain containing protein-like [Cucumis 
sativus]
 ref|XP_004171283.1| PREDICTED: EG45-like domain containing protein-like [Cucumis 
sativus]
 gb|KGN52957.1| hypothetical protein Csa_4G007620 [Cucumis sativus]
Length=130

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 1/105 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPSACYGF++QGT+IAAASD +Y NG ACGRMY V CTGPTN GV QPC 
Sbjct  26   GTATYYTPPYVPSACYGFEDQGTMIAAASDGLYNNGEACGRMYTVTCTGPTNLGVQQPCT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  VTVK+VDRCPSPGCQ TIDLSQEAF++IA+P+AGKVNID+ Q
Sbjct  86   GNSVTVKVVDRCPSPGCQGTIDLSQEAFSMIANPDAGKVNIDFTQ  130



>ref|XP_008454153.1| PREDICTED: EG45-like domain containing protein [Cucumis melo]
Length=131

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSACYGF+EQGT+IAAA D +Y NG ACGRMY V CTG TN GV QPC 
Sbjct  26   GTATFYTPPYVPSACYGFEEQGTMIAAAGDGLYNNGEACGRMYTVTCTGRTNLGVEQPCT  85

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTVK+VDRCPSPGCQATIDLSQEAF+IIA+P+AGKV ID+ QV
Sbjct  86   GNSVTVKVVDRCPSPGCQATIDLSQEAFSIIANPDAGKVIIDFTQV  131



>ref|XP_002324498.1| hypothetical protein POPTR_0018s10730g [Populus trichocarpa]
 gb|EEF03063.1| hypothetical protein POPTR_0018s10730g [Populus trichocarpa]
Length=130

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 92/106 (87%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+Y   YVPSACYG+Q+QG +IAAASD ++ NG ACGRMY+V C GPTNAGVPQPC+
Sbjct  26   GTATYYNV-YVPSACYGYQDQGVMIAAASDGLWDNGAACGRMYKVTCQGPTNAGVPQPCK  84

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             G VTVKIVDRCPSPGCQATIDLSQEAF+ IAD NAGK+NIDY QV
Sbjct  85   DGSVTVKIVDRCPSPGCQATIDLSQEAFSQIADLNAGKINIDYTQV  130



>emb|CDP02908.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 87/105 (83%), Gaps = 1/105 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+CYGFQ  G +IAAASD I+ N  ACGR YRV CTG TN GV QPCR
Sbjct  26   GTATFYTPPYVPSSCYGFQNNGVMIAAASDAIWGNRAACGRNYRVTCTGRTNLGVLQPCR  85

Query  437  GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G V VKIVD CP PGC+ TIDLSQEAFAIIADPNAGKVNI+Y QV
Sbjct  86   GSVVVKIVDYCP-PGCRGTIDLSQEAFAIIADPNAGKVNIEYHQV  129



>emb|CDP02909.1| unnamed protein product [Coffea canephora]
Length=128

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 1/104 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+CYGFQ+ G +IAAASD I+ N  ACGR YRV CTG TN GV QPCR
Sbjct  26   GTATYYTPPYVPSSCYGFQDNGVMIAAASDAIWDNRAACGRNYRVTCTGRTNEGVLQPCR  85

Query  437  GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G V VKIVD CP PGC+ TIDLSQEAFAIIADPNAG+VNI+Y Q
Sbjct  86   GSVVVKIVDYCP-PGCRGTIDLSQEAFAIIADPNAGRVNIEYDQ  128



>ref|XP_008223553.1| PREDICTED: EG45-like domain containing protein [Prunus mume]
Length=119

 Score =   160 bits (404),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+C G+Q  G LIAAAS PI+ N  ACGR YRV CTG TN GVPQPC+
Sbjct  14   GTATFYTPPYVPSSCNGYQNDGVLIAAASAPIFNNKAACGRSYRVTCTGATNQGVPQPCK  73

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CPSPGCQAT+DLSQEAFA IA+P+AGK+ I+Y QV
Sbjct  74   GTSVVVKIVDLCPSPGCQATLDLSQEAFATIANPDAGKITIEYNQV  119



>ref|XP_010926573.1| PREDICTED: EG45-like domain containing protein [Elaeis guineensis]
Length=130

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG++ +GT+IAAAS  IYANG ACGR Y VRCTGPTNAGVP PC+
Sbjct  26   GTATYYTE-YTPSACYGYKNKGTMIAAASRRIYANGAACGRRYSVRCTGPTNAGVPHPCK  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V V IVD CPSPGCQAT+DLSQEAFA IAD NAGK+ IDY QV
Sbjct  85   GTSVVVTIVDLCPSPGCQATLDLSQEAFAAIADLNAGKIKIDYTQV  130



>gb|EAZ09461.1| hypothetical protein OsI_31732 [Oryza sativa Indica Group]
Length=134

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PSACYGF++QGT+IAAASD  +  G ACG+ Y V CTGPTN GVPQPC 
Sbjct  30   GTATFYTPPYTPSACYGFEDQGTMIAAASDVFWNGGAACGQQYVVTCTGPTNQGVPQPCT  89

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ VTVKIVD CPS GC  TIDLSQEAFAIIA+P+AGKV IDY QV
Sbjct  90   GQSVTVKIVDHCPS-GCAGTIDLSQEAFAIIANPDAGKVFIDYQQV  134



>ref|XP_006660734.1| PREDICTED: EG45-like domain containing protein-like [Oryza brachyantha]
Length=133

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY+PSACYG QEQGT+IAAASD  +  G ACGR Y V CTG TN GVPQPC 
Sbjct  29   GTATFYTPPYIPSACYGNQEQGTMIAAASDVFWNGGAACGRRYAVTCTGATNQGVPQPCT  88

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTVKIVD CPS GCQ TIDLSQEAFAIIA+P+AGK+ IDY QV
Sbjct  89   GRSVTVKIVDYCPS-GCQGTIDLSQEAFAIIANPDAGKIKIDYRQV  133



>ref|NP_001063448.1| Os09g0472900 [Oryza sativa Japonica Group]
 dbj|BAF25362.1| Os09g0472900 [Oryza sativa Japonica Group]
 dbj|BAG88562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=134

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PSACYGF++QGT+IAAASD  +  G ACG+ Y V CTGPTN GVPQPC 
Sbjct  30   GTATFYTPPYTPSACYGFEDQGTMIAAASDVFWNGGAACGQQYVVTCTGPTNQGVPQPCT  89

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ VTVKIVD CPS GC  TIDLSQEAFAIIA+P+AGKV IDY QV
Sbjct  90   GQSVTVKIVDHCPS-GCAGTIDLSQEAFAIIANPDAGKVFIDYQQV  134



>dbj|BAD22245.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD34331.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 gb|EAZ45085.1| hypothetical protein OsJ_29724 [Oryza sativa Japonica Group]
Length=131

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PSACYGF++QGT+IAAASD  +  G ACG+ Y V CTGPTN GVPQPC 
Sbjct  27   GTATFYTPPYTPSACYGFEDQGTMIAAASDVFWNGGAACGQQYVVTCTGPTNQGVPQPCT  86

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ VTVKIVD CPS GC  TIDLSQEAFAIIA+P+AGKV IDY QV
Sbjct  87   GQSVTVKIVDHCPS-GCAGTIDLSQEAFAIIANPDAGKVFIDYQQV  131



>ref|NP_001175882.1| Os09g0472700 [Oryza sativa Japonica Group]
 dbj|BAD22243.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 gb|EAZ09460.1| hypothetical protein OsI_31730 [Oryza sativa Indica Group]
 gb|EAZ45084.1| hypothetical protein OsJ_29722 [Oryza sativa Japonica Group]
 dbj|BAH94610.1| Os09g0472700 [Oryza sativa Japonica Group]
Length=130

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PSAC+GFQEQGT+IAAASD  +  G ACG+ Y V CTG TN GVP+PC 
Sbjct  26   GTATFYTPPYTPSACFGFQEQGTMIAAASDVFWNGGAACGKRYVVTCTGATNQGVPRPCT  85

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTVKIVD CPS GCQ TIDLSQEAFAIIA+P+AGK+ IDY QV
Sbjct  86   GRSVTVKIVDHCPS-GCQGTIDLSQEAFAIIANPDAGKIKIDYRQV  130



>ref|XP_008780464.1| PREDICTED: putative EG45-like domain containing protein 1 [Phoenix 
dactylifera]
Length=130

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG +++GT+IAAASDPIY NG ACGR Y V CTGPTN GVP PC 
Sbjct  26   GTATYYTV-YTPSACYGNEDKGTMIAAASDPIYDNGAACGRQYSVTCTGPTNEGVPHPCT  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTV IVDRCPSPGCQAT+DLS++AFA IAD NAGK+NI+Y  V
Sbjct  85   GASVTVTIVDRCPSPGCQATLDLSEQAFAAIADLNAGKINIEYTLV  130



>ref|XP_008780453.1| PREDICTED: EG45-like domain containing protein [Phoenix dactylifera]
Length=130

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG Q +GT+IAAASD IY  G ACGR Y V+CTGPTN GVP PC 
Sbjct  26   GTATYYTE-YTPSACYGNQNKGTMIAAASDAIYNKGAACGRRYSVKCTGPTNQGVPHPCT  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTV IVD CPSPGCQAT+DLSQ+AFA IAD NAGK+ I+Y QV
Sbjct  85   GASVTVTIVDLCPSPGCQATLDLSQQAFAAIADQNAGKIKIEYTQV  130



>ref|XP_004302408.1| PREDICTED: EG45-like domain containing protein-like [Fragaria 
vesca subsp. vesca]
Length=133

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+CYGFQ+ G +IAAASD I+ N  ACGR YRV+CTG TN G+ QPC+
Sbjct  29   GTATFYTPPYVPSSCYGFQDNGVMIAAASDVIWGNRAACGRKYRVKCTGATNQGISQPCK  88

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CP PGC  TIDLS+EAF +IA+P+AGK+ I+Y QV
Sbjct  89   GNSVVVKIVDYCP-PGCHGTIDLSKEAFTVIANPDAGKIKIEYTQV  133



>ref|XP_010926571.1| PREDICTED: EG45-like domain containing protein [Elaeis guineensis]
Length=130

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 87/106 (82%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  YVPS+CYG++++GT+IAAASD I+ N  ACGRMY VRCTG TN GVP PC+
Sbjct  26   GTATYYTQ-YVPSSCYGYEDEGTMIAAASDAIWDNRAACGRMYSVRCTGATNEGVPHPCK  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
               V VKIVD CP PGC+ATIDLSQEAFA IAD NAGK++IDY QV
Sbjct  85   DTSVVVKIVDYCPPPGCRATIDLSQEAFAAIADLNAGKIDIDYTQV  130



>ref|XP_007223500.1| hypothetical protein PRUPE_ppa013544mg [Prunus persica]
 gb|EMJ24699.1| hypothetical protein PRUPE_ppa013544mg [Prunus persica]
Length=117

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+CYG+Q  G +IAAASD I+ N  ACG+ YRV CTG TN GVPQPC+
Sbjct  14   GTATFYTPPYVPSSCYGYQNDGVMIAAASDAIWGNRAACGKRYRVTCTGATNQGVPQPCK  73

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  V +KIVD CP PGC+ TIDLSQEAFA+IA+P+AGK+ I Y Q
Sbjct  74   GTSVVIKIVDYCP-PGCRGTIDLSQEAFAVIANPDAGKIKISYTQ  117



>ref|XP_010652416.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
Length=133

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C G+Q  G +IAAASD I+ N GACGR Y+V+C G TNAGVPQPCR
Sbjct  28   GTATYYTPPYVPSSCNGYQNDGVMIAAASDAIWDNRGACGRNYKVKCEGATNAGVPQPCR  87

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G   V VKIVD CP PGC+ TIDLSQEAFA IADP+AGK+ I + QV
Sbjct  88   GAQSVVVKIVDYCP-PGCRGTIDLSQEAFASIADPDAGKIKISFQQV  133



>ref|XP_008223552.1| PREDICTED: EG45-like domain containing protein [Prunus mume]
Length=130

 Score =   150 bits (379),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+C G+Q  G +IAAASD I+ N  ACGR YRV CTG TN GVPQPC+
Sbjct  26   GTATFYTPPYVPSSCNGYQNDGVMIAAASDAIWGNRAACGRSYRVTCTGATNQGVPQPCK  85

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CP PGC+ TIDLSQEAFA IA+P+AGK+ I Y QV
Sbjct  86   GTSVVVKIVDYCP-PGCRGTIDLSQEAFAAIANPDAGKIKISYTQV  130



>ref|XP_010649023.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
Length=133

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C GFQ+ G +IAAASD I+ N GACGR Y V+C G TNAG P PCR
Sbjct  28   GTATYYTPPYVPSSCNGFQDDGVMIAAASDAIWDNRGACGRNYEVKCEGATNAGDPHPCR  87

Query  437  GE--VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+  V VKIVD CP PGC+ TIDLSQEAFA IADP+AGK+ I + QV
Sbjct  88   GDQSVVVKIVDYCP-PGCRGTIDLSQEAFASIADPDAGKIKISFQQV  133



>emb|CBI37189.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C G+Q  G +IAAASD I+ N GACGR Y+V+C G TNAGVPQPCR
Sbjct  98   GTATYYTPPYVPSSCNGYQNDGVMIAAASDAIWDNRGACGRNYKVKCEGATNAGVPQPCR  157

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G   V VKIVD CP PGC+ TIDLSQEAFA IADP+AGK+ I + Q
Sbjct  158  GAQSVVVKIVDYCP-PGCRGTIDLSQEAFASIADPDAGKIKISFQQ  202



>ref|XP_007224320.1| hypothetical protein PRUPE_ppa020356mg [Prunus persica]
 gb|EMJ25519.1| hypothetical protein PRUPE_ppa020356mg [Prunus persica]
Length=134

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAG---VPQ  447
            GT TFYTP YVPS+C G+Q  G LIAAAS PI+ N  ACGR YRV CTG TN G   VPQ
Sbjct  27   GTVTFYTPAYVPSSCNGYQNDGVLIAAASAPIFNNKAACGRSYRVTCTGATNQGPPLVPQ  86

Query  446  PCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            PC+G  V VKIVD CPSPGCQAT+DLSQEAFA IA+P+AGK+ I+Y Q
Sbjct  87   PCKGTSVVVKIVDLCPSPGCQATLDLSQEAFATIANPDAGKITIEYNQ  134



>emb|CBI26795.3| unnamed protein product [Vitis vinifera]
Length=141

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C GFQ+ G +IAAASD I+ N GACGR Y V+C G TNAG P PCR
Sbjct  28   GTATYYTPPYVPSSCNGFQDDGVMIAAASDAIWDNRGACGRNYEVKCEGATNAGDPHPCR  87

Query  437  GE--VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+  V VKIVD CP PGC+ TIDLSQEAFA IADP+AGK+ I + Q
Sbjct  88   GDQSVVVKIVDYCP-PGCRGTIDLSQEAFASIADPDAGKIKISFQQ  132



>emb|CDP02911.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTL--IAAASDPIYANGGACGRMYRVRCTGPTNAGVPQP  444
            GTATFYTPPY P+AC G +  GTL  IAAAS+ I+ NG ACGR YRV CTG  + G+ QP
Sbjct  27   GTATFYTPPYSPNACIGVRVNGTLPLIAAASNVIWDNGAACGRNYRVTCTGTNSEGIAQP  86

Query  443  CRGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            CRG V V+I+D CP PGC+AT DLSQEAFA+IADPNAGKVNIDY
Sbjct  87   CRGSVVVQIIDYCP-PGCRATFDLSQEAFALIADPNAGKVNIDY  129



>ref|XP_006661338.1| PREDICTED: EG45-like domain containing protein-like [Oryza brachyantha]
Length=139

 Score =   145 bits (366),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PSAC GFQ++GT+IAAASD  +  G ACG+M  V C G TN GVPQPC 
Sbjct  27   GTATFYTPPYTPSACTGFQQEGTMIAAASDAFWNGGAACGKMLAVTCVGATNQGVPQPCT  86

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV*SKRRA  285
            G  VTVKIVD CP+ GC+ TIDLSQEAFA IA+P+AGK+ I+Y +    R A
Sbjct  87   GRSVTVKIVDYCPA-GCRGTIDLSQEAFAAIANPDAGKILIEYHEYVPHRHA  137



>ref|XP_011069851.1| PREDICTED: EG45-like domain containing protein [Sesamum indicum]
Length=128

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = -2

Query  689  MGIERvillslvamslvvmasaiSGTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANG  510
            M IERVI+L+LVA SL+ MASAI+GTATFYT  YVPSACYGFQ+QGT+IAAA+  +Y NG
Sbjct  1    MAIERVIILALVASSLIAMASAIAGTATFYTV-YVPSACYGFQDQGTMIAAANPALYNNG  59

Query  509  GACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNA  333
             ACGR YRVRCTG TN GV QPCR GE+TV+IVD CP  G    +DLSQEAF++IADPNA
Sbjct  60   AACGRSYRVRCTGRTNDGVLQPCRNGEITVRIVDLCPGCG-PDQLDLSQEAFSMIADPNA  118

Query  332  GKVNIDY  312
            G++ IDY
Sbjct  119  GRIRIDY  125



>ref|XP_007011622.1| Barwin-related endoglucanase [Theobroma cacao]
 gb|EOY29241.1| Barwin-related endoglucanase [Theobroma cacao]
Length=158

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPY PSACYG++EQGT+IAAASD I+ +GGACG+MY+V C   TN G P PC 
Sbjct  39   GTATYYTPPYTPSACYGYEEQGTMIAAASDEIWNDGGACGQMYQVTCVSGTNEGTPYPCW  98

Query  437  GE--VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G   V +KIVD CP+ GC+ TIDLSQEAFA IADP++G +NI Y Q
Sbjct  99   GSGTVEIKIVDHCPA-GCRGTIDLSQEAFASIADPDSGVINISYQQ  143



>ref|XP_002462560.1| hypothetical protein SORBIDRAFT_02g028190 [Sorghum bicolor]
 gb|EER99081.1| hypothetical protein SORBIDRAFT_02g028190 [Sorghum bicolor]
Length=200

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = -2

Query  614  TATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG  435
            TATFYTP Y PSACYGFQ++GT+IAAAS+  +  G ACG  Y V C G TN GVP+PC G
Sbjct  30   TATFYTPSYTPSACYGFQDKGTMIAAASEAFWNGGKACGDRYEVTCKGATNDGVPEPCTG  89

Query  434  E-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV*SKRRAY  282
              VTV+IVD CP+ GC+ TIDLSQEAFAIIADPNAGKV I+Y +     RA+
Sbjct  90   RSVTVRIVDLCPAAGCRGTIDLSQEAFAIIADPNAGKVQIEYRRTPPLPRAW  141



>ref|XP_002527539.1| ATEXPB4, putative [Ricinus communis]
 gb|EEF34848.1| ATEXPB4, putative [Ricinus communis]
Length=136

 Score =   144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPY PS+CYG   +G +IAAASD I+ N  ACGR YRV C G TN G P PC 
Sbjct  32   GTATFYTPPYTPSSCYGNSNEGVMIAAASDAIWDNRAACGRKYRVTCLGATNNGDPHPCN  91

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VKIVD CPSPGCQ TIDLSQEAFA IA+P+AGK+ I Y
Sbjct  92   GNSVAVKIVDYCPSPGCQGTIDLSQEAFASIANPDAGKIKIAY  134



