BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c47540_g1_i1 len=205 path=[161:0-114 276:115-159 276:160-204]

Length=205
                                                                      Score     E

emb|CDP18043.1|  unnamed protein product                              48.1    1e-04   
ref|XP_011073850.1|  PREDICTED: transcription factor bHLH25-like      43.9    8e-04   



>emb|CDP18043.1| unnamed protein product [Coffea canephora]
Length=330

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  1    SVARFGSLTYDITIIVEMLKEFDLPVKHIAKNLRYAIQNASK  126
            SVA FGSL  DITII EM KEF L +K + + LR A+Q A++
Sbjct  287  SVAPFGSLALDITIIAEMDKEFSLTMKELVQGLRSALQRAAR  328



>ref|XP_011073850.1| PREDICTED: transcription factor bHLH25-like [Sesamum indicum]
Length=145

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    SVARFGSLTYDITIIVEMLKEFDLPVKHIAKNLRYAIQ  114
            +VA FGSL  DITII +M +EF+L  K + K LR A++
Sbjct  107  NVATFGSLALDITIIADMEREFNLTAKEVVKRLRAALR  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515927033552