>ref|XP_008384747.1| PREDICTED: EG45-like domain containing protein [Malus domestica]
Length=133

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C G+Q  G +IAAASD I+ N  ACGR Y V C G TN GVPQPC+
Sbjct  29   GTATYYTPPYVPSSCNGYQNDGVMIAAASDAIWGNRAACGRRYSVTCIGATNQGVPQPCK  88

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CP PGC+ TIDLSQEAFA IA+P+AGK+ I Y QV
Sbjct  89   GNSVVVKIVDYCP-PGCRGTIDLSQEAFAAIANPDAGKIKIRYTQV  133



>gb|KDP38161.1| hypothetical protein JCGZ_04804 [Jatropha curcas]
Length=110

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+CYG  E+G +IAAASD ++ N  ACGR YRV+C   TN G P PC 
Sbjct  5    GTATFYTPPYVPSSCYGNSEEGVMIAAASDALWDNRAACGRQYRVKCLSATNEGDPHPCN  64

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CPSP C+ TIDLS+EAFA IA+ +AGK+NI Y +V
Sbjct  65   GNSVEVKIVDYCPSPACRGTIDLSEEAFASIANTDAGKINIAYDRV  110



>ref|XP_002438913.1| hypothetical protein SORBIDRAFT_10g028070 [Sorghum bicolor]
 gb|EER90280.1| hypothetical protein SORBIDRAFT_10g028070 [Sorghum bicolor]
Length=130

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG+Q++GT+IAAASD ++ NG ACGRMY+V C G TNA  P PC+
Sbjct  27   GTATYYTV-YTPSACYGYQDEGTMIAAASDGLWDNGAACGRMYQVSCAGGTNA-TPNPCK  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTVKIVDRCPSPGCQAT+DLSQEAF  I + +AGK+ I+Y QV
Sbjct  85   GGSVTVKIVDRCPSPGCQATLDLSQEAFNTIGNLDAGKILINYNQV  130



>ref|XP_004959535.1| PREDICTED: EG45-like domain containing protein-like [Setaria 
italica]
Length=144

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYTP Y PSACYG+++QGT+IAAASD  +  G ACG  Y VRC G TN GV  PC 
Sbjct  29   GFATFYTPSYTPSACYGYEDQGTMIAAASDAFWNGGEACGHRYVVRCKGATNEGVAHPCT  88

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  VTVKIVD CP+ GC  TIDLSQEAFA+IADPNAGKV I+Y
Sbjct  89   GRSVTVKIVDLCPA-GCAGTIDLSQEAFAVIADPNAGKVQIEY  130



>gb|ABX46166.1| blight-associated protein P12, partial [Citrus trifoliata]
Length=115

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IADP+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIADPDAGKIKIEF  114



>gb|ABX46128.1| blight-associated protein P12, partial [Citrus webberi]
 gb|ABX46129.1| blight-associated protein P12, partial [Citrus webberi]
Length=115

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G+P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGIPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>ref|XP_006474112.1| PREDICTED: EG45-like domain containing protein-like [Citrus sinensis]
 sp|Q9ZP41.1|EGC_CITJA RecName: Full=EG45-like domain containing protein; AltName: Full=Blight-associated 
protein p12; AltName: Full=Plant natriuretic 
peptide; Short=PNP; Flags: Precursor [Citrus jambhiri]
 gb|AAD03398.1| blight-associated protein p12 precursor [Citrus jambhiri]
 gb|KDO62379.1| hypothetical protein CISIN_1g032897mg [Citrus sinensis]
Length=131

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  27   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  86

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++ Q
Sbjct  87   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEFNQ  130



>gb|ABX46151.1| blight-associated protein P12, partial [Citrus sinensis]
 gb|ABX46152.1| blight-associated protein P12, partial [Citrus sinensis]
Length=115

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46124.1| blight-associated protein P12, partial [Citrus medica]
 gb|ABX46144.1| blight-associated protein P12, partial [Citrus nippokoreana]
 gb|ABX46146.1| blight-associated protein P12, partial [Citrus reshni]
 gb|ABX46155.1| blight-associated protein P12, partial [Citrus maxima]
 gb|ABX46156.1| blight-associated protein P12, partial [Citrus maxima]
 gb|ABX46157.1| blight-associated protein P12, partial [Citrus maxima]
 gb|ABX46158.1| blight-associated protein P12, partial [Citrus maxima]
 gb|ABX46161.1| blight-associated protein P12, partial [Citrus hanaju]
 gb|ABX46163.1| blight-associated protein P12, partial [Citrus trifoliata]
 gb|ABX46164.1| blight-associated protein P12, partial [Citrus trifoliata]
 gb|ABX46165.1| blight-associated protein P12, partial [Citrus trifoliata]
Length=115

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46122.1| blight-associated protein P12, partial [Citrus medica]
 gb|ABX46125.1| blight-associated protein P12, partial [Citrus medica]
 gb|ABX46131.1| blight-associated protein P12, partial [Citrus aurantiifolia]
 gb|ABX46132.1| blight-associated protein P12, partial [Citrus limettioides]
Length=115

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSEIANPDAGKIKIEF  114



>gb|ABX46135.1| blight-associated protein P12, partial [Citrus unshiu]
Length=115

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>ref|XP_002271904.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
Length=151

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+YTPPY PSACYGF++ G +IAAASD  + +GGACG+MY+V C   TN G P+PC 
Sbjct  33   GTATYYTPPYTPSACYGFEDDGVMIAAASDTFWNDGGACGQMYQVTCLSGTNEGTPEPCL  92

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G V VKIVD CP   C+ TIDLSQEAF  IAD +AG +NI Y Q
Sbjct  93   GSGSVVVKIVDHCPPGSCRGTIDLSQEAFESIADTDAGVINISYQQ  138



>emb|CAN65920.1| hypothetical protein VITISV_043455 [Vitis vinifera]
Length=626

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPYVPS+C GFQ+ G +IAAASD I+ N GACGR Y V+C G TNAG P PCR
Sbjct  28   GTATYYTPPYVPSSCNGFQDDGVMIAAASDAIWDNRGACGRNYEVKCEGATNAGDPHPCR  87

Query  437  GE--VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+  V VKIVD CP PGC+ TIDLSQEAFA IAD +AGK+ I + Q+
Sbjct  88   GDQSVVVKIVDYCP-PGCRGTIDLSQEAFASIADQDAGKIKISFQQI  133



>gb|ABX46123.1| blight-associated protein P12, partial [Citrus medica]
Length=115

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGKPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSEIANPDAGKIKIEF  114



>ref|XP_006453477.1| hypothetical protein CICLE_v10010217mg [Citrus clementina]
 gb|ESR66717.1| hypothetical protein CICLE_v10010217mg [Citrus clementina]
Length=148

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  27   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  86

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++ Q
Sbjct  87   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEFNQ  130



>ref|NP_001148968.1| blight-associated protein p12 precursor [Zea mays]
 gb|ACG33670.1| blight-associated protein p12 precursor [Zea mays]
Length=132

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYTP Y PSACYG+Q+ GT+IAAASD  +  G ACG  Y V C G TN GVP PC 
Sbjct  28   GYATFYTPSYTPSACYGYQDMGTMIAAASDVFWNGGAACGDRYVVSCKGGTNEGVPHPCT  87

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  VTV+IVD CP+ GCQ TIDLSQ+AFAIIADP+AGKV I+Y ++
Sbjct  88   GRSVTVQIVDLCPA-GCQGTIDLSQDAFAIIADPDAGKVEIEYRRI  132



>emb|CBI24005.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+YTPPY PSACYGF++ G +IAAASD  + +GGACG+MY+V C   TN G P+PC 
Sbjct  33   GTATYYTPPYTPSACYGFEDDGVMIAAASDTFWNDGGACGQMYQVTCLSGTNEGTPEPCL  92

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G V VKIVD CP   C+ TIDLSQEAF  IAD +AG +NI Y Q
Sbjct  93   GSGSVVVKIVDHCPPGSCRGTIDLSQEAFESIADTDAGVINISYQQ  138



>gb|ABX46126.1| blight-associated protein P12, partial [Citrus halimii]
 gb|ABX46127.1| blight-associated protein P12, partial [Citrus halimii]
 gb|ABX46167.1| blight-associated protein P12, partial [Citrus japonica var. 
margarita]
 gb|ABX46168.1| blight-associated protein P12, partial [Citrus japonica var. 
margarita]
Length=115

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNKGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I +
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIAF  114



>gb|ABX46148.1| blight-associated protein P12, partial [Citrus aurantium]
 gb|ABX46150.1| blight-associated protein P12, partial [Citrus aurantium]
 gb|ABX46159.1| blight-associated protein P12, partial [Citrus maxima]
Length=115

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46130.1| blight-associated protein P12, partial [Citrus longispina]
 gb|ABX46133.1| blight-associated protein P12, partial [Citrus limettioides]
 gb|ABX46139.1| blight-associated protein P12, partial [Citrus reticulata]
 gb|ABX46140.1| blight-associated protein P12, partial [Citrus reticulata]
 gb|ABX46141.1| blight-associated protein P12, partial [Citrus reticulata]
 gb|ABX46142.1| blight-associated protein P12, partial [Citrus reticulata]
 gb|ABX46143.1| blight-associated protein P12, partial [Citrus reticulata]
 gb|ABX46145.1| blight-associated protein P12, partial [Citrus nippokoreana]
 gb|ABX46147.1| blight-associated protein P12, partial [Citrus aurantium]
 gb|ABX46149.1| blight-associated protein P12, partial [Citrus aurantium]
 gb|ABX46153.1| blight-associated protein P12, partial [Citrus nobilis]
 gb|ABX46154.1| blight-associated protein P12, partial [Citrus nobilis]
 gb|ABX46162.1| blight-associated protein P12, partial [Citrus hanaju]
Length=115

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46134.1| blight-associated protein P12, partial [Citrus unshiu]
Length=115

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>ref|XP_007011620.1| Barwin-related endoglucanase, putative [Theobroma cacao]
 gb|EOY29239.1| Barwin-related endoglucanase, putative [Theobroma cacao]
Length=106

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = -2

Query  599  TPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC--RGEVT  426
            TPPY+PSACYGF++QG +IAAAS+ I+ NG ACG++Y+V C   TNAG P PC  RG V 
Sbjct  8    TPPYMPSACYGFEDQGVMIAAASEAIWNNGAACGQLYQVNCLSGTNAGTPMPCQGRGVVV  67

Query  425  VKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            VKIVD CP+ GC+ TIDLSQEAFA+IADPN+G +NI Y Q
Sbjct  68   VKIVDHCPA-GCRGTIDLSQEAFALIADPNSGVINISYQQ  106



>gb|ABX46121.1| blight-associated protein P12, partial [Atalantia ceylanica]
Length=115

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G++  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYKNDGVMIAAASYAIWNNGAVCNKRFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GC+ATIDLSQEAF+ IADP+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCRATIDLSQEAFSQIADPDAGKIKIEF  114



>ref|XP_010926572.1| PREDICTED: putative EG45-like domain containing protein 1 [Elaeis 
guineensis]
Length=126

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG Q +GT+IAAASD IY+NG ACGR Y VRCTG TN GVP PC+
Sbjct  26   GTATYYTQ-YTPSACYGNQNKGTMIAAASDAIYSNGAACGRRYSVRCTGSTN-GVPHPCK  83

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  V V IVD C   GCQAT+DLS E FA IADP AGK+ IDY Q
Sbjct  84   GASVVVTIVDHC--AGCQATLDLSHEVFAAIADPIAGKIMIDYTQ  126



>gb|EYU42474.1| hypothetical protein MIMGU_mgv1a026027mg, partial [Erythranthe 
guttata]
Length=103

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPS+C GF+  G +IAAASD I+ N  ACGR YRV+CTG TN  VP PC 
Sbjct  1    GTATFYTPPYVPSSCNGFKNDGVMIAAASDAIWDNRRACGRTYRVKCTGGTNQ-VPHPCT  59

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  V V+IVD CP+ GC+ TIDLSQEAFA+IA+P+AGKVNI + Q
Sbjct  60   GRSVVVRIVDYCPA-GCRGTIDLSQEAFAVIANPDAGKVNIQFNQ  103



>gb|ABX46137.1| blight-associated protein P12, partial [Citrus limon]
Length=115

 Score =   137 bits (344),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS   + NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAXWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46136.1| blight-associated protein P12, partial [Citrus limon]
Length=115

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS   + NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAXWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSEIANPDAGKIKIEF  114



>ref|XP_011025167.1| PREDICTED: EG45-like domain containing protein [Populus euphratica]
Length=139

 Score =   137 bits (345),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTATFYTPPYVPS CYG+++QG +IAAAS+ I+ NG ACGR Y+V C   TN G+P PC 
Sbjct  33   GTATFYTPPYVPSKCYGYEDQGVMIAAASEGIFNNGEACGRYYQVTCVSGTNEGIPFPCL  92

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
              G V V I D CP   C+ TIDLS+EAFA IADPN+G +NI Y Q+
Sbjct  93   DNGSVVVMITDLCPPDSCRGTIDLSKEAFASIADPNSGVINISYQQI  139



>gb|ABX46169.1| blight-associated protein P12, partial [Citrus australasica]
 gb|ABX46170.1| blight-associated protein P12, partial [Citrus australasica]
Length=115

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V  KIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLDKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46138.1| blight-associated protein P12, partial [Citrus amblycarpa]
Length=115

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+   G +IAAAS  I+ NG  C + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYXNDGVMIAAASYAIWNNGAVCNKSFRVKCTGATNQGXPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>gb|ABX46160.1| blight-associated protein P12, partial [Citrus ichangensis]
Length=115

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYTPPYVPSAC G+Q  G +IAAAS  I+ NG    + +RV+CTG TN G P PCR
Sbjct  13   GTATFYTPPYVPSACNGYQNDGVMIAAASYAIWNNGAVXNKSFRVKCTGATNXGTPHPCR  72

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKIVD CP+ GCQATIDLSQEAF+ IA+P+AGK+ I++
Sbjct  73   GGSVLVKIVDLCPA-GCQATIDLSQEAFSQIANPDAGKIKIEF  114



>ref|XP_002271870.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
Length=171

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+YTPPY PSACYGF++ G +IAAASD  + +GGACG+MY+V C   TN G P+PC 
Sbjct  32   GTATYYTPPYTPSACYGFEDDGVMIAAASDVFWNDGGACGQMYQVTCLSGTNEGTPEPCL  91

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G   VKIVD CP   C+ TIDLSQ+AF  IAD NAG +NI Y Q
Sbjct  92   GSGSAVVKIVDHCPPGSCRGTIDLSQKAFESIADTNAGVINISYQQ  137



>emb|CBI24004.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+YTPPY PSACYGF++ G +IAAASD  + +GGACG+MY+V C   TN G P+PC 
Sbjct  32   GTATYYTPPYTPSACYGFEDDGVMIAAASDVFWNDGGACGQMYQVTCLSGTNEGTPEPCL  91

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G   VKIVD CP   C+ TIDLSQ+AF  IAD NAG +NI Y Q
Sbjct  92   GSGSAVVKIVDHCPPGSCRGTIDLSQKAFESIADTNAGVINISYQQ  137



>ref|XP_006450200.1| hypothetical protein CICLE_v10010575mg [Citrus clementina]
 gb|ESR63440.1| hypothetical protein CICLE_v10010575mg [Citrus clementina]
Length=120

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 79/104 (76%), Gaps = 2/104 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPY+PSACYGF +QG +IAAAS+ I+  GGACG+ Y+V C   TNAG P PC+
Sbjct  13   GTATYYTPPYMPSACYGFADQGVMIAAASEAIWNGGGACGQYYQVTCVSGTNAGTPYPCQ  72

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G   V VKIVD CP+  C+ TIDLSQEAFA +AD  +G +NI Y
Sbjct  73   GSSSVVVKIVDLCPAGSCRGTIDLSQEAFASVADTASGVINISY  116



>gb|ADG29118.1| gamma-expansin natriuretic peptide [Alnus glutinosa]
Length=122

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFY PPYVPS+CYG+Q  G++IAAASD I+ N  ACG  Y V C G TN GVP PCR
Sbjct  19   GTATFYKPPYVPSSCYGYQNNGSMIAAASDAIWGNRSACGTSYNVSCGGATNKGVP-PCR  77

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD CP+ GC+ TI+LSQEAF+ IA+P+AGK+ I+Y +V
Sbjct  78   GTSVVVKIVDYCPA-GCKGTINLSQEAFSAIANPDAGKILIEYTEV  122



>ref|XP_008648924.1| PREDICTED: EG45-like domain containing protein [Zea mays]
 gb|AFW75934.1| blight-associated protein p12 [Zea mays]
Length=132

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG Q++GTLIAAASD ++  G ACG MY V C G TN   P PC 
Sbjct  28   GTATYYTV-YTPSACYGNQDEGTLIAAASDALWNGGAACGTMYTVTCVGGTNE-TPNPCN  85

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
                VTVKIVDRCPSPGCQAT+DLSQ+AFAII +  AGK+ IDY Q
Sbjct  86   PGASVTVKIVDRCPSPGCQATLDLSQQAFAIIGNLGAGKIVIDYSQ  131



>ref|XP_010687707.1| PREDICTED: EG45-like domain containing protein [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = -2

Query  713  NIYISERK-MGIERvillslvamslvvmasaiSGTATFYTPPYVPSACYGFQEQGTLIAA  537
            +++IS  K   + R +++  +  S   +A AISG AT+YT  YVPS+CYGF  QGT+IAA
Sbjct  17   SLFISNMKSASLTRSMMIMAIFASFASVAIAISGQATYYTV-YVPSSCYGFDNQGTMIAA  75

Query  536  ASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRCPSPGCQAT-IDLSQE  363
            AS  I+ N  ACGR YRV C   TN GVPQPCR G VTV++VD C  PGC A  +DLSQE
Sbjct  76   ASADIFQNRAACGRSYRVTCVSGTNQGVPQPCRGGSVTVRVVDLC--PGCSANGLDLSQE  133

Query  362  AFAIIADPNAGKVNIDYVQV  303
            AF++IADPNAG++NI++  V
Sbjct  134  AFSMIADPNAGRINIEFTPV  153



>ref|XP_002530854.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31528.1| conserved hypothetical protein [Ricinus communis]
Length=139

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+YT  Y+PSACYG+++QG +IAAAS+ I+ NG ACG+MY+V C   TN G P PC 
Sbjct  33   GTATYYTT-YLPSACYGYEDQGVMIAAASEAIWNNGAACGQMYQVNCISGTNEGTPFPCW  91

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G V VKIVDRCP+  C+ TIDLSQEAFA IADPN+G ++I Y Q
Sbjct  92   ASGSVVVKIVDRCPA-SCRGTIDLSQEAFASIADPNSGVIHITYQQ  136



>gb|EYU42472.1| hypothetical protein MIMGU_mgv1a016234mg [Erythranthe guttata]
Length=129

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (78%), Gaps = 6/107 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  YVPSACYGFQ+QGTLIAAA+  +Y NG ACGR YR+RCTG TN   P PCR
Sbjct  27   GTATYYTT-YVPSACYGFQDQGTLIAAANPSLYNNGAACGRRYRIRCTGGTNQ-TPNPCR  84

Query  437  -GEVTVKIVDRCPSPGCQAT-IDLSQEAFAIIADPNAGKVNIDYVQV  303
             GEVTV+IVD C  PGC A  +DLSQ+AF+ I + +AG++ IDY QV
Sbjct  85   SGEVTVRIVDLC--PGCGANQLDLSQQAFSTIGNLDAGRIRIDYTQV  129



>ref|XP_011070161.1| PREDICTED: putative EG45-like domain containing protein 1 [Sesamum 
indicum]
Length=126

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG + QG +IAAASDP++ANG  CG+++ V CTGPTN  VP PC 
Sbjct  26   GTATFYTS-YVPSACYGSKGQGVMIAAASDPLWANGAICGKVFNVTCTGPTNP-VPHPCT  83

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  V VKIVD C  PGC  T+DLS+EAFA IA+P AG + IDY Q
Sbjct  84   GRRVVVKIVDHC--PGCGGTLDLSKEAFATIANPVAGIIKIDYRQ  126



>dbj|BAD45610.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD46066.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 gb|EAZ38083.1| hypothetical protein OsJ_22430 [Oryza sativa Japonica Group]
Length=142

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 82/119 (69%), Gaps = 15/119 (13%)
 Frame = -2

Query  617  GTATFYT-------------PPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRC  477
            GTATFYT                  SACYGFQ+QGT+IAAASD ++  G ACGRMY VRC
Sbjct  25   GTATFYTVYTRTSPNCSLILNDVFASACYGFQDQGTMIAAASDGLWDGGRACGRMYTVRC  84

Query  476  TGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
               TNA VP PC G  VTVKIVDRCPSPGC +T+DLS+EAFA I + +AG++ IDY QV
Sbjct  85   VRGTNA-VPNPCNGGTVTVKIVDRCPSPGCTSTLDLSREAFAAIGNLDAGRIVIDYNQV  142



>gb|EAZ02158.1| hypothetical protein OsI_24247 [Oryza sativa Indica Group]
Length=142

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 82/119 (69%), Gaps = 15/119 (13%)
 Frame = -2

Query  617  GTATFYT-------------PPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRC  477
            GTATFYT                  SACYGFQ+QGT+IAAASD ++  G ACGRMY VRC
Sbjct  25   GTATFYTVYTRTFPNCSLILNDVFASACYGFQDQGTMIAAASDGLWDGGRACGRMYTVRC  84

Query  476  TGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
               TNA VP PC G  VTVKIVDRCPSPGC +T+DLS+EAFA I + +AG++ IDY QV
Sbjct  85   VRGTNA-VPNPCNGGTVTVKIVDRCPSPGCTSTLDLSREAFAAIGNLDAGRIVIDYNQV  142



>ref|XP_007227631.1| hypothetical protein PRUPE_ppa022885mg [Prunus persica]
 gb|EMJ28830.1| hypothetical protein PRUPE_ppa022885mg [Prunus persica]
Length=122

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  590  YVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIV  414
            Y  S+CYG+Q  G +IAAASD I+ N  ACG+ YRV CTG TN GVPQPC+G  V VKIV
Sbjct  19   YTTSSCYGYQNDGVMIAAASDAIWGNRAACGKRYRVTCTGATNQGVPQPCKGTSVVVKIV  78

Query  413  DRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            D CP PGC+ TIDLSQEAFA+IA+P+AGK+ I Y  
Sbjct  79   DYCP-PGCRGTIDLSQEAFAVIANPDAGKIKISYTH  113



>ref|XP_010108656.1| hypothetical protein L484_017889 [Morus notabilis]
 gb|EXC19912.1| hypothetical protein L484_017889 [Morus notabilis]
Length=151

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTAT+ TPPY+PS+CYGF++QG +IAAASD IY +G ACG+MY V C   TN G P PC 
Sbjct  33   GTATYNTPPYLPSSCYGFEDQGVMIAAASDAIYNDGEACGQMYEVTCLSGTNLGTPMPCL  92

Query  440  RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G V VKI D C    C+ TIDLS EAFA IADP +G +N+ Y
Sbjct  93   EGSVVVKITDYCKPESCRGTIDLSIEAFASIADPASGVINVSY  135



>ref|XP_009757659.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
sylvestris]
Length=128

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   QGT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPQGTIIAAASDPLWNNGAICGKTFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|XP_009625075.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
tomentosiformis]
Length=126

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   QGT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPQGTIIAAASDPLWNNGAICGKFFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|XP_002304006.1| hypothetical protein POPTR_0003s21270g [Populus trichocarpa]
 gb|EEE78985.1| hypothetical protein POPTR_0003s21270g [Populus trichocarpa]
Length=147

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            GTATF TPPYVPS CYG++++G +IAAAS+ I+ NG ACG  Y+V C   TN G P PC 
Sbjct  33   GTATFNTPPYVPSKCYGYEDRGVMIAAASEGIFNNGEACGLYYQVTCVSGTNEGTPFPCL  92

Query  440  -RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              G V V I D CP   C+ TIDLSQEAFA IADPN+G +NI Y Q
Sbjct  93   DNGSVVVMITDLCPPDSCRGTIDLSQEAFASIADPNSGVINISYQQ  138



>gb|EYU42471.1| hypothetical protein MIMGU_mgv1a016269mg [Erythranthe guttata]
Length=128

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG ++ G +IAAASDP++ANGG CG+++ V CTGPTN  VP PC 
Sbjct  26   GTATFYTS-YVPSACYGNKDSGVMIAAASDPLWANGGICGKVFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ V VKIVD C  PGC  T+DLS+EAFA IA+P AG + I++ Q+
Sbjct  84   GQSVVVKIVDHC--PGCGGTLDLSREAFAAIANPVAGIIKIEFNQI  127



>ref|XP_009790201.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
sylvestris]
Length=128

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  Y+PSACYG   QGT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YIPSACYGNTPQGTIIAAASDPLWNNGAICGKTFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|XP_009591860.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=128

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   +GT+IAAASDP++ NG  CG+++ V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPEGTIIAAASDPLWNNGAICGKVFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|XP_009625073.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=128

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   +GT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPEGTIIAAASDPLWKNGAICGKFFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGIIKIDYVQ  126



>ref|XP_009591861.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=126

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   +GT+IAAASDP++ NG  CG+++ V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPEGTIIAAASDPLWNNGAICGKVFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|XP_009625074.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=126

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   +GT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGNTPEGTIIAAASDPLWKNGAICGKFFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKIVDHC--PGCGGTLDLSKEAFSTIANPVAGIIKIDYVQ  126



>ref|XP_009630751.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
tomentosiformis]
Length=128

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   QGT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC 
Sbjct  26   GTATFYTQ-YVPSACYGNTPQGTVIAAASDPLWNNGAICGKTFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VK+VD C  PGC  T+DLS+EAF+ IA+P AG + IDYVQ
Sbjct  84   GKSIVVKVVDHC--PGCGGTLDLSKEAFSTIANPVAGVIKIDYVQ  126



>ref|NP_001148288.1| blight-associated protein p12 precursor [Zea mays]
 gb|ACG30415.1| blight-associated protein p12 precursor [Zea mays]
Length=133

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 76/106 (72%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y PSACYG Q++GTLIAAASD ++  G ACG MY V C   TN   P PC 
Sbjct  29   GTATYYTV-YTPSACYGNQDEGTLIAAASDALWNGGAACGTMYTVTCVAGTNE-TPNPCN  86

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
                VTVKIVD CPSPGCQAT+DLSQ+AFA I +  AGK+ IDY Q
Sbjct  87   PGASVTVKIVDLCPSPGCQATLDLSQQAFATIGNLGAGKIVIDYSQ  132



>ref|XP_006343715.1| PREDICTED: putative EG45-like domain containing protein 1-like 
[Solanum tuberosum]
Length=124

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   QGT+IAAASDP++A+G  CG+ + V CTGPTN  VP PC 
Sbjct  24   GTATFYTN-YVPSACYGSTPQGTIIAAASDPLWADGKICGKTFNVTCTGPTNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ + VKIVD C  PGC  T+DLS+E F+ IA+P AG + IDYVQ
Sbjct  82   GKSMVVKIVDHC--PGCGGTLDLSKEVFSTIANPVAGVIKIDYVQ  124



>gb|EYU42473.1| hypothetical protein MIMGU_mgv1a025603mg [Erythranthe guttata]
Length=137

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 4/105 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  Y+PSACYG++ QGTLIAAA+  +Y NG ACGR Y+VRCTG TN G P PCR
Sbjct  31   GTATFYTE-YLPSACYGYEGQGTLIAAANPRLYNNGAACGRTYKVRCTGGTN-GTPNPCR  88

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             GEVTVKIVD CP  G    +DLS++ F+ IA+P+AG++ IDY +
Sbjct  89   NGEVTVKIVDLCPGCG-NYQLDLSKQVFSRIANPDAGRIRIDYTR  132



>ref|XP_010525751.1| PREDICTED: putative EG45-like domain containing protein 1 [Tarenaya 
hassleriana]
Length=128

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (75%), Gaps = 5/103 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y PSACYG Q +G +IAAASD ++ NG  CG+M+ V+CTGP N  VP PC 
Sbjct  27   GIATFYTT-YTPSACYGNQPEGVMIAAASDSLWDNGKICGQMFTVKCTGPRNP-VPHPCN  84

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  VTVKIVD CPS  C +T+DLS+EAFA IADP AG +NIDY
Sbjct  85   GNSVTVKIVDHCPS--CPSTLDLSREAFAAIADPVAGIINIDY  125



>gb|KHG03416.1| Putative EG45-like domain containing protein 1 [Gossypium arboreum]
Length=125

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFY   YVPSAC+G Q+QG +IAAA D ++ NG  CG+M+ V CTGP N  VP PC 
Sbjct  24   GIATFYRN-YVPSACFGSQDQGKMIAAAGDGLWNNGAVCGKMFTVTCTGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V VKIVD C  PGC +TIDLS+EAFA+IA+P AG +NIDY QV
Sbjct  82   GNSVAVKIVDHC--PGCPSTIDLSREAFALIANPVAGIINIDYNQV  125



>ref|XP_010447724.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X1 [Camelina sativa]
Length=126

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACYG +++G  IAAASD ++ NG  CG+M+RV+CTG  NA VP PC 
Sbjct  24   GIGTFYTT-YTPSACYGGKQEGVFIAAASDQLWNNGQVCGKMFRVKCTGARNA-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ V V+IVD CPS GC +TIDLS+EAFA IA+P AG +NIDY  V
Sbjct  82   GKSVIVRIVDHCPS-GCASTIDLSREAFAQIANPVAGIINIDYTPV  126



>ref|XP_007013995.1| Barwin-related endoglucanase [Theobroma cacao]
 gb|EOY31614.1| Barwin-related endoglucanase [Theobroma cacao]
Length=161

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 5/106 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y+PSAC+G Q  G +IAAA D ++ NG  CG+ + V CTG  NA VP PC 
Sbjct  60   GIATFYTS-YIPSACFGNQNNGNMIAAAGDALWNNGAVCGKTFTVTCTGARNA-VPHPCT  117

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ VTVKIVD C  PGC +T+DLS+EAF +IADP AG +NIDY Q+
Sbjct  118  GKSVTVKIVDHC--PGCPSTLDLSKEAFTLIADPVAGIINIDYKQL  161



>gb|EEC84740.1| hypothetical protein OsI_31733 [Oryza sativa Indica Group]
Length=115

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = -2

Query  581  SACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIVDRC  405
            SAC+GFQEQGT+IAAASD  +  G ACG+   V CTG TN GVPQPC G  VTVKIVD C
Sbjct  5    SACFGFQEQGTMIAAASDVFWNGGAACGKRLAVTCTGATNQGVPQPCTGRSVTVKIVDYC  64

Query  404  PSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            P+ GC+ TIDLSQEAFA IA+P+AGK+ ++Y
Sbjct  65   PA-GCRGTIDLSQEAFAAIANPDAGKILVEY  94



>ref|XP_006284971.1| hypothetical protein CARUB_v10006278mg [Capsella rubella]
 gb|EOA17869.1| hypothetical protein CARUB_v10006278mg [Capsella rubella]
Length=125

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACYG +++G +IAAASD ++ NG  CG+ +RV+CTGP N  VP PC 
Sbjct  24   GIGTFYTS-YTPSACYGGKQEGVMIAAASDTLWDNGRVCGKKFRVKCTGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYV  309
            G+ VTV IVD CPS GC +TIDLS+EAFA IA+P AG +NIDY+
Sbjct  82   GKSVTVTIVDHCPS-GCASTIDLSREAFAQIANPVAGIINIDYI  124



>ref|XP_010447725.1| PREDICTED: putative EG45-like domain containing protein 1 isoform 
X2 [Camelina sativa]
Length=125

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACYG +++G  IAAASD ++ NG  CG+M+RV+CTG  NA VP PC 
Sbjct  24   GIGTFYTT-YTPSACYGGKQEGVFIAAASDQLWNNGQVCGKMFRVKCTGARNA-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ V V+IVD CPS GC +TIDLS+EAFA IA+P AG +NIDY
Sbjct  82   GKSVIVRIVDHCPS-GCASTIDLSREAFAQIANPVAGIINIDY  123



>ref|XP_006451651.1| hypothetical protein CICLE_v10010346mg [Citrus clementina]
 gb|ESR64891.1| hypothetical protein CICLE_v10010346mg [Citrus clementina]
Length=126

 Score =   122 bits (305),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y PSAC+G   QG +IAAA D ++ NG  CG+M+ V+CTG  NA VP PC 
Sbjct  26   GIATFYTT-YTPSACFGNNGQGVMIAAAGDALWDNGAVCGKMFNVKCTGARNA-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            GE VTVKIVD C  PGC +TIDLS+EAF  IA+P AG +NIDY Q
Sbjct  84   GESVTVKIVDHC--PGCPSTIDLSREAFTQIANPVAGIINIDYHQ  126



>ref|XP_006490753.1| PREDICTED: putative EG45-like domain containing protein 1-like 
[Citrus sinensis]
Length=125

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y PSAC+G   QG +IAAA D ++ NG  CG+M+ V+CTG  NA VP PC 
Sbjct  25   GIATFYTT-YTPSACFGNNGQGVMIAAAGDALWDNGAVCGKMFNVKCTGARNA-VPHPCT  82

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            GE VTVKIVD C  PGC +TIDLS+EAF  IA+P AG +NIDY Q
Sbjct  83   GESVTVKIVDHC--PGCPSTIDLSREAFTQIANPVAGIINIDYHQ  125



>gb|EYU42470.1| hypothetical protein MIMGU_mgv1a025943mg, partial [Erythranthe 
guttata]
Length=93

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = -2

Query  581  SACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRC  405
            SAC+GFQ+QGT+IAAA+  +Y NG ACG  YRVRCTG TNAGV  PCR GE+TV+IVD C
Sbjct  1    SACFGFQDQGTMIAAANPSLYNNGAACGTSYRVRCTGRTNAGVLAPCRNGEITVRIVDLC  60

Query  404  PSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            P  G    +DLSQEAF++IADPNAG++ I+Y +V
Sbjct  61   PGCGVD-QLDLSQEAFSMIADPNAGRILIEYNRV  93



>ref|XP_010438186.1| PREDICTED: putative EG45-like domain containing protein 1 [Camelina 
sativa]
Length=126

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACYG +++G  IAAASD ++ NG  CG+M+RV+CTG  NA VP PC 
Sbjct  24   GIGTFYTT-YTPSACYGGKQEGVFIAAASDQLWNNGQVCGKMFRVKCTGARNA-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ V V+IVD CP+ GC +TIDLS+EAFA IA+P AG +NIDY  V
Sbjct  82   GKSVIVRIVDHCPN-GCASTIDLSREAFAQIANPVAGIINIDYTPV  126



>ref|XP_011069852.1| PREDICTED: EG45-like domain containing protein [Sesamum indicum]
Length=128

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = -2

Query  689  MGIERvillslvamslvvmasaiSGTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANG  510
            M I+RVI+ +L+A SL+  + AI+GTAT+Y   YVPS+CYGF+ QGT+IAAA+  ++ N 
Sbjct  1    MAIQRVIVFTLIASSLISGSYAIAGTATYYNV-YVPSSCYGFENQGTMIAAANAALFNNS  59

Query  509  GACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRCPSPGCQAT-IDLSQEAFAIIADPN  336
             ACGR YRVRCTG TN G+PQPCR GE+TVKIVD C  PGC+A  +DLS +AFA IAD +
Sbjct  60   AACGRRYRVRCTGSTNQGIPQPCRNGEITVKIVDMC--PGCEANQVDLSLQAFATIADLD  117

Query  335  AGKVNIDY  312
            AG++NID+
Sbjct  118  AGRINIDF  125



>dbj|BAD22249.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD34335.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
Length=123

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = -2

Query  581  SACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRGE-VTVKIVDRC  405
            SAC+GFQEQGT+ AAASD  +  G ACG+   V CTG TN GVPQPC G  VTVKIVD C
Sbjct  5    SACFGFQEQGTMTAAASDVFWNGGAACGKRLAVTCTGATNQGVPQPCTGRSVTVKIVDYC  64

Query  404  PSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            P+ GC+ TIDLSQEAFA IA+P+AGK+ ++Y
Sbjct  65   PA-GCRGTIDLSQEAFAAIANPDAGKILVEY  94



>ref|XP_010323233.1| PREDICTED: putative EG45-like domain containing protein 1 [Solanum 
lycopersicum]
Length=127

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 5/106 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  YVPSACYG   QG++IAAASD ++ +G  CG+++ V CTGPTN  VP PC 
Sbjct  26   GTATFYTN-YVPSACYGSTPQGSIIAAASDFLWDDGKICGKIFNVTCTGPTNP-VPHPCT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ + VKIVD C  PGC  T+DLS+E F+ IA+P AG + IDYVQ+
Sbjct  84   GKSMVVKIVDHC--PGCGGTLDLSKEVFSTIANPIAGVIKIDYVQI  127



>ref|XP_002309385.1| Expansin-related protein 2 precursor [Populus trichocarpa]
 gb|EEE92908.1| Expansin-related protein 2 precursor [Populus trichocarpa]
Length=124

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  YVPSACYG +  G +IAAA+D ++ NG ACG+++ V C GP N  VP PC 
Sbjct  24   GIATFYTN-YVPSACYGNKSFGVMIAAANDSLWNNGAACGKVFHVTCKGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ VTVK+VD C  PGC +T+DLS+EAF  IA+P AG +NIDY+Q
Sbjct  82   GKTVTVKVVDHC--PGCPSTLDLSKEAFTQIANPVAGIINIDYIQ  124



>gb|EPS68012.1| hypothetical protein M569_06763 [Genlisea aurea]
Length=127

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 4/105 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YT  Y+PSACYGF +QGT+IAAA+  +YANGGACG  Y +RCTG TN   P PCR
Sbjct  26   GTATYYTT-YLPSACYGFADQGTMIAAANPSLYANGGACGSRYTIRCTGGTNQ-TPNPCR  83

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             G+VTV IVD CP  G     DLS EAF++I +P+AG++ IDY Q
Sbjct  84   NGQVTVTIVDLCPGCG-PNQFDLSYEAFSVIGNPDAGRIQIDYTQ  127



>ref|XP_010432992.1| PREDICTED: putative EG45-like domain containing protein 1 [Camelina 
sativa]
Length=125

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 78/103 (76%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACYG +++G  IAAAS+ ++ NG  CG+M+RV+CTG  NA VP PC 
Sbjct  24   GIGTFYTT-YTPSACYGGKQEGVFIAAASNQLWDNGRVCGKMFRVKCTGARNA-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ VTV+IVD CP+ GC +TIDLS+EAFA IA+P  G +NIDY
Sbjct  82   GKSVTVRIVDHCPN-GCASTIDLSREAFAQIANPVTGIINIDY  123



>gb|KHG04714.1| Putative EG45-like domain containing protein 1 [Gossypium arboreum]
Length=125

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 5/106 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y+PSAC+  Q+ G +IAAA D ++ NG  CG+ + V+CTGP N GV  PC 
Sbjct  24   GIATFYTK-YIPSACFKNQDHGKMIAAAGDALWKNGAMCGKKFTVKCTGPRN-GVRHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G+ VTVK+VD+C  PGC +T+DLS+EAF IIA P AG +NIDY +V
Sbjct  82   GKSVTVKVVDQC--PGCPSTMDLSREAFEIIAKPVAGIINIDYKKV  125



>ref|XP_011009944.1| PREDICTED: putative EG45-like domain containing protein 1 [Populus 
euphratica]
Length=124

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  YVPSACYG +  G +IAAA+D ++ NG  CG++++V C GP N  VP PC 
Sbjct  24   GIATFYTT-YVPSACYGNKSFGVMIAAANDSLWKNGAVCGKVFQVTCKGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G+ VTVK+VD C  PGC +T+DLS+EAF  IA+P AG +NIDY+Q
Sbjct  82   GKTVTVKVVDHC--PGCPSTLDLSKEAFTQIANPVAGIINIDYIQ  124



>ref|XP_009334181.1| PREDICTED: putative EG45-like domain containing protein 1 [Pyrus 
x bretschneideri]
Length=123

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 73/103 (71%), Gaps = 5/103 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            G ATFY+  Y+PSACYG   QG LIAAA D I+ NG  CG+ Y V+CTGP N  VP PC 
Sbjct  24   GIATFYSS-YIPSACYGNAPQGILIAAAGDAIWNNGAGCGKFYNVKCTGPRNP-VPHPCT  81

Query  440  RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
               V VKIVD C  PGCQ+T+DLSQ AFA IA+P AG +NIDY
Sbjct  82   NSTVRVKIVDHC--PGCQSTLDLSQPAFAKIANPVAGIINIDY  122



>ref|XP_006450199.1| hypothetical protein CICLE_v10010585mg, partial [Citrus clementina]
 gb|ESR63439.1| hypothetical protein CICLE_v10010585mg, partial [Citrus clementina]
 gb|KDO67326.1| hypothetical protein CISIN_1g038502mg, partial [Citrus sinensis]
Length=100

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 14/104 (13%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT+YTPPY+PSACYGF +QG +IAAAS+ I+  GGACG+            G P PC+
Sbjct  8    GTATYYTPPYIPSACYGFADQGVMIAAASEAIWNGGGACGQ------------GTPNPCQ  55

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G   V VKIVD CP+  C+ TIDLSQEAFA IAD   G +NI Y
Sbjct  56   GSSSVVVKIVDLCPAGSCRGTIDLSQEAFASIADTACGVINISY  99



>ref|XP_002460385.1| hypothetical protein SORBIDRAFT_02g027360 [Sorghum bicolor]
 gb|EER96906.1| hypothetical protein SORBIDRAFT_02g027360 [Sorghum bicolor]
Length=86

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = -2

Query  557  QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQAT  381
             GT+IAAAS+  +  G ACG  Y V C G TNAGVP PC G  VTVKIVD CPSPGCQ T
Sbjct  1    MGTMIAAASEVFWNGGKACGDRYVVSCKGATNAGVPHPCTGRSVTVKIVDLCPSPGCQGT  60

Query  380  IDLSQEAFAIIADPNAGKVNIDYVQV  303
            IDLSQEAFAIIA+P+AGKV I+Y ++
Sbjct  61   IDLSQEAFAIIANPDAGKVEIEYHRI  86



>emb|CDX68653.1| BnaC01g08000D [Brassica napus]
Length=125

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y+PSACY    +G +IAAASD ++ NG  CG+M+ V CTGP N  VP PC 
Sbjct  24   GIGTFYTS-YIPSACYKDTPEGVMIAAASDTLWDNGRVCGKMFHVTCTGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ VTVKIVD CP+ GC +TIDLS EAF+ IA+P AG +NIDY
Sbjct  82   GKTVTVKIVDHCPA-GCASTIDLSFEAFSQIANPVAGIINIDY  123



>ref|XP_011069850.1| PREDICTED: EG45-like domain containing protein [Sesamum indicum]
Length=129

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 90/128 (70%), Gaps = 4/128 (3%)
 Frame = -2

Query  689  MGIERvillslvamslvvmasaiSGTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANG  510
            MG ERVI+L+++A SL+ MA A+ G ATF  P  +PSACYG Q   TL AA +  +Y NG
Sbjct  1    MGPERVIILAVIASSLISMACAVPGIATFSNPTPLPSACYGSQVPSTLFAAVNPDLYNNG  60

Query  509  GACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRCPSPGCQA-TIDLSQEAFAIIADPN  336
             ACGR YR+RCTGPTN  VPQPCR GEV V IVD C +  CQ    DLS EAF+ IADPN
Sbjct  61   TACGRRYRIRCTGPTNENVPQPCRNGEVVVTIVDLCIA--CQPDQFDLSAEAFSRIADPN  118

Query  335  AGKVNIDY  312
            A ++ I+Y
Sbjct  119  AARIRIEY  126



>ref|XP_006845496.1| hypothetical protein AMTR_s00019p00151500 [Amborella trichopoda]
 gb|ERN07171.1| hypothetical protein AMTR_s00019p00151500 [Amborella trichopoda]
Length=81

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = -2

Query  548  LIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRGE-VTVKIVDRCPSPGCQATIDL  372
            +IAAASD I+ N  ACGR YRVRCTG TN GVP+PCRG+ V V++VD CP PGC++TIDL
Sbjct  1    MIAAASDAIWDNRAACGRNYRVRCTGGTNQGVPEPCRGDSVVVRVVDYCP-PGCRSTIDL  59

Query  371  SQEAFAIIADPNAGKVNIDYVQ  306
            SQEAF+ IADPNAG +NI+Y Q
Sbjct  60   SQEAFSQIADPNAGVINIEYEQ  81



>ref|XP_002869381.1| hypothetical protein ARALYDRAFT_328678 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45640.1| hypothetical protein ARALYDRAFT_328678 [Arabidopsis lyrata subsp. 
lyrata]
Length=124

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 76/104 (73%), Gaps = 5/104 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACY    QG +IAAASD ++ NG  CG+M  V+CTGP NA VP PC 
Sbjct  24   GITTFYTS-YTPSACYR-GTQGVMIAAASDRLWNNGRVCGKMITVKCTGPRNA-VPHPCT  80

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYV  309
            G+ +TVKIVD CPS  C +T+DLS+EAFA IA+P AG +NIDY+
Sbjct  81   GKSMTVKIVDHCPS-SCASTLDLSREAFAQIANPVAGIINIDYI  123



>ref|NP_001288929.1| putative EG45-like domain containing protein 1 precursor [Brassica 
rapa]
 gb|AGM16374.1| beta-expansin-like protein 2 [Brassica rapa]
 emb|CDY28184.1| BnaA01g06650D [Brassica napus]
Length=125

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACY    +G +IAAASD ++ NG  CG+M+ V CTGP N  VP PC 
Sbjct  24   GIGTFYTT-YTPSACYKDTPEGVMIAAASDTLWDNGRVCGKMFHVTCTGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ VTVKIVD CP+ GC +TIDLS EAF+ IA+P AG +NIDY
Sbjct  82   GKTVTVKIVDHCPA-GCASTIDLSFEAFSQIANPVAGIINIDY  123



>ref|XP_009127860.1| PREDICTED: putative EG45-like domain containing protein 1 [Brassica 
rapa]
Length=126

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G  TFYT  Y PSACY    +G +IAAASD ++ NG  CG+M+ V CTGP N  VP PC 
Sbjct  24   GIGTFYTT-YTPSACYKDTPEGVMIAAASDTLWDNGRVCGKMFHVTCTGPRNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ VTVKIVD CP+ GC +TIDLS EAF+ IA+P AG +NIDY
Sbjct  82   GKTVTVKIVDHCPA-GCASTIDLSFEAFSQIANPVAGIINIDY  123



>gb|KCW85998.1| hypothetical protein EUGRSUZ_B02703 [Eucalyptus grandis]
Length=153

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFY   YVPSACYG Q QG +IAAASD  +A G ACG  YRV C G   +G+  PC 
Sbjct  29   GTATFY-QQYVPSACYGSQPQGVMIAAASDAFWAGGAACGSTYRVTCIGAAYSGIQDPCT  87

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V V+IVD CP  GC  TIDLS+EAF  IADP AG V + Y
Sbjct  88   GRSVEVRIVDHCPG-GCAGTIDLSKEAFETIADPVAGIVKVTY  129



>ref|XP_006412713.1| hypothetical protein EUTSA_v10026568mg [Eutrema salsugineum]
 gb|ESQ54166.1| hypothetical protein EUTSA_v10026568mg [Eutrema salsugineum]
Length=125

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G AT+YT  Y PSACYG  ++G +IAAASD ++ NG  CG+M+ V+CTG  N  VP PC 
Sbjct  24   GIATYYTS-YTPSACYGGTQEGVMIAAASDKLWDNGRVCGKMFTVKCTGARNP-VPHPCT  81

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ VTVKIVD CP   C +T+DLS+EAFA IA+P AG +NIDY
Sbjct  82   GKSVTVKIVDHCPG-ACPSTLDLSREAFAQIANPVAGIINIDY  123



>ref|XP_007013992.1| Plant natriuretic peptide A [Theobroma cacao]
 gb|EOY31611.1| Plant natriuretic peptide A [Theobroma cacao]
Length=130

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A F+ PPYVPSAC+G Q  G ++A  SD ++ N GACG+ YRV+C G  N   P PC+
Sbjct  26   GKAVFFAPPYVPSACFGNQNNGKMVAGVSDALWKNRGACGKRYRVKCVGGANEA-PHPCK  84

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
                V VK+VD C + GCQ  I+LSQ+AF+ IADP+AG + +++ +V
Sbjct  85   NGKSVVVKVVDYCKA-GCQGIINLSQDAFSAIADPDAGIIQVEFHEV  130



>ref|NP_194767.1| plant natriuretic peptide [Arabidopsis thaliana]
 sp|Q9M0C2.1|EGC1_ARATH RecName: Full=Putative EG45-like domain containing protein 1; 
AltName: Full=Plant natriuretic peptide B; Short=AtEXPR2; Short=AtPNP-B; 
Short=Ath-ExpGamma-1.1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB79756.1| blight-associated protein homolog [Arabidopsis thaliana]
 gb|AEE85758.1| plant natriuretic peptide [Arabidopsis thaliana]
Length=123

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 6/103 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G ATFYT  Y P  CY   ++G +IAAASD ++ NG  CG+M+ V+C+GP NA VP PC 
Sbjct  24   GIATFYTS-YTP--CYRGTQEGVMIAAASDTLWDNGRVCGKMFTVKCSGPRNA-VPHPCT  79

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G+ V VKIVD CPS GC +T+DLS+EAFA IA+P AG +NIDY
Sbjct  80   GKSVKVKIVDHCPS-GCASTLDLSREAFAQIANPVAGIINIDY  121



>ref|XP_011010591.1| PREDICTED: EG45-like domain containing protein [Populus euphratica]
Length=130

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY PS CYG +  G ++A  SD +++ G ACGR YRV C   TN   P+PCR
Sbjct  27   GNAVFYDPPYTPSKCYGNRNNGVMVAGVSDALWSGGAACGRKYRVSCIRGTNEA-PKPCR  85

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             G V V +VD C S GC   I+LS++AF+ IADPNAGKV I Y QV
Sbjct  86   QGSVVVTVVDYC-SRGCNGVINLSKDAFSRIADPNAGKVVIQYDQV  130



>gb|EAZ02159.1| hypothetical protein OsI_24248 [Oryza sativa Indica Group]
Length=111

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 4/91 (4%)
 Frame = -2

Query  572  YGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR-GEVTVKIVDRCPSP  396
            YG Q+ G +IAAASD ++A G  CG M+ VRC G TNA VP PCR G +TVKIVDRC  P
Sbjct  24   YGNQDNGRMIAAASDGLWAGGKICGTMFTVRCVGATNA-VPNPCRGGAITVKIVDRC--P  80

Query  395  GCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            GC AT+DLS+EAFA IA+P AGKV IDY Q+
Sbjct  81   GCTATLDLSREAFAAIANPVAGKVLIDYQQL  111



>ref|XP_010046465.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
Length=192

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 69/105 (66%), Gaps = 3/105 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTAT YT  YVPSACYG+   G +IAAASD ++  G ACGR   V CTG TN G P PC 
Sbjct  73   GTATCYTE-YVPSACYGYDNPGGMIAAASDELWEGGAACGRTSLVTCTGATNLGDPHPCT  131

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            G  V V IVD CPS GC+ TIDLSQEAFA IA   AGK  +  + 
Sbjct  132  GASVVVTIVDYCPS-GCRGTIDLSQEAFAAIAHLEAGKALVKLIS  175



>gb|KDO62908.1| hypothetical protein CISIN_1g044897mg, partial [Citrus sinensis]
Length=90

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = -2

Query  581  SACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRGE-VTVKIVDRC  405
            SAC+G   QG +IAAA D ++ NG  CG+M+ V+CTG  NA VP PC GE VTVKIVD C
Sbjct  1    SACFGNNGQGVMIAAAGDALWDNGAVCGKMFNVKCTGARNA-VPHPCTGESVTVKIVDHC  59

Query  404  PSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              PGC +TIDLS+EAF  IA+P AG +NIDY Q
Sbjct  60   --PGCPSTIDLSREAFTQIANPVAGIINIDYHQ  90



>gb|KDP45911.1| hypothetical protein JCGZ_15471 [Jatropha curcas]
Length=132

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = -2

Query  617  GTATFYT----PPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            G A +Y+    PPY PS CYG Q+ G ++A  SD ++ NG ACGR YRV C G  N   P
Sbjct  26   GLAVWYSRKSSPPYTPSKCYGNQDNGLMVAGVSDALWNNGAACGRRYRVSCIGGANKA-P  84

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             PC+ G V VKIVD C S GCQA I+LSQ+AF+ IAD +AG V + Y Q
Sbjct  85   HPCKGGSVVVKIVDYC-SRGCQADINLSQDAFSQIADTDAGIVRVQYDQ  132



>ref|XP_006845497.1| hypothetical protein AMTR_s00019p00152080 [Amborella trichopoda]
 gb|ERN07172.1| hypothetical protein AMTR_s00019p00152080 [Amborella trichopoda]
Length=82

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = -2

Query  548  LIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR--GEVTVKIVDRCPSPGCQATID  375
            +IAAASD I+ +  ACGR+Y+V+CTG TN GV  PCR  G VTVKIVD CP+ GC+ TID
Sbjct  1    MIAAASDEIWDSKRACGRVYKVKCTGGTNNGVEHPCRGSGSVTVKIVDYCPA-GCRGTID  59

Query  374  LSQEAFAIIADPNAGKVNIDYVQ  306
            LSQEAF  IADP+ GK+ IDY Q
Sbjct  60   LSQEAFEAIADPDEGKITIDYHQ  82



>ref|XP_006343714.1| PREDICTED: uncharacterized protein LOC102581938 [Solanum tuberosum]
Length=219

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVP-SACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC  441
            G+ +  +P   P SACYG   QGT+IAAASDP++A+G  CG+ + V CTGPTN  VP PC
Sbjct  118  GSMSQSSPKVSPTSACYGSTPQGTIIAAASDPLWADGKICGKTFNVTCTGPTNP-VPHPC  176

Query  440  RGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYV  309
             G+ + VKIV  C  PGC  T+D+S+EAF+IIA+P AG + IDYV
Sbjct  177  TGKSIVVKIVGHC--PGCGGTLDVSKEAFSIIANPMAGIIKIDYV  219



>ref|XP_011018086.1| PREDICTED: EG45-like domain containing protein [Populus euphratica]
Length=130

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY PS CYG +  G ++A  SD ++  G ACGR YRV C    N   P+PCR
Sbjct  27   GIAVFYKPPYTPSKCYGNRNNGVMVAGVSDALWNGGAACGRKYRVSCVRGANQA-PRPCR  85

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             G V V +VD C   GC   I+LSQ+AF+ IADPNAGKV + Y Q
Sbjct  86   KGSVVVTVVDFC-RKGCNGVINLSQDAFSRIADPNAGKVVVRYDQ  129



>ref|XP_007013994.1| Plant natriuretic peptide A [Theobroma cacao]
 gb|EOY31613.1| Plant natriuretic peptide A [Theobroma cacao]
Length=129

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 5/104 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY PSAC   Q+QG ++A  SD ++ NGGACG+ YRV+C G  N   P PC+
Sbjct  26   GKAVFYKPPYFPSACSN-QDQGKMVAGVSDALWNNGGACGKSYRVKCIGGANLA-PHPCK  83

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                V VK+VD C + GCQ  I+LSQ+AF+ IAD +AG + +++
Sbjct  84   EGTSVVVKVVDYCKA-GCQGIINLSQDAFSTIADTDAGIIKVEF  126



>ref|XP_008385952.1| PREDICTED: putative EG45-like domain containing protein 1 [Malus 
domestica]
Length=121

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 70/103 (68%), Gaps = 7/103 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            G ATFY+  Y+P  CYG   QG LIAAA D I+ NG  CG+ Y V+CTG  N  VP PC 
Sbjct  24   GIATFYSS-YIP--CYGNTPQGILIAAAGDAIWNNGAGCGKFYNVKCTGXRNP-VPHPCT  79

Query  440  RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
               V VKIVD C  PGCQ+T+DLSQ AFA IA+P AG +NIDY
Sbjct  80   NSTVRVKIVDHC--PGCQSTLDLSQPAFAKIANPVAGIINIDY  120



>ref|XP_004309960.1| PREDICTED: putative EG45-like domain containing protein 1-like 
[Fragaria vesca subsp. vesca]
Length=122

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 84/127 (66%), Gaps = 7/127 (6%)
 Frame = -2

Query  689  MGIERvillslvamslvvmasaiSGTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANG  510
            MG++ V+++  +   L+  + A  G ATFYT  Y P  CYG   +G +IA+A D I+ NG
Sbjct  1    MGLQNVLIILSIVACLISTSMATPGVATFYTS-YTP--CYGDTPEGVMIASAGDAIWNNG  57

Query  509  GACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNA  333
             ACG+ + V+CTGP N  VP PC G  V VKIVD C  PGC +T+DLS+EAF  IA+P A
Sbjct  58   AACGKYFTVKCTGPRNP-VPHPCTGATVKVKIVDHC--PGCPSTLDLSKEAFTKIANPVA  114

Query  332  GKVNIDY  312
            G +NIDY
Sbjct  115  GIINIDY  121



>ref|XP_002309373.1| Expansin-related protein 3 precursor [Populus trichocarpa]
 gb|EEE92896.1| Expansin-related protein 3 precursor [Populus trichocarpa]
Length=130

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY PS CYG +  G ++A  SD ++  G ACGR YRV C    N   P+PC+
Sbjct  27   GNAVFYDPPYTPSKCYGNRNDGVMVAGVSDALWNGGAACGRKYRVSCIRGANEA-PKPCK  85

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             G V V +VD C   GC   I+LS++AF+ IADPNAGKV I Y QV
Sbjct  86   QGSVVVTVVDYC-RRGCNGVINLSKDAFSRIADPNAGKVVIQYDQV  130



>ref|XP_010047025.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
 gb|KCW78770.1| hypothetical protein EUGRSUZ_C00204 [Eucalyptus grandis]
Length=129

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGF--QEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQP  444
            G A +Y P Y P+AC GF  +  G ++A  SD ++ NG ACGRM +VRCTG  N   P P
Sbjct  26   GLAVYYAPQYYPAACPGFTLKNSGVMVAGVSDALWNNGRACGRMLKVRCTGAANQ-FPNP  84

Query  443  CR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            CR G +TVK+VD C  P C   I+LSQ+AFA IA+ +AGKV +DY
Sbjct  85   CRAGVITVKVVDYCRQP-CNGVINLSQDAFAKIANLDAGKVWVDY  128



>ref|XP_010046492.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
 gb|KCW85996.1| hypothetical protein EUGRSUZ_B02700 [Eucalyptus grandis]
Length=138

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 65/103 (63%), Gaps = 3/103 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFY   YVPSACYG Q QG +IAAAS    A G ACG  YRV C G   +G+  PC 
Sbjct  29   GTATFY-QQYVPSACYGSQPQGMMIAAASHAFSAGGAACGSTYRVTCIGAAYSGIQDPCT  87

Query  437  G-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V V+IVD CP   C  TIDLS+EAF  IAD  AG V + Y
Sbjct  88   GRSVEVRIVDHCPGR-CAGTIDLSKEAFETIADSVAGIVKVTY  129



>ref|XP_002325108.2| hypothetical protein POPTR_0018s11050g [Populus trichocarpa]
 gb|EEF03673.2| hypothetical protein POPTR_0018s11050g [Populus trichocarpa]
Length=130

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 3/105 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY PS CYG +  G ++A  SD ++  G ACGR YRV C    N   P+PCR
Sbjct  27   GIAVFYKPPYTPSKCYGNRNNGVMVAGVSDALWNGGAACGRKYRVSCVRGANQA-PRPCR  85

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
             G V V +VD C   GC   I+LSQ+AF+ IADP+AGKV + Y Q
Sbjct  86   KGSVVVTVVDFC-RKGCNGVINLSQDAFSRIADPDAGKVVVRYDQ  129



>ref|XP_009792892.1| PREDICTED: putative EG45-like domain containing protein 1, partial 
[Nicotiana sylvestris]
Length=85

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = -2

Query  572  YGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRGE-VTVKIVDRCPSP  396
            YG   QGT+IAAASDP++ NG  CG+ + V CTGPTN  VP PC G+ + VKIVD C  P
Sbjct  1    YGNTPQGTIIAAASDPLWNNGAICGKTFNVTCTGPTNP-VPHPCTGKSIVVKIVDHC--P  57

Query  395  GCQATIDLSQEAFAIIADPNAGKVNIDY  312
            GC  T+DLS+EAF+ IA+P AG + IDY
Sbjct  58   GCGGTLDLSKEAFSTIANPVAGVIKIDY  85



>gb|KDP38770.1| hypothetical protein JCGZ_04123 [Jatropha curcas]
Length=137

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = -2

Query  617  GTATFY-------TPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNA  459
            G A +Y        PPY PS CYG Q  G ++A  SD ++ NG ACGR YRV C G  N 
Sbjct  28   GLAVWYKNDSKKPMPPYTPSKCYGNQNNGLIVAGVSDALWNNGAACGRRYRVTCIGGANK  87

Query  458  GVPQPC-RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              P PC RG V VKIVD C S GC   I+LSQ+AF+ IAD +AG V + Y Q
Sbjct  88   A-PHPCKRGSVVVKIVDYC-SRGCMGDINLSQDAFSRIADTDAGIVRVQYDQ  137



>dbj|BAD09315.1| putative blight-associated protein p12 precursor [Oryza sativa 
Japonica Group]
Length=165

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRC-TGPTNAGVPQPC  441
            G ATFYT  Y PSACYG +  G ++AAA+D +Y NG  CGR Y V+C       G   PC
Sbjct  28   GVATFYTQ-YTPSACYGNRNMGNMVAAANDRLYNNGAVCGRCYAVKCAGAAAGGGGGNPC  86

Query  440  RG-EVTVKIVDRCPSP-GCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G  VTVK+VD C S  GC +TIDLS+EAFA IA+ +AG + I Y
Sbjct  87   TGASVTVKMVDNCASSDGCTSTIDLSREAFAKIANLDAGVIRITY  131



>ref|XP_010548629.1| PREDICTED: EG45-like domain containing protein 2 [Tarenaya hassleriana]
Length=128

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY PSACYG +  GT +A     ++  G ACGR YRVRC GPT +  P  C 
Sbjct  25   GRAVYYNPPYTPSACYGGRNYGTHVAGVKGELWGRGSACGRRYRVRCLGPTFS-FPNACT  83

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V V +VD C  P C   ++LS +AFA IA+P AG + IDY
Sbjct  84   GRSVVVTVVDFCREP-CNGNLNLSLDAFAAIANPKAGNIRIDY  125



>ref|XP_006453480.1| hypothetical protein CICLE_v10009878mg [Citrus clementina]
 ref|XP_006474110.1| PREDICTED: EG45-like domain containing protein 2-like [Citrus 
sinensis]
 gb|ESR66720.1| hypothetical protein CICLE_v10009878mg [Citrus clementina]
Length=130

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACY  Q+ GT++   SD ++  G ACGR Y+V+C    N   P PC 
Sbjct  26   GNAVYYDPPYTKSACYQNQDHGTMVTGVSDTLWDGGRACGRKYKVQCVRGANTA-PHPCH  84

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                V V++VD C  P C   ++LS++AFA+IADP AGKV ++Y
Sbjct  85   DGASVEVEVVDYCRQP-CNGVLNLSKDAFAVIADPVAGKVQVEY  127



>ref|XP_007023861.1| Plant natriuretic peptide A [Theobroma cacao]
 gb|EOY26483.1| Plant natriuretic peptide A [Theobroma cacao]
Length=131

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA+FY PPY+P+ C G +E+    G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  26   GTASFYNPPYIPTKCDGNREEQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGPQ  81

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+   + VK+VD CP   C +T+ LS++AFA IA  +  K+NI+Y+QV
Sbjct  82   RPCKHRTIDVKVVDFCPVTPCLSTMMLSRDAFAAIAHQHGRKINIEYIQV  131



>gb|EAZ45086.1| hypothetical protein OsJ_29725 [Oryza sativa Japonica Group]
Length=100

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = -2

Query  548  LIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQATIDL  372
            + AAASD  +  G ACG+   V CTG TN GVPQPC G  VTVKIVD CP+ GC+ TIDL
Sbjct  1    MTAAASDVFWNGGAACGKRLAVTCTGATNQGVPQPCTGRSVTVKIVDYCPA-GCRGTIDL  59

Query  371  SQEAFAIIADPNAGKVNIDY  312
            SQEAFA IA+P+AGK+ ++Y
Sbjct  60   SQEAFAAIANPDAGKILVEY  79



>ref|NP_001175636.1| Os08g0485800 [Oryza sativa Japonica Group]
 dbj|BAH01305.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83771.1| hypothetical protein OsI_29665 [Oryza sativa Indica Group]
 gb|EEE68893.1| hypothetical protein OsJ_27726 [Oryza sativa Japonica Group]
 dbj|BAH94364.1| Os08g0485800 [Oryza sativa Japonica Group]
Length=137

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRC-TGPTNAGVPQPC  441
            G ATFYT  Y PSACYG +  G ++AAA+D +Y NG  CGR Y V+C       G   PC
Sbjct  28   GVATFYTQ-YTPSACYGNRNMGNMVAAANDRLYNNGAVCGRCYAVKCAGAAAGGGGGNPC  86

Query  440  RG-EVTVKIVDRCPSP-GCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G  VTVK+VD C S  GC +TIDLS+EAFA IA+ +AG + I Y
Sbjct  87   TGASVTVKMVDNCASSDGCTSTIDLSREAFAKIANLDAGVIRITY  131



>gb|KDO62378.1| hypothetical protein CISIN_1g032886mg [Citrus sinensis]
Length=131

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q+ G ++   SD ++ NG ACG+ YRVRC    N   P PC+
Sbjct  27   GNAVYYKPPYSHSACYGNQDNGPMVTGVSDALWRNGQACGKRYRVRCIRGANQA-PHPCK  85

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                V VK+VD C  P C   ++LSQ+AF  IAD +AGKV ++Y
Sbjct  86   PGNSVVVKVVDYCRQP-CNGILNLSQDAFNEIADLDAGKVIVEY  128



>ref|XP_006453478.1| hypothetical protein CICLE_v10009872mg [Citrus clementina]
 ref|XP_006474111.1| PREDICTED: EG45-like domain containing protein 2-like [Citrus 
sinensis]
 gb|ESR66718.1| hypothetical protein CICLE_v10009872mg [Citrus clementina]
Length=131

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 4/104 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q+ G ++   SD ++ NG ACG+ YRVRC    N   P PC+
Sbjct  27   GNAVYYKPPYSHSACYGNQDNGPMVTGVSDALWRNGQACGKRYRVRCIRGANQA-PHPCK  85

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                V VK+VD C  P C   ++LSQ+AF  IAD +AGKV ++Y
Sbjct  86   PGKSVVVKVVDYCRQP-CNGILNLSQDAFNEIADLDAGKVIVEY  128



>gb|KHG03669.1| EG45-like domain containing protein 2 [Gossypium arboreum]
Length=131

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 72/110 (65%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA++Y PPY+P+ C G +E+    G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  26   GTASYYNPPYIPTKCDGNREEQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGPK  81

Query  449  QPC-RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC R  + VK+VD CP   C +TI LS++AFA IA  +  K+NI+Y+Q+
Sbjct  82   RPCKRRTIDVKVVDFCPFTPCPSTIMLSRDAFAAIAHKHGRKINIEYIQI  131



>gb|KDO67327.1| hypothetical protein CISIN_1g045975mg, partial [Citrus sinensis]
Length=82

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  548  LIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG--EVTVKIVDRCPSPGCQATID  375
            +IAAAS+ I+  GGACG+ Y+V C   TNAG P PC+G   V VKIVD CP+  C+ TID
Sbjct  1    MIAAASEAIWNGGGACGQYYQVTCVSGTNAGTPYPCQGSSSVVVKIVDLCPAGSCRGTID  60

Query  374  LSQEAFAIIADPNAGKVNIDY  312
            LSQEAFA +AD  +G +NI Y
Sbjct  61   LSQEAFASVADTASGVINISY  81



>gb|KDO62377.1| hypothetical protein CISIN_1g032956mg [Citrus sinensis]
Length=130

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACY  Q+ GT++   SD ++  G ACGR Y+V+C    N   P PC 
Sbjct  26   GNAVYYDPPYTKSACYQNQDHGTMVTGVSDALWDGGRACGRRYKVQCVRGANTA-PHPCH  84

Query  437  --GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                V V++VD C  P C   ++LS++AFA+IAD  AGKV ++Y
Sbjct  85   DGASVEVEVVDYCRQP-CNGVLNLSKDAFAVIADTVAGKVQVEY  127



>gb|KDP33609.1| hypothetical protein JCGZ_07180 [Jatropha curcas]
Length=127

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y  PY+P+ CYG +E     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  23   GTATSYNAPYMPTRCYGNREDQFPAGNLFIAVSEGLWDNGAACGRRYRLRCLSGNN----  78

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ G V VK+VD CP   C +TI LS +AF+ ++  +  K+N++Y+Q
Sbjct  79   KPCKDGIVDVKVVDYCPKSPCPSTILLSNDAFSAVSRSSTAKINVEYIQ  127



>ref|XP_010254377.1| PREDICTED: EG45-like domain containing protein [Nelumbo nucifera]
Length=138

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 72/110 (65%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +    +G L AAAS+ I+ NG ACGR YR+RC     +G+ 
Sbjct  33   GTATSYDPPYLPTKCSGYDQNQFPEGGLFAAASNGIWDNGAACGRRYRIRCI----SGLK  88

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C +  C AT+ LS  AF  I++  + KVN++Y Q+
Sbjct  89   RPCKDGSIVVEVVDICRNNPCPATLVLSNTAFNCISNIPSAKVNVEYAQI  138



>ref|XP_007013846.1| Plant natriuretic peptide A [Theobroma cacao]
 gb|EOY31465.1| Plant natriuretic peptide A [Theobroma cacao]
Length=126

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+ CYG  E+    G L  A S+ ++ NG ACGR YRVRC     +G  
Sbjct  22   GTAASYDPPYIPTKCYGNSEEQFPPGNLFVAVSEGLWDNGAACGRRYRVRCL----SGNG  77

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + VK+VD CP   C A + +S  AF  I+ P  G++NI+YVQV
Sbjct  78   RPCKSGNIDVKVVDFCPKSPCPAAMVMSNTAFNAISRP-GGRINIEYVQV  126



>ref|XP_008219481.1| PREDICTED: EG45-like domain containing protein [Prunus mume]
Length=131

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G Q+     G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  25   GTATSYRPPYIPTGCFGNQQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGHK  80

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G   V VK+VD C    C +TI +S +AFA I+   + K+N++Y+Q+
Sbjct  81   KPCKGGATVDVKVVDLCRRSPCPSTIAMSTDAFAAISRSPSTKINVEYIQI  131



>ref|XP_010050243.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
 gb|KCW78771.1| hypothetical protein EUGRSUZ_C00205 [Eucalyptus grandis]
Length=125

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +++  Y P+AC GF   G++     D ++ NG ACG+M  V+CTG  N G P+PC+
Sbjct  26   GLAYWHSLSYYPAACAGFDNSGSMTTGVGDELWDNGRACGQMLTVKCTGSAN-GFPKPCK  84

Query  437  -GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
             G VTVK+VD C  P     ++LS +AF+ IA+P+AG V +DY
Sbjct  85   DGVVTVKVVDYCQQP---CDVNLSWDAFSSIANPDAGSVRVDY  124



>ref|XP_010050244.1| PREDICTED: EG45-like domain containing protein 2 [Eucalyptus 
grandis]
Length=135

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQ--EQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQP  444
            G A +++ PY P+AC GF     G++I      ++ NG ACGRM RVRCT   N G P+P
Sbjct  34   GLADYHSLPYYPAACAGFNFSNSGSMITGVGAELWDNGRACGRMLRVRCTCSAN-GFPKP  92

Query  443  CR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            C+ G +TVK+VD C  P     I+LS++AF+ IA+ +AGKV +DY
Sbjct  93   CKDGVITVKVVDYCQQP---CDINLSEDAFSCIANIDAGKVWVDY  134



>ref|XP_008394066.1| PREDICTED: EG45-like domain containing protein 2 [Malus domestica]
Length=141

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  35   GTATSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCLSGRN----  90

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ+
Sbjct  91   KPCKGGATVDVKVVDLCKKSPCPSTVAMSTDAFAAISHSPSTRINVEYVQI  141



>ref|XP_002979843.1| hypothetical protein SELMODRAFT_153548 [Selaginella moellendorffii]
 ref|XP_002988414.1| hypothetical protein SELMODRAFT_229367 [Selaginella moellendorffii]
 gb|EFJ10504.1| hypothetical protein SELMODRAFT_229367 [Selaginella moellendorffii]
 gb|EFJ19245.1| hypothetical protein SELMODRAFT_153548 [Selaginella moellendorffii]
Length=130

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 63/104 (61%), Gaps = 13/104 (13%)
 Frame = -2

Query  611  ATFYTPPYVPSACYGFQE--QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            ATFYTPPY PSAC+GF       L AAAS  +Y NG ACG  + VRCTG         CR
Sbjct  33   ATFYTPPYQPSACFGFNPLPADFLFAAASPAVYNNGAACGTFFCVRCTG-------NGCR  85

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                + V+IVD CP  GC    DLSQEAFA IADP  G ++++Y
Sbjct  86   NGDTIRVQIVDLCP--GCPGAFDLSQEAFARIADPAVGVISVNY  127



>ref|XP_008350393.1| PREDICTED: EG45-like domain containing protein isoform X2 [Malus 
domestica]
Length=126

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 70/111 (63%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  20   GTATSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGRN  75

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ+
Sbjct  76   KPCKGGATVDVKVVDLCRDSTCPSTVVMSTDAFAAISHSPSTRINVEYVQI  126



>ref|XP_010250071.1| PREDICTED: EG45-like domain containing protein [Nelumbo nucifera]
Length=140

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +    +G L  AAS+ I+ NG ACGR YR+RC     +G+ 
Sbjct  35   GTATSYDPPYLPTKCSGYDQNQFPEGGLFVAASNGIWDNGAACGRRYRIRCI----SGLR  90

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C S  C AT+ LS  AF  I+     K+N++Y Q+
Sbjct  91   RPCKDGSIVVQVVDVCRSNPCPATLVLSNTAFGAISRIPTAKINVEYAQI  140



>gb|KCW78772.1| hypothetical protein EUGRSUZ_C00206 [Eucalyptus grandis]
Length=127

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQ--EQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQP  444
            G A +++ PY P+AC GF     G++I      ++ NG ACGRM RVRCT   N G P+P
Sbjct  26   GLADYHSLPYYPAACAGFNFSNSGSMITGVGAELWDNGRACGRMLRVRCTCSAN-GFPKP  84

Query  443  CR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            C+ G +TVK+VD C  P     I+LS++AF+ IA+ +AGKV +DY
Sbjct  85   CKDGVITVKVVDYCQQP---CDINLSEDAFSCIANIDAGKVWVDY  126



>gb|ABS87382.1| putative expansin [Lactuca sativa]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 5/106 (5%)
 Frame = -2

Query  611  ATFYTPPYVPSACYGFQEQGTLIAAASDPIYANG-GACGRMYRVRCTGPTNAGVPQPCRG  435
            A  Y+PPYVPS C+G Q+QGT+IA A   + ANG  +CGR +RVRC   TN  +   C G
Sbjct  28   AIVYSPPYVPSLCFGMQDQGTMIAKAHSGLIANGIASCGRRFRVRCLSGTNKAIRDACTG  87

Query  434  -EVTVKIVDRCPSPGCQAT-IDLSQEAFAIIADPNAGKVNIDYVQV  303
              V V +V  C   GC    + LS+E+F  IA    G+VNI+Y Q+
Sbjct  88   NSVDVTVVGTC--SGCAVNELQLSEESFGKIARLALGRVNIEYEQI  131



>ref|XP_009348609.1| PREDICTED: EG45-like domain containing protein isoform X1 [Pyrus 
x bretschneideri]
Length=141

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  35   GTATSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCLSGRN----  90

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ+
Sbjct  91   KPCKGGATVDVKVVDLCNKSPCPSTVAMSTDAFAAISHSPSTRINVEYVQI  141



>ref|XP_010681100.1| PREDICTED: EG45-like domain containing protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=127

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 63/104 (61%), Gaps = 6/104 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A ++T    PSACYG Q++G+ I   S  ++ N GACGR Y+V C G  N   P PC+
Sbjct  25   GLAVYHTHN-TPSACYGNQDKGSYITGVSKDLWNNRGACGRFYKVTCIGGAN-NAPHPCK  82

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                VTV++ D C S  C   ++LSQEAF +IAD  AGKV + Y
Sbjct  83   SSQSVTVRVTDLCDS--CAGDLNLSQEAFNVIADTRAGKVRVRY  124



>emb|CDP13494.1| unnamed protein product [Coffea canephora]
Length=133

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 11/112 (10%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y+PPY+P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYSPPYIPTRCNGNRPDQFPAGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCRG---EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+     + V++VD CP   C +TI LS +AFA IA     K+NI+Y+QV
Sbjct  82   KPCKNVGTTIDVRVVDFCPRRPCPSTILLSTDAFAAIAHSPHAKINIEYIQV  133



>ref|XP_008350392.1| PREDICTED: EG45-like domain containing protein isoform X1 [Malus 
domestica]
Length=130

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  25   GTATSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCLSGRN----  80

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ
Sbjct  81   KPCKGGATVDVKVVDLCRDSTCPSTVVMSTDAFAAISHSPSTRINVEYVQ  130



>ref|XP_010648653.1| PREDICTED: EG45-like domain containing protein 2 [Vitis vinifera]
Length=129

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ CYG ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  24   GTATSYKPPYTPTRCYGSRQDQFPPGNLFIAVSEGLWDNGAACGRRYRLRCLSGNN----  79

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + VK+VD C    C +TI +S +AF+ ++     K+NI+Y+Q+
Sbjct  80   RPCKDGTIDVKVVDYCTKSPCPSTILMSNDAFSALSRSPDAKINIEYIQI  129



>ref|XP_010648654.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
Length=130

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 70/110 (64%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +    +G L  +ASD ++ NG ACGR YR+RC     +G+ 
Sbjct  25   GTATSYDPPYLPTKCKGYDQNQFPEGGLFVSASDGLWDNGAACGRRYRLRCI----SGLR  80

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C AT+ LS +AF  I+   + K+NI+Y Q+
Sbjct  81   RPCKEGSIVVQVVDFCQHRPCPATMVLSNKAFDAISRIPSAKINIEYAQI  130



>emb|CBI21023.3| unnamed protein product [Vitis vinifera]
Length=125

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ CYG ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  20   GTATSYKPPYTPTRCYGSRQDQFPPGNLFIAVSEGLWDNGAACGRRYRLRCLSGNN----  75

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + VK+VD C    C +TI +S +AF+ ++     K+NI+Y+Q+
Sbjct  76   RPCKDGTIDVKVVDYCTKSPCPSTILMSNDAFSALSRSPDAKINIEYIQI  125



>ref|XP_009626738.1| PREDICTED: EG45-like domain containing protein isoform X2 [Nicotiana 
tomentosiformis]
Length=145

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  40   GTATSYNPPYTPTKCGGNRADQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  95

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +TI LS +AFA I+     K+NI+YVQ+
Sbjct  96   RPCKEGTIDVRVVDHCTKRPCPSTIVLSSDAFAEISHSQNAKINIEYVQI  145



>ref|XP_007224872.1| hypothetical protein PRUPE_ppa022706mg, partial [Prunus persica]
 gb|EMJ26071.1| hypothetical protein PRUPE_ppa022706mg, partial [Prunus persica]
Length=124

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 10/109 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G Q+     G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  20   GTATSYRPPYIPTGCFGNQQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGHK  75

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYV  309
            +PC+G   V VK+VD C    C +TI +S +AFA I+   + K+N++Y+
Sbjct  76   KPCKGGATVDVKVVDLCRRSPCPSTIAMSTDAFAAISRSPSTKINVEYI  124



>ref|XP_009348610.1| PREDICTED: EG45-like domain containing protein isoform X2 [Pyrus 
x bretschneideri]
Length=140

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  35   GTATSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCLSGRN----  90

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ
Sbjct  91   KPCKGGATVDVKVVDLCNKSPCPSTVAMSTDAFAAISHSPSTRINVEYVQ  140



>ref|XP_010250070.1| PREDICTED: EG45-like domain containing protein [Nelumbo nucifera]
Length=129

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 70/109 (64%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA+ Y PPY+P+ C G+ +    +G L AAAS+ ++ NG ACGR YR+RC     +G+ 
Sbjct  25   GTASSYEPPYLPTRCNGYDQNQFPEGGLFAAASNGVWDNGAACGRRYRIRCI----SGLK  80

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ G + V++VD C S  C+ T+ LS+ AF  I+     K+N++Y Q
Sbjct  81   RPCKDGSIVVQVVDVCRSNPCRTTLVLSRRAFDAISRIPNAKINVEYAQ  129



>ref|XP_009114707.1| PREDICTED: EG45-like domain containing protein 2 isoform X1 [Brassica 
rapa]
Length=130

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY  SACYG Q + T++    + ++    ACGR YRVRC GPT    P+ C 
Sbjct  28   GRAVFYDPPYTKSACYGNQYE-TMVTGVRNNLWQGSRACGRRYRVRCIGPT-YNFPRACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG V ++Y
Sbjct  86   GRSVIVKVVDLCREP-CNGDLNLSRDAFRVIANTDAGNVRVEY  127



>ref|XP_009797602.1| PREDICTED: EG45-like domain containing protein isoform X2 [Nicotiana 
sylvestris]
Length=144

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  39   GTATSYNPPYTPTKCGGNRADQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  94

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + VK+VD C    C +TI LS +AFA ++     K+NI+YVQ+
Sbjct  95   RPCKEGTIDVKVVDYCTKRPCPSTIVLSSDAFAQVSHSQNAKINIEYVQI  144



>ref|XP_009114708.1| PREDICTED: EG45-like domain containing protein 2 isoform X2 [Brassica 
rapa]
 emb|CDY43908.1| BnaA07g01850D [Brassica napus]
Length=129

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A FY PPY  SACYG Q + T++    + ++    ACGR YRVRC GPT    P+ C 
Sbjct  28   GRAVFYDPPYTKSACYGNQYE-TMVTGVRNNLWQGSRACGRRYRVRCIGPT-YNFPRACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG V ++Y
Sbjct  86   GRSVIVKVVDLCREP-CNGDLNLSRDAFRVIANTDAGNVRVEY  127



>emb|CBI21024.3| unnamed protein product [Vitis vinifera]
Length=129

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +    +G L  +ASD ++ NG ACGR YR+RC     +G+ 
Sbjct  25   GTATSYDPPYLPTKCKGYDQNQFPEGGLFVSASDGLWDNGAACGRRYRLRCI----SGLR  80

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ G + V++VD C    C AT+ LS +AF  I+   + K+NI+Y Q
Sbjct  81   RPCKEGSIVVQVVDFCQHRPCPATMVLSNKAFDAISRIPSAKINIEYAQ  129



>ref|XP_011026456.1| PREDICTED: EG45-like domain containing protein 2 [Populus euphratica]
Length=131

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  + S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYNPPYLPTKCHGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +TI LS +AF+ ++   + K+N++Y+Q+
Sbjct  82   RPCKDGTIDVRVVDFCRKSPCPSTILLSGDAFSAVSRSLSAKINVEYIQI  131



>ref|XP_009782997.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
sylvestris]
Length=127

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 12/109 (11%)
 Frame = -2

Query  617  GTATFY-TPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC  441
            GTA+FY   PYV S C+G   QGTL+A++          CG + +V CTGP    VP+PC
Sbjct  26   GTASFYYNLPYVSSVCFGNTSQGTLVASSDQ--LGEEFQCGTLLKVTCTGP----VPKPC  79

Query  440  RGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNA--GKVNIDYVQV  303
             G+ V VKIV  CP  GC  T+DLS+EAFAIIA P      + IDYV+V
Sbjct  80   TGKSVVVKIVHTCP--GCGVTMDLSKEAFAIIATPVTVDNIIKIDYVKV  126



>ref|XP_009355724.1| PREDICTED: EG45-like domain containing protein [Pyrus x bretschneideri]
Length=140

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GT T Y PPY+P+ C+G ++     G L  A S+ ++ NG ACGR YR+RC     +G  
Sbjct  35   GTGTSYGPPYIPTKCFGSRQDQFPPGNLFVAVSEGLWDNGAACGRRYRLRCL----SGRN  90

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G   V VK+VD C    C +T+ +S +AFA I+   + ++N++YVQ
Sbjct  91   KPCKGGATVDVKVVDLCNKSPCPSTVAMSTDAFAAISHSPSTRINVEYVQ  140



>ref|XP_004245324.2| PREDICTED: EG45-like domain containing protein [Solanum lycopersicum]
Length=131

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y  PY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYNSPYTPTKCGGNRSDQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +TI LS +AFA I++ +  K+NI+YVQ+
Sbjct  82   RPCKEGTIDVRVVDYCTKRPCPSTIALSTDAFAQISNAHNAKINIEYVQI  131



>gb|KCW85963.1| hypothetical protein EUGRSUZ_B02666, partial [Eucalyptus grandis]
Length=74

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -2

Query  548  LIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKIVDRCPSPGCQATIDL  372
            +IAAASD ++  G ACGR   V CTG TN G P PC G  V V IVD CPS GC+ TIDL
Sbjct  1    MIAAASDELWEGGAACGRTSLVTCTGATNLGDPHPCTGASVVVTIVDYCPS-GCRGTIDL  59

Query  371  SQEAFAIIADPNAGK  327
            SQEAFA IA   AGK
Sbjct  60   SQEAFAAIAHLEAGK  74



>gb|AAO85279.1| immuno-reactant natriuretic peptide-like protein precursor [Hedera 
helix]
Length=104

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + TL+    + ++ NG ACGR YRVRC G T     + C 
Sbjct  3    GKAVYYDPPYTRSACYGTQRE-TLVVGVKNNLWQNGRACGRRYRVRCIGAT-YNFDRACT  60

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG + + Y
Sbjct  61   GRTVDVKVVDFCREP-CNGDLNLSRDAFRVIANTDAGNIRVVY  102



>ref|XP_006371737.1| hypothetical protein POPTR_0018s01570g [Populus trichocarpa]
 gb|ERP49534.1| hypothetical protein POPTR_0018s01570g [Populus trichocarpa]
Length=131

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G ++     G L  + S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYNPPYLPTKCHGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ + + V++VD C    C +TI LS +AF+ ++   + K+N++Y+Q+
Sbjct  82   RPCKDQTIDVRVVDFCRKSPCPSTILLSGDAFSAVSHSPSAKINVEYIQI  131



>ref|XP_007011890.1| Plant natriuretic peptide A [Theobroma cacao]
 gb|EOY29509.1| Plant natriuretic peptide A [Theobroma cacao]
Length=131

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+ C G+ E     G L AA SD ++ NG +CGR YR+RC     +G  
Sbjct  27   GTAKAYDPPYLPTKCNGYNEDQFPPGGLFAAVSDGLWDNGASCGRKYRIRCI----SGPK  82

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+   + V++VDRC    C AT+ LS +AF  I+  +A ++N++Y Q+
Sbjct  83   RPCKARSIVVEVVDRCTEDPCPATMQLSNKAFVAISKFDA-RINVEYAQI  131



>ref|XP_008792053.1| PREDICTED: EG45-like domain containing protein [Phoenix dactylifera]
Length=138

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P++C G+ +       + AA S  ++ NG ACGR YR+RC     +G+ 
Sbjct  33   GTAASYGPPYTPTSCNGYSQDQFPPNNMFAAVSWGLWDNGAACGRTYRLRCL----SGID  88

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + V +VD+C S  C A + LS+EAF  ++    GK+N++Y Q+
Sbjct  89   RPCKGGNIVVVVVDKCASNPCPANLLLSREAFGAVSRFTDGKINVEYTQI  138



>ref|XP_002269641.1| PREDICTED: EG45-like domain containing protein [Vitis vinifera]
 emb|CBI36297.3| unnamed protein product [Vitis vinifera]
Length=130

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P+ C G ++     G L  + S+ ++ NG ACGR YR+RC     +G  
Sbjct  25   GTANSYNPPYTPTRCNGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCL----SGAK  80

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G V VK+VD C    C +T+ LS +AFA I+   + K+N++Y+Q+
Sbjct  81   KPCKDGTVDVKVVDFCSVRPCPSTLLLSNDAFAAISHSPSMKINVEYIQI  130



>ref|NP_849979.1| plant natriuretic peptide A [Arabidopsis thaliana]
 sp|Q9ZV52.2|EGC2_ARATH RecName: Full=EG45-like domain containing protein 2; AltName: 
Full=Plant natriuretic peptide A; Short=AtEXPR3; Short=AtPNP-A; 
Short=Ath-ExpGamma-1.2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL38745.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06790.1| plant natriuretic peptide A [Arabidopsis thaliana]
Length=130

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + TL+    + ++ NG ACGR YRVRC G T     + C 
Sbjct  28   GKAVYYDPPYTRSACYGTQRE-TLVVGVKNNLWQNGRACGRRYRVRCIGAT-YNFDRACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG + + Y
Sbjct  86   GRTVDVKVVDFCREP-CNGDLNLSRDAFRVIANTDAGNIRVVY  127



>gb|AAD08935.1| hypothetical protein [Arabidopsis thaliana]
Length=126

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + TL+    + ++ NG ACGR YRVRC G T     + C 
Sbjct  25   GKAVYYDPPYTRSACYGTQRE-TLVVGVKNNLWQNGRACGRRYRVRCIGAT-YNFDRACT  82

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG + + Y
Sbjct  83   GRTVDVKVVDFCREP-CNGDLNLSRDAFRVIANTDAGNIRVVY  124



>ref|XP_010414521.1| PREDICTED: EG45-like domain containing protein 2 isoform X1 [Camelina 
sativa]
 ref|XP_010414528.1| PREDICTED: EG45-like domain containing protein 2 isoform X2 [Camelina 
sativa]
 ref|XP_010467695.1| PREDICTED: EG45-like domain containing protein 2 isoform X1 [Camelina 
sativa]
 ref|XP_010489572.1| PREDICTED: EG45-like domain containing protein 2 isoform X1 [Camelina 
sativa]
Length=130

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + T++      +Y  G ACGR YRVRC G T    P+ C 
Sbjct  28   GRAVYYNPPYTRSACYGTQRE-TMVVGVRSNLYQGGRACGRRYRVRCIGAT-YNFPRACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V V++VD C  P C   ++LS++AF +IA+ +AG + ++Y  +
Sbjct  86   GRTVDVRVVDFCREP-CNGDLNLSRDAFRVIANTDAGNIRVEYTPI  130



>ref|XP_010414536.1| PREDICTED: EG45-like domain containing protein 2 isoform X3 [Camelina 
sativa]
 ref|XP_010467696.1| PREDICTED: EG45-like domain containing protein 2 isoform X2 [Camelina 
sativa]
 ref|XP_010489573.1| PREDICTED: EG45-like domain containing protein 2 isoform X2 [Camelina 
sativa]
 ref|XP_010489575.1| PREDICTED: EG45-like domain containing protein 2 [Camelina sativa]
 ref|XP_010489576.1| PREDICTED: EG45-like domain containing protein 2 [Camelina sativa]
Length=129

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + T++      +Y  G ACGR YRVRC G T    P+ C 
Sbjct  28   GRAVYYNPPYTRSACYGTQRE-TMVVGVRSNLYQGGRACGRRYRVRCIGAT-YNFPRACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V V++VD C  P C   ++LS++AF +IA+ +AG + ++Y
Sbjct  86   GRTVDVRVVDFCREP-CNGDLNLSRDAFRVIANTDAGNIRVEY  127



>gb|AFK48209.1| unknown [Lotus japonicus]
Length=133

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 12/112 (11%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+AC G + +    G + AA ++ ++ NG ACGR YRVRC     +G  
Sbjct  27   GTAAAYGPPYIPTACDGNRREQFPPGNIFAAVNEGLWDNGAACGRSYRVRCV----SGHN  82

Query  449  QPCR-GEVTVKIVDRCPS-PGCQATIDLSQEAFAIIAD-PNAGKVNIDYVQV  303
            +PC+ G V VK+VD C +   C  T+ LS +AFA I+  PNA K+NI+Y Q+
Sbjct  83   KPCKGGSVDVKVVDSCAAGSSCSNTLLLSNDAFAAISRFPNA-KINIEYTQI  133



>ref|XP_002979711.1| hypothetical protein SELMODRAFT_153550 [Selaginella moellendorffii]
 gb|EFJ19113.1| hypothetical protein SELMODRAFT_153550 [Selaginella moellendorffii]
Length=130

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 62/104 (60%), Gaps = 13/104 (13%)
 Frame = -2

Query  611  ATFYTPPYVPSACYGFQE--QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            ATFYTPPY PS+C+GF       L AAAS  ++ N  ACG  + VRCTG         CR
Sbjct  33   ATFYTPPYQPSSCFGFDPLPADFLFAAASPAVFNNRAACGTFFCVRCTG-------NGCR  85

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                + V+IVD CP  GC    DLSQEAFA IADP  G ++++Y
Sbjct  86   NGNTIRVQIVDLCP--GCPGAFDLSQEAFARIADPAVGVISVNY  127



>ref|XP_002308659.2| hypothetical protein POPTR_0006s26840g [Populus trichocarpa]
 gb|EEE92182.2| hypothetical protein POPTR_0006s26840g [Populus trichocarpa]
Length=131

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G ++     G L  + S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYEPPYLPTKCNGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +TI LS +AF+ ++   + K+N++Y+Q+
Sbjct  82   KPCKDGTIDVRVVDFCRKSPCPSTILLSNDAFSSVSYSPSAKINVEYIQI  131



>gb|AAM18791.1| immuno-reactant natriuretic peptide-like protein [Erucastrum 
strigosum]
Length=126

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + TL+    + ++ NG ACGR YRVRC G T     + C 
Sbjct  25   GKAVYYDPPYTRSACYGTQRE-TLVVGVKNNLWQNGRACGRRYRVRCIGAT-YNFDRACT  82

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF ++A+ +AG + + Y
Sbjct  83   GRTVDVKVVDFCREP-CNGDLNLSRDAFRVVANTDAGNIRVVY  124



>gb|AFK33398.1| unknown [Lotus japonicus]
Length=133

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 12/112 (11%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+AC G + +    G + AA ++ ++ NG ACGR YRVRC     +G  
Sbjct  27   GTAAAYGPPYIPTACDGNRREQFPPGNIFAAVNEGLWDNGAACGRRYRVRCV----SGHN  82

Query  449  QPCR-GEVTVKIVDRCPS-PGCQATIDLSQEAFAIIAD-PNAGKVNIDYVQV  303
            +PC+ G V VK+VD C +   C  T+ LS +AFA I+  PNA K+NI+Y Q+
Sbjct  83   KPCKGGSVDVKVVDSCAAGSSCSNTLFLSNDAFAAISRFPNA-KINIEYTQI  133



>gb|KFK40256.1| hypothetical protein AALP_AA3G350600 [Arabis alpina]
Length=130

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG ++  T++    D ++  G ACGR YRVRC G T     +PC 
Sbjct  28   GRAVYYDPPYTRSACYG-RQYNTMVVGVKDNLWQRGRACGRRYRVRCIGAT-YHFDRPCT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V V +VD C  P C   ++LS++AF +IA+ +AG + ++Y
Sbjct  86   GRTVDVTVVDYCREP-CNGDLNLSRDAFRVIANTDAGNIRVEY  127



>ref|XP_011039706.1| PREDICTED: EG45-like domain containing protein [Populus euphratica]
Length=131

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G ++     G L  + S+ ++ NG ACGR YR+RC    N    
Sbjct  26   GTATSYQPPYLPTKCNGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNN----  81

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +TI LS +AF+ ++   + K+N++Y+Q+
Sbjct  82   KPCKDGTIDVRVVDFCRKSPCPSTILLSNDAFSSVSYSPSAKINVEYIQI  131



>ref|XP_006298812.1| hypothetical protein CARUB_v10014916mg [Capsella rubella]
 gb|EOA31710.1| hypothetical protein CARUB_v10014916mg [Capsella rubella]
Length=130

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + T++      +Y  G ACGR YRVRC G T    P  C 
Sbjct  28   GRAVYYNPPYTRSACYGTQRE-TMVVGVRGYMYQGGQACGRRYRVRCLGAT-YNFPGACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            G  V V++VD C  P C   ++LS++AF +IA+ NAG + ++Y  +
Sbjct  86   GRTVDVRVVDLCREP-CNGDLNLSRDAFRVIANTNAGNIRVEYTPI  130



>ref|XP_002886189.1| hypothetical protein ARALYDRAFT_319814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62448.1| hypothetical protein ARALYDRAFT_319814 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SACYG Q + T++    + ++ NG ACGR YRVRC G T    P  C 
Sbjct  28   GKAVYYDPPYTRSACYGTQRE-TMVVGVKNNLWQNGRACGRRYRVRCIGAT-YNFPGACT  85

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ +AG + + Y
Sbjct  86   GRTVDVKVVDFCREP-CNGDLNLSRDAFRVIANIDAGNIRVVY  127



>emb|CDP13495.1| unnamed protein product [Coffea canephora]
Length=165

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 11/111 (10%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  27   GTATSYNPPYTPTKCGGNRNDQFPAGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  82

Query  449  QPCRG---EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PCR     + V++VD CP   C +TI LS +AFA I+     K+NI+Y+Q
Sbjct  83   KPCRDIGTTIDVRVVDFCPRRPCPSTIVLSSDAFAAISRNPDAKINIEYIQ  133



>ref|XP_008388276.1| PREDICTED: EG45-like domain containing protein isoform X1 [Malus 
domestica]
 ref|XP_008388277.1| PREDICTED: EG45-like domain containing protein isoform X1 [Malus 
domestica]
Length=131

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 68/111 (61%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGT----LIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G +        L AA S+ ++  G ACGR+Y++RC    N    
Sbjct  25   GTATSYGPPYMPTTCFGSRPDQFPPMYLFAAVSEGLWDGGSACGRLYKIRCLSGRN----  80

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             PC+G   V VK+VD C    C +TI +S  AFA I++ ++ ++NI+Y+Q+
Sbjct  81   MPCKGGATVEVKVVDLCRQSPCPSTIAMSTNAFAAISNSSSTQINIEYLQI  131



>ref|XP_002979710.1| hypothetical protein SELMODRAFT_111663 [Selaginella moellendorffii]
 ref|XP_002988363.1| hypothetical protein SELMODRAFT_229368 [Selaginella moellendorffii]
 gb|EFJ10453.1| hypothetical protein SELMODRAFT_229368 [Selaginella moellendorffii]
 gb|EFJ19112.1| hypothetical protein SELMODRAFT_111663 [Selaginella moellendorffii]
Length=130

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 62/104 (60%), Gaps = 13/104 (13%)
 Frame = -2

Query  611  ATFYTPPYVPSACYGFQE--QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            ATFYTPPY PS+C+GF       L AAAS  ++ N  ACG  + VRCTG         CR
Sbjct  33   ATFYTPPYQPSSCFGFDPLPADFLFAAASPAVFNNRAACGTFFCVRCTG-------NGCR  85

Query  437  G--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
                + V+IVD CP  GC    DLSQEAFA IADP  G ++++Y
Sbjct  86   NGNTIRVQIVDLCP--GCPGAFDLSQEAFARIADPAVGVISVNY  127



>ref|XP_008388280.1| PREDICTED: EG45-like domain containing protein isoform X3 [Malus 
domestica]
Length=119

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGT----LIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G +        L AA S+ ++  G ACGR+Y++RC     +G  
Sbjct  13   GTATSYGPPYMPTTCFGSRPDQFPPMYLFAAVSEGLWDGGSACGRLYKIRCL----SGRN  68

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             PC+G   V VK+VD C    C +TI +S  AFA I++ ++ ++NI+Y+Q+
Sbjct  69   MPCKGGATVEVKVVDLCRQSPCPSTIAMSTNAFAAISNSSSTQINIEYLQI  119



>ref|XP_008388279.1| PREDICTED: EG45-like domain containing protein isoform X2 [Malus 
domestica]
Length=121

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGT----LIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C+G +        L AA S+ ++  G ACGR+Y++RC     +G  
Sbjct  15   GTATSYGPPYMPTTCFGSRPDQFPPMYLFAAVSEGLWDGGSACGRLYKIRCL----SGRN  70

Query  449  QPCRG--EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             PC+G   V VK+VD C    C +TI +S  AFA I++ ++ ++NI+Y+Q+
Sbjct  71   MPCKGGATVEVKVVDLCRQSPCPSTIAMSTNAFAAISNSSSTQINIEYLQI  121



>ref|XP_003603417.1| EG45-like domain containing protein [Medicago truncatula]
 gb|AES73668.1| rare lipoprotein A-like double-psi beta-barrel protein [Medicago 
truncatula]
Length=151

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 14/114 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA+ Y PPY+P+AC G + Q    G +  A ++ ++ NG ACGR YRVRC     +G+ 
Sbjct  43   GTASSYGPPYIPTACDGNRRQQFPPGNIFVAVNEGLWDNGAACGRRYRVRCV----SGIN  98

Query  449  QPCRG--EVTVKIVDR--CPSPGCQATIDLSQEAFAIIAD-PNAGKVNIDYVQV  303
            +PC+G   + VK+VD   C    C  T  +S EAFA I+  PNA  +N++Y+Q+
Sbjct  99   KPCKGGSSIDVKVVDSITCTKSSCPHTFHMSTEAFAAISRFPNAN-INVEYIQI  151



>ref|XP_010688162.1| PREDICTED: EG45-like domain containing protein [Beta vulgaris 
subsp. vulgaris]
Length=126

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 59/103 (57%), Gaps = 5/103 (5%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC-  441
            G A ++T    PSACYG Q+ G  I   S  ++ N GACGR Y V C G  N   P PC 
Sbjct  25   GLAVYHTHN-TPSACYGNQDHGQWITGVSGALWNNRGACGRYYWVTCIGGANL-APHPCK  82

Query  440  RGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            RG V V++ D C S  C   ++LSQ+AF  IAD  AGK+ + Y
Sbjct  83   RGSVLVRVTDFCAS--CAGDLNLSQQAFNQIADTRAGKIRVRY  123



>ref|XP_009626732.1| PREDICTED: EG45-like domain containing protein isoform X1 [Nicotiana 
tomentosiformis]
Length=152

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 9/107 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  40   GTATSYNPPYTPTKCGGNRADQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  95

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            +PC+ G + V++VD C    C +TI LS +AFA I+     K+NI+Y
Sbjct  96   RPCKEGTIDVRVVDHCTKRPCPSTIVLSSDAFAEISHSQNAKINIEY  142



>ref|XP_006450462.1| hypothetical protein CICLE_v10009837mg [Citrus clementina]
 gb|ESR63702.1| hypothetical protein CICLE_v10009837mg [Citrus clementina]
Length=130

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G ++     G L  A  + ++ NG ACGR YR+RC    N    
Sbjct  26   GTATAYHPPYLPTRCNGNRQDQFPPGNLFVAVGEGLWDNGAACGRRYRMRCISGNN----  81

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + VK+VD C +  C +TI LS +AF  I+  +A K+N++YVQ+
Sbjct  82   KPCKGSTIDVKVVDFCRTSPCPSTIVLSNDAFQAISRVDA-KINVEYVQI  130



>ref|XP_009797601.1| PREDICTED: EG45-like domain containing protein isoform X1 [Nicotiana 
sylvestris]
Length=151

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  39   GTATSYNPPYTPTKCGGNRADQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  94

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV*SKRR  288
            +PC+ G + VK+VD C    C +TI LS +AFA ++     K+NI+Y    +K R
Sbjct  95   RPCKEGTIDVKVVDYCTKRPCPSTIVLSSDAFAQVSHSQNAKINIEYDLTTNKLR  149



>ref|XP_006361730.1| PREDICTED: EG45-like domain containing protein 2-like [Solanum 
tuberosum]
Length=129

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y  PY P+ C G +      G L  A S+ ++ NG ACGR YR+RC    N    
Sbjct  25   GTATSYNSPYTPTKCGGNRSDQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGNN----  80

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ G + V++VD C    C +TI LS +AFA I+  +  K+NI+YVQ
Sbjct  81   RPCKEGTIDVRVVDYCTKRPCPSTIALSTDAFAQISISHNAKINIEYVQ  129



>tpg|DAA61898.1| TPA: hypothetical protein ZEAMMB73_297023, partial [Zea mays]
Length=74

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = -2

Query  593  PYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCRG-EVTVKI  417
            P+  SACYG+Q  GT+IAAASD  +  G ACG  Y V C G TN GVP PC G  VTV+I
Sbjct  2    PHAASACYGYQYMGTMIAAASDVFWNGGAACGDRYAVSCKGGTNEGVPHPCTGRSVTVQI  61

Query  416  VDRCPSPGCQATI  378
            VD CP+ GCQ TI
Sbjct  62   VDLCPA-GCQGTI  73



>ref|XP_003619769.1| EG45-like domain containing protein [Medicago truncatula]
 gb|AES75987.1| rare lipoprotein A-like double-psi beta-barrel protein [Medicago 
truncatula]
Length=133

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 14/114 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA+ Y PPY+P+AC G + Q    G +  A ++ ++ NG ACGR YR+RC     +G+ 
Sbjct  25   GTASSYGPPYIPTACDGNRRQQFPPGNIFVAVNEGLWDNGAACGRRYRIRCI----SGIN  80

Query  449  QPCR--GEVTVKIVDR--CPSPGCQATIDLSQEAFAIIAD-PNAGKVNIDYVQV  303
            +PC+    + VK+VD+  C    C  T  +S EAFA I+  PNA  +N++Y+Q+
Sbjct  81   KPCKVGSSIDVKVVDKITCTRSSCHQTFHMSTEAFAAISRFPNA-NINVEYIQI  133



>ref|XP_006409125.1| hypothetical protein EUTSA_v10022910mg [Eutrema salsugineum]
 gb|ESQ50578.1| hypothetical protein EUTSA_v10022910mg [Eutrema salsugineum]
Length=127

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 4/103 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            G A +Y PPY  SAC G Q + T++      +Y  G ACGR YRVRC G T    P  C 
Sbjct  25   GRAVYYNPPYTRSACSGRQYE-TMVVGLKSNLYQGGRACGRRYRVRCIGAT-YNFPGACT  82

Query  437  GE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDY  312
            G  V VK+VD C  P C   ++LS++AF +IA+ NAG + ++Y
Sbjct  83   GRTVVVKVVDFCREP-CNGDLNLSRDAFQVIANTNAGNIRVEY  124



>ref|XP_008792052.1| PREDICTED: EG45-like domain containing protein [Phoenix dactylifera]
Length=134

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +       L  AA + ++ NG ACGR YR+RC     +G+ 
Sbjct  29   GTATSYGPPYLPTKCSGYNQDQLPGNGLFVAAGNGVWDNGAACGRKYRLRCL----SGLR  84

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C +  C +T+ LS EAF  ++     K+N++Y Q+
Sbjct  85   RPCKDGTIVVEVVDLCRNRPCSSTLVLSNEAFDAVSKIPNTKINVEYTQI  134



>ref|XP_006483331.1| PREDICTED: EG45-like domain containing protein-like [Citrus sinensis]
 ref|XP_006483341.1| PREDICTED: EG45-like domain containing protein-like [Citrus sinensis]
Length=130

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G ++     G L  A  + ++ NG ACGR YR+RC    N    
Sbjct  26   GTATAYHPPYLPTRCNGNRQDQFPPGNLFVAVGEGLWDNGAACGRRYRMRCISGNN----  81

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + VK+VD C    C +TI LS +AF  I+  +A K+N++YVQ+
Sbjct  82   KPCKGSTIDVKVVDFCRKSPCPSTIVLSNDAFQAISRVDA-KINVEYVQI  130



>gb|KDP34255.1| hypothetical protein JCGZ_07826 [Jatropha curcas]
Length=93

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFY   YVPS CYG   +G +IAAASD I+ NG ACGR YRVRCTG TN G P PC+
Sbjct  26   GTATFYNH-YVPSYCYGNANKGVMIAAASDAIWNNGAACGRKYRVRCTGATNNG-PPPCK  83

Query  437  -GEVTVKIVD  411
             G V V IVD
Sbjct  84   GGSVDVTIVD  93



>ref|XP_007137033.1| hypothetical protein PHAVU_009G094000g [Phaseolus vulgaris]
 gb|ESW09027.1| hypothetical protein PHAVU_009G094000g [Phaseolus vulgaris]
Length=129

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+AC G        G L  A ++ ++ NG ACGR YR+RC    N    
Sbjct  25   GTAASYGPPYIPTACGGNSAGQFPPGNLFVAVNEGLWDNGAACGRRYRIRCMSGKN----  80

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G  + VK+VD CP   C  ++ +S++AFA I+     K+NI+Y +
Sbjct  81   RPCKGGSIDVKVVDSCPGSPCSNSLLMSKDAFAAISHFPHAKINIEYTE  129



>ref|XP_002524475.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37915.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            G+AT Y PPY+P+ C G+ E    QG    AAS+ I+ NG ACGR YR+RC     +G  
Sbjct  25   GSATSYDPPYLPTRCKGYSEDQFPQGGYFVAASEGIWDNGAACGRKYRMRCI----SGPR  80

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ E + V++VD C    C +T+ LS +AF+ I+   A K+N+++ Q
Sbjct  81   RPCKDESIVVQVVDLCRGNPCPSTLVLSNKAFSAISKVPAIKINVEFAQ  129



>ref|XP_009626720.1| PREDICTED: EG45-like domain containing protein [Nicotiana tomentosiformis]
Length=134

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 65/110 (59%), Gaps = 8/110 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC   +     
Sbjct  28   GTATSYNPPYTPTRCNGNRGDQFPAGNLFVAVSEGLWDNGAACGRRYRLRCMSGSGR---  84

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + V++VD C    C +TI LS +AF+ I+     K+NI+Y+Q+
Sbjct  85   RPCKGGTIDVRVVDYCRKRPCPSTIALSSDAFSEISRSPNAKINIEYIQI  134



>gb|KCW81415.1| hypothetical protein EUGRSUZ_C02792, partial [Eucalyptus grandis]
Length=113

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+ C G+      +G    AASD ++ NG ACGR YRVRC     +G  
Sbjct  9    GTAMSYDPPYLPTRCKGYDPDQFPEGGYFIAASDGLWDNGAACGRRYRVRCI----SGPK  64

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PCR   + V++VD C S  C AT+ LS +AF  I+  +  K+N++Y Q
Sbjct  65   RPCREATIFVEVVDFCRSNVCPATMTLSTKAFNAISRYSDAKINVEYTQ  113



>ref|XP_010914875.1| PREDICTED: EG45-like domain containing protein [Elaeis guineensis]
Length=131

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ +       L  AA   I+ NG ACGR YR+RC     +G+ 
Sbjct  26   GTATSYDPPYLPTKCSGYNQDQMPGNGLFVAAGGGIWDNGAACGRKYRLRCL----SGLR  81

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + V++VD C +  C +T+ LS +AF  ++     K+N++Y Q+
Sbjct  82   RPCKGGSIVVEVVDLCRNSPCPSTLVLSNKAFDAVSKIPNTKINVEYTQI  131



>ref|XP_010059598.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
 ref|XP_010048252.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
Length=141

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P+AC+G+         L AAA + I+ NG ACGR Y VRC    +A  P
Sbjct  29   GTAGHYDPPYTPTACFGYDPLQFPSSFLFAAAGEGIWDNGAACGRQYWVRCI---SADRP  85

Query  449  QPCR--GEVTVKIVDRC-----PSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            + C     V V+IVDR       S   +ATI LS+ AF  IA+P+A  VN+++VQV
Sbjct  86   KTCNPAQLVQVRIVDRALSAVSRSSSDRATIVLSKTAFEAIANPSASSVNVEFVQV  141



>ref|XP_010519943.1| PREDICTED: EG45-like domain containing protein [Tarenaya hassleriana]
Length=132

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 11/111 (10%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYG-----FQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGV  453
            GTA  Y PPY+P+ C G     FQ +G  +AA SD ++ NG +CGR YR+RC      G 
Sbjct  27   GTAASYDPPYLPTRCNGYKQGEFQSRGYFVAA-SDGLWDNGASCGRRYRLRCLN----GR  81

Query  452  PQPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
              PCRG  + V++VD C S  C AT  LS +AF  I+     K+NI++ Q+
Sbjct  82   RNPCRGRSIVVEVVDVCKSDPCPATFLLSNKAFDEISRFPDAKINIEFQQI  132



>gb|KDP33631.1| hypothetical protein JCGZ_07202 [Jatropha curcas]
Length=141

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 66/115 (57%), Gaps = 14/115 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y+PPY+P+ACYG  E       L AAAS+ I+ NG ACGR Y VRC    +A  P
Sbjct  30   GTAAHYSPPYLPTACYGNDESQFPSSNLFAAASEGIWDNGAACGRQYLVRC---ISAVAP  86

Query  449  QPCRGE--VTVKIVDRCPSPGCQ-----ATIDLSQEAFAIIADPNAGKVNIDYVQ  306
              C  E  + V+IVDR  +   +     ATI LS  AFA IA P+   VN+++ Q
Sbjct  87   NTCNREKIIRVRIVDRAQTSVSRPSRNGATIILSDIAFAQIASPSVSSVNVEFQQ  141



>gb|KCW81417.1| hypothetical protein EUGRSUZ_C02797, partial [Eucalyptus grandis]
Length=113

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+ C G+      +G    AASD ++ NG ACGR YRVRC     +G  
Sbjct  9    GTAMSYNPPYLPTRCKGYDPGQFPEGGYFIAASDGLWDNGAACGRRYRVRCI----SGPK  64

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PCR   + V++VD C S  C AT+ LS +AF  I+     K+N++Y Q
Sbjct  65   RPCREATIFVEVVDFCRSNVCPATMTLSNKAFNAISRYPDAKINVEYTQ  113



>ref|XP_008344354.1| PREDICTED: EG45-like domain containing protein 2 isoform X2 [Malus 
domestica]
Length=142

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGT----LIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y+PPY+P+ C+G +        L  A S+ ++  G ACGR+Y++RC    N    
Sbjct  36   GTATPYSPPYIPTRCFGTRPDQFPPMYLFXAVSEGLWDGGSACGRIYKIRCLSGPN----  91

Query  449  QPCRGEVTV--KIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             PC+G  TV  K+VD C    C +TI +S +AFA I+  ++  +NI+Y Q+
Sbjct  92   MPCKGRATVEAKVVDFCRQSPCPSTIAMSTDAFAAISHNSSAPINIEYAQI  142



>ref|XP_006854924.1| hypothetical protein AMTR_s00052p00109070 [Amborella trichopoda]
 gb|ERN16391.1| hypothetical protein AMTR_s00052p00109070 [Amborella trichopoda]
Length=126

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 7/109 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTATFY PPY P+ CYG          L AAASD I+ NG ACGR Y VRC    ++  P
Sbjct  20   GTATFYNPPYAPTKCYGNDTSQFPANNLFAAASDSIWDNGAACGREYTVRCLSDASSADP  79

Query  449  QPCRGEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPN-AGKVNIDYVQ  306
                  + V+IVD   + G   T+ LS +AF   ADPN A  +N ++ Q
Sbjct  80   CVANSAIQVRIVDYRTAAG--TTMLLSSDAFQATADPNMATTINFEFQQ  126



>ref|XP_004501316.1| PREDICTED: EG45-like domain containing protein-like [Cicer arietinum]
Length=132

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA+ Y PPY+P+AC G + +    G + AA ++ ++ NG ACGR YR+RC     +G+ 
Sbjct  25   GTASSYGPPYIPTACDGNRREQFPPGNIFAAVNEGLWDNGAACGRRYRIRCL----SGIN  80

Query  449  QPCR-GEVTVKIVD--RCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + VKIVD   C    C  T  LS +AFA I+      +NI+Y+Q+
Sbjct  81   KPCKDGSIDVKIVDIISCSKHPCFQTFLLSTQAFAAISRFPNANINIEYMQI  132



>gb|KCW80453.1| hypothetical protein EUGRSUZ_C01794 [Eucalyptus grandis]
Length=155

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P+AC+G+         L AAA + I+ NG ACGR Y VRC    +A  P
Sbjct  43   GTAGHYDPPYTPTACFGYDPLQFPSSFLFAAAGEGIWDNGAACGRQYWVRC---ISADRP  99

Query  449  QPCR--GEVTVKIVDRC-----PSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            + C     V V+IVDR       S   +AT+ LS+ AF  IA+P+A  VN+++VQV
Sbjct  100  KTCNPAQLVQVRIVDRALSAVSRSSSDRATVVLSKTAFEAIANPSASSVNVEFVQV  155



>ref|XP_006450476.1| hypothetical protein CICLE_v10010610mg, partial [Citrus clementina]
 gb|ESR63716.1| hypothetical protein CICLE_v10010610mg, partial [Citrus clementina]
Length=128

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 66/108 (61%), Gaps = 10/108 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G ++     G L  A  + ++ NG ACGR YR+RC    N    
Sbjct  26   GTATAYHPPYLPTRCNGNRQDQFPPGNLFVAVGEGLWDNGAACGRRYRMRCISGNN----  81

Query  449  QPCRGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYV  309
            +PC+G  + VK+VD C +  C +TI LS +AF  I+  +A K+N++YV
Sbjct  82   KPCKGSTIDVKVVDFCRASPCPSTIVLSNDAFQAISRVDA-KINVEYV  128



>ref|XP_010325216.1| PREDICTED: uncharacterized protein LOC104648879 [Solanum lycopersicum]
Length=248

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 8/109 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQ----EQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC   +     
Sbjct  16   GTATSYHPPYTPTRCNGNRGDQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGSGY---  72

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G  + V++VD C    C +TI LS +AF+ I+     K+NI+Y+Q
Sbjct  73   RPCKGGTIDVRVVDYCNKRPCPSTIALSADAFSQISHSTKAKINIEYIQ  121



>ref|XP_010048249.1| PREDICTED: EG45-like domain containing protein [Eucalyptus grandis]
 gb|KCW80454.1| hypothetical protein EUGRSUZ_C01794 [Eucalyptus grandis]
Length=141

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P+AC+G+         L AAA + I+ NG ACGR Y VRC    +A  P
Sbjct  29   GTAGHYDPPYTPTACFGYDPLQFPSSFLFAAAGEGIWDNGAACGRQYWVRC---ISADRP  85

Query  449  QPCR--GEVTVKIVDRC-----PSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            + C     V V+IVDR       S   +AT+ LS+ AF  IA+P+A  VN+++VQV
Sbjct  86   KTCNPAQLVQVRIVDRALSAVSRSSSDRATVVLSKTAFEAIANPSASSVNVEFVQV  141



>ref|XP_011082209.1| PREDICTED: EG45-like domain containing protein [Sesamum indicum]
Length=133

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 64/110 (58%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L    S+ ++ NG ACGR YR+RC   +N    
Sbjct  28   GTATSYDPPYAPTKCNGNRADQFPPGNLFVQVSEVLWDNGAACGRRYRLRCLSGSN----  83

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  V V++VD C    C +TI +S +AF  ++     K+NI+++Q+
Sbjct  84   KPCKGGTVDVRVVDFCSRRPCPSTIVMSNDAFDAVSRSPDAKINIEFIQI  133



>gb|KHN07086.1| EG45-like domain containing protein 2 [Glycine soja]
Length=129

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 63/109 (58%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY+P+AC G +      G L  A ++ ++ NG ACGR YR+RC    N    
Sbjct  25   GTAASYGPPYIPTACDGNRPGQFPPGNLFVAVNEGLWDNGAACGRRYRIRCVSGNN----  80

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G  + VK+VD C    C  T+ +S +AFA IA     K+NI+Y Q
Sbjct  81   RPCKGGSIDVKVVDSCSRSPCPNTLLMSNDAFAAIARFPHVKINIEYTQ  129



>ref|XP_006361729.1| PREDICTED: EG45-like domain containing protein-like [Solanum 
tuberosum]
Length=137

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (59%), Gaps = 8/109 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G +      G L  A S+ ++ NG ACGR YR+RC   +     
Sbjct  30   GTATSYHPPYTPTRCNGNRADQFPSGNLFVAVSEGLWDNGAACGRRYRLRCLSGSGY---  86

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G  + V++VD C    C +TI LS +AF+ I+     K+NI+Y+Q
Sbjct  87   RPCKGGTINVRVVDYCNKRPCPSTIALSADAFSQISPTPKSKINIEYIQ  135



>ref|XP_009782998.1| PREDICTED: putative EG45-like domain containing protein 1 [Nicotiana 
sylvestris]
Length=127

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 12/109 (11%)
 Frame = -2

Query  617  GTATFY-TPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC  441
            GTA+FY    +  + CYG   QGTL+AA SD +  +   CG + +V CTGP    VPQPC
Sbjct  26   GTASFYYNLSHATTTCYGNTTQGTLLAA-SDRLGLDFN-CGTLLKVTCTGP----VPQPC  79

Query  440  RGE-VTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGK--VNIDYVQV  303
             G+ V VK+V  CP  GC  T+DLS+EAF+IIA P   +  + IDYV+V
Sbjct  80   TGKSVVVKMVSDCP--GCGVTMDLSKEAFSIIATPVTVENIIKIDYVKV  126



>ref|XP_009797600.1| PREDICTED: EG45-like domain containing protein isoform X2 [Nicotiana 
sylvestris]
Length=135

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y  PY P+ C G +      G L  A S+ ++ NG ACGR YR+RC   +     
Sbjct  29   GTATSYNSPYTPTRCNGNRGDQFPAGNLFVAVSEGLWDNGAACGRRYRLRCLSGSGR---  85

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+G  + V++VD C    C +TI LS +AF+ I+     K+NI+Y+Q+
Sbjct  86   RPCKGGTIDVRVVDYCRKRPCPSTIALSSDAFSEISRSPNAKINIEYIQI  135



>ref|XP_011026494.1| PREDICTED: EG45-like domain containing protein isoform X2 [Populus 
euphratica]
 ref|XP_011026495.1| PREDICTED: EG45-like domain containing protein isoform X2 [Populus 
euphratica]
Length=140

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GT   Y PPY+P+ACYG          + AAA + I+ NG ACGR Y+VRC    +A VP
Sbjct  28   GTCAHYRPPYLPTACYGNSPSHFPSSKMFAAAGERIWDNGAACGRQYQVRC---ISAAVP  84

Query  449  QPCRGE--VTVKIVDRCPSPGCQ-----ATIDLSQEAFAIIADPNAGKVNIDYVQV  303
              C  +  + V+IVDR  +   +     ATI LS  AF  IADP+A  VN++++QV
Sbjct  85   GTCLPDQIIQVRIVDRAQTSRSRPSSNGATIVLSSTAFGTIADPSARLVNVEFLQV  140



>gb|ENH89000.1| avirulent on Ve1-like protein [Colletotrichum orbiculare MAFF 
240422]
Length=124

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 66/112 (59%), Gaps = 12/112 (11%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y+PPY+PS C G          L  AA D I+ NG AC R YRVRC    +A  P
Sbjct  18   GTATSYSPPYLPSQCGGNNPAIFPSSNLFVAAGDGIWDNGAACDRQYRVRC---ISAAQP  74

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGK--VNIDYVQV  303
            + C+ GE+ VK+VD    PG  +T+ LS  AFA +AD + G   +NI++ QV
Sbjct  75   RTCKGGEIMVKVVDY--KPGAGSTMVLSDTAFAALADTSKGASLINIEFEQV  124



>ref|XP_002976316.1| hypothetical protein SELMODRAFT_38740, partial [Selaginella moellendorffii]
 ref|XP_002987327.1| hypothetical protein SELMODRAFT_28725, partial [Selaginella moellendorffii]
 ref|XP_002987328.1| hypothetical protein SELMODRAFT_28726, partial [Selaginella moellendorffii]
 gb|EFJ11642.1| hypothetical protein SELMODRAFT_28725, partial [Selaginella moellendorffii]
 gb|EFJ11643.1| hypothetical protein SELMODRAFT_28726, partial [Selaginella moellendorffii]
 gb|EFJ22576.1| hypothetical protein SELMODRAFT_38740, partial [Selaginella moellendorffii]
Length=128

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQ-EQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC  441
            GTAT+Y  PY P+AC         + AA S  IY  G  CG MY ++C    N G P  C
Sbjct  22   GTATYYDSPYTPNACADNNLPADHMFAAGSAAIYMGGSGCGDMYTIKCVRQNNQG-PYGC  80

Query  440  R---GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
                G  T+KIVD CP  GC  T DL  E F  +ADPNAG + ++Y ++
Sbjct  81   TNNPGPYTIKIVDYCPE-GCNGTFDLPHELFQKMADPNAGNIIVEYQKI  128



>dbj|BAD45611.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD46067.1| hypothetical protein [Oryza sativa Japonica Group]
Length=98

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 58/105 (55%), Gaps = 31/105 (30%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPCR  438
            GTATFYT  Y PSACYG Q+ G +IAAASD ++A G  CG M+ VR              
Sbjct  25   GTATFYTT-YNPSACYGNQDNGRMIAAASDGLWAGGKICGTMFTVRT-------------  70

Query  437  GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
                             ATIDLS+EAFA IA+P AGKV IDY Q+
Sbjct  71   -----------------ATIDLSREAFAAIANPVAGKVLIDYQQL  98



>ref|XP_006483307.1| PREDICTED: EG45-like domain containing protein-like [Citrus sinensis]
Length=135

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 13/115 (11%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PP++P+AC G  +     G L AAA + I+ NG +CGR Y++RC    +A V 
Sbjct  24   GTAARYGPPFLPTACNGNDQSQFPSGNLFAAAGEGIWDNGASCGRQYKLRC---ISAAVS  80

Query  449  QPC-RGEVTVKIVDRCPS----PGCQ-ATIDLSQEAFAIIADPNAGKVNIDYVQV  303
              C    + +KIVDR  S    P  +  TI LS  AFA IA+P+A  VN++Y+QV
Sbjct  81   GTCINNTIQIKIVDRAQSLVSTPSLKGTTIVLSNTAFAAIANPSATVVNVEYIQV  135



>ref|XP_011026493.1| PREDICTED: EG45-like domain containing protein isoform X1 [Populus 
euphratica]
Length=234

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYG----FQEQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GT   Y PPY+P+ACYG          + AAA + I+ NG ACGR Y+VRC    +A VP
Sbjct  122  GTCAHYRPPYLPTACYGNSPSHFPSSKMFAAAGERIWDNGAACGRQYQVRC---ISAAVP  178

Query  449  QPCRGE--VTVKIVDRCPSPGCQ-----ATIDLSQEAFAIIADPNAGKVNIDYVQV  303
              C  +  + V+IVDR  +   +     ATI LS  AF  IADP+A  VN++++QV
Sbjct  179  GTCLPDQIIQVRIVDRAQTSRSRPSSNGATIVLSSTAFGTIADPSARLVNVEFLQV  234



>ref|XP_002976317.1| hypothetical protein SELMODRAFT_38741, partial [Selaginella moellendorffii]
 gb|EFJ22577.1| hypothetical protein SELMODRAFT_38741, partial [Selaginella moellendorffii]
Length=128

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQ-EQGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVPQPC  441
            GTAT+Y  PY P+AC         + AA S  IY  G  CG MY V+C    N G P  C
Sbjct  22   GTATYYDSPYTPNACADNNLPADHMFAAGSAAIYMGGRGCGDMYTVKCVRQNNQG-PYGC  80

Query  440  R---GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
                G  T+KIVD CP  GC  T DL  E F  +ADPNAG + ++Y ++
Sbjct  81   TSNPGPYTIKIVDYCPE-GCNGTFDLPHELFQKMADPNAGNIIVEYQKI  128



>ref|XP_010914876.1| PREDICTED: EG45-like domain containing protein [Elaeis guineensis]
Length=139

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 10/111 (9%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y PPY P+ C G+ +       + AA S  ++ NG ACGR YR+RC     +G+ 
Sbjct  33   GTAMSYGPPYTPTKCDGYSQGQFPPSNMFAAVSGGLWDNGAACGRTYRLRCL----SGIN  88

Query  449  QPCR-GEVTVKIVDRCP-SPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V +VD C  S  C A + LS+EAF  ++  + GK+N++Y Q+
Sbjct  89   RPCKNGNIVVVVVDECQMSNPCPANLLLSREAFGAVSRYSDGKINVEYTQI  139



>ref|XP_002324844.2| hypothetical protein POPTR_0018s01330g [Populus trichocarpa]
 gb|EEF03409.2| hypothetical protein POPTR_0018s01330g [Populus trichocarpa]
Length=157

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 14/115 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GT + Y PPY+P+ACYG          L AAA + I+ NG ACGR Y VRC    +A VP
Sbjct  28   GTCSHYRPPYLPTACYGNSSSHFPSSNLFAAAGEGIWDNGAACGRQYLVRC---ISAAVP  84

Query  449  QPCRGE--VTVKIVDRCPSPGCQ-----ATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            + C  +  + V+IVDR  +   +     ATI LS  AF  IADP+A  VN+++ Q
Sbjct  85   RTCLPDQIIQVRIVDRAQTSRSRPSSNGATIVLSSTAFGSIADPSARLVNVEFQQ  139



>ref|XP_009610346.1| PREDICTED: EG45-like domain containing protein isoform X1 [Nicotiana 
tomentosiformis]
Length=142

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 65/116 (56%), Gaps = 14/116 (12%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y+PPY PSAC+G            AAA + I+ +G ACGR Y V C    +   P
Sbjct  30   GTATQYSPPYTPSACFGSDSTQFPSSNFFAAAGEGIWDDGAACGRQYLVSCISSIS---P  86

Query  449  QPCR-GE-VTVKIVDRCPSPGCQ-----ATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            + C+ GE + +KIVDR  +   +      TI LS  AFA IAD NA  +NID+ QV
Sbjct  87   RACKSGETIQIKIVDRAQTVASKPTRQGTTIVLSNAAFAAIADSNAPSLNIDFRQV  142



>ref|XP_009381120.1| PREDICTED: EG45-like domain containing protein [Musa acuminata 
subsp. malaccensis]
Length=134

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQE----QGTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ E    +  L  AA + ++ NG ACGR Y++RC     +G+ 
Sbjct  29   GTATSYDPPYLPTKCPGYTEDQLPENGLFVAAGNGMWDNGAACGRKYQLRCL----SGLR  84

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
            +PC+ G + V++VD C    C +T+ LS  AF  ++     K+N++Y Q+
Sbjct  85   RPCKDGSIVVQVVDFCRVSPCPSTLVLSNRAFDAVSKIPNTKINVEYAQI  134



>ref|XP_009797599.1| PREDICTED: EG45-like domain containing protein isoform X1 [Nicotiana 
sylvestris]
Length=142

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 63/109 (58%), Gaps = 8/109 (7%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y  PY P+ C G +      G L  A S+ ++ NG ACGR YR+RC   +     
Sbjct  29   GTATSYNSPYTPTRCNGNRGDQFPAGNLFVAVSEGLWDNGAACGRRYRLRCLSGSGR---  85

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+G  + V++VD C    C +TI LS +AF+ I+     K+NI+Y+Q
Sbjct  86   RPCKGGTIDVRVVDYCRKRPCPSTIALSSDAFSEISRSPNAKINIEYIQ  134



>gb|KDP32388.1| hypothetical protein JCGZ_13313 [Jatropha curcas]
Length=133

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY+P+ C G+ E     G    A S+ I+ NG ACGR YR+RC     +G+ 
Sbjct  29   GTATSYDPPYLPTRCKGYNEDQFPPGGYFIAVSEGIWDNGAACGRKYRMRCI----SGLK  84

Query  449  QPCRG-EVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+   + V++VD C    C +T+ LS +AF  I+     K+N+++ Q
Sbjct  85   RPCKDPTIVVQVVDLCTLNPCPSTLLLSNKAFNAISKVPITKINVEFAQ  133



>gb|EYU20273.1| hypothetical protein MIMGU_mgv1a019531mg, partial [Erythranthe 
guttata]
Length=190

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTAT Y PPY P+ C G ++     G L    ++ ++ NG ACGR YR+RC   TN    
Sbjct  54   GTATSYDPPYTPTKCNGNRQDQFPSGNLFVQVNEGLWDNGAACGRRYRLRCLSGTN----  109

Query  449  QPCR-GEVTVKIVDRCPSPGCQATIDLSQEAFAIIADPNAGKVNIDYVQ  306
            +PC+ G V V++VD C    C +T+ +S +AF  ++     ++NI+++Q
Sbjct  110  KPCKGGTVDVRVVDFCSKRPCPSTMVMSNDAFDAVSHSLDARLNIEFIQ  158



>ref|XP_007013332.1| Uncharacterized protein TCM_037991 [Theobroma cacao]
 gb|EOY30951.1| Uncharacterized protein TCM_037991 [Theobroma cacao]
Length=141

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 9/113 (8%)
 Frame = -2

Query  617  GTATFYTPPYVPSACYGFQEQ----GTLIAAASDPIYANGGACGRMYRVRCTGPTNAGVP  450
            GTA  Y+PPY+P+ACYG  +       L AAA D I+ NG +CGR Y VRC   +  G  
Sbjct  30   GTAARYSPPYLPTACYGDDQSQFPSSNLFAAAGDGIWDNGASCGRQYLVRCISASEPGTC  89

Query  449  QPCRGEVTVKIVDRCPS----PGCQATIDLSQEAFAIIADPNAGKVNIDYVQV  303
             P +  + VKIVD  P+    P  Q+TI LS+ AF+ I +     +NI++ QV
Sbjct  90   VPDQ-TIQVKIVDYAPNAQSPPSAQSTIVLSETAFSGITNIAIDSINIEFQQV  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1173402497230