BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c47483_g1_i1 len=334 path=[1:0-333]

Length=334
                                                                      Score     E

ref|XP_009617780.1|  PREDICTED: uncharacterized protein LOC104110064    174   3e-49   
ref|XP_004232545.1|  PREDICTED: uncharacterized protein LOC101250947    172   1e-48   
ref|XP_006340808.1|  PREDICTED: uncharacterized protein LOC102585334    172   2e-48   
emb|CDP09140.1|  unnamed protein product                                172   3e-48   
ref|XP_009791934.1|  PREDICTED: uncharacterized protein LOC104239101    170   5e-48   
gb|EYU38462.1|  hypothetical protein MIMGU_mgv1a005921mg                166   1e-46   
gb|EPS73426.1|  hypothetical protein M569_01325                         167   2e-46   
ref|XP_011080844.1|  PREDICTED: uncharacterized protein LOC105164004    164   2e-45   
emb|CBI16015.3|  unnamed protein product                                157   7e-44   
ref|XP_010650952.1|  PREDICTED: uncharacterized protein LOC100265690    157   6e-43   
ref|XP_002520441.1|  conserved hypothetical protein                     154   3e-42   Ricinus communis
gb|KHN01792.1|  hypothetical protein glysoja_028464                     149   7e-42   
ref|XP_010262742.1|  PREDICTED: uncharacterized protein LOC104601...    154   1e-41   
ref|XP_010262741.1|  PREDICTED: uncharacterized protein LOC104601...    154   1e-41   
gb|KDP46563.1|  hypothetical protein JCGZ_08535                         153   1e-41   
ref|XP_010256702.1|  PREDICTED: uncharacterized protein LOC104597...    152   3e-41   
ref|XP_010256700.1|  PREDICTED: uncharacterized protein LOC104597...    152   6e-41   
ref|XP_010256701.1|  PREDICTED: uncharacterized protein LOC104597...    152   7e-41   
gb|KHN06269.1|  hypothetical protein glysoja_030335                     150   7e-41   
ref|XP_010256699.1|  PREDICTED: uncharacterized protein LOC104597...    152   7e-41   
ref|XP_003551325.1|  PREDICTED: uncharacterized protein LOC100812...    151   9e-41   
ref|XP_007016206.1|  Uncharacterized protein isoform 3                  151   9e-41   
gb|KEH34146.1|  DUF641 family protein                                   151   9e-41   
ref|XP_007146717.1|  hypothetical protein PHAVU_006G063700g             150   1e-40   
ref|XP_003532215.1|  PREDICTED: uncharacterized protein LOC100789256    150   1e-40   
ref|XP_004160182.1|  PREDICTED: uncharacterized LOC101208715            150   1e-40   
ref|XP_004143140.1|  PREDICTED: uncharacterized protein LOC101208715    150   1e-40   
ref|XP_008464068.1|  PREDICTED: uncharacterized protein LOC103502046    151   1e-40   
ref|XP_011032187.1|  PREDICTED: uncharacterized protein LOC105131...    151   1e-40   
ref|XP_011032186.1|  PREDICTED: uncharacterized protein LOC105131...    151   1e-40   
ref|XP_007016205.1|  Uncharacterized protein isoform 2                  150   2e-40   
ref|XP_007016204.1|  Uncharacterized protein isoform 1                  150   2e-40   
ref|XP_010104697.1|  hypothetical protein L484_022081                   151   2e-40   
gb|KGN47111.1|  hypothetical protein Csa_6G188040                       150   3e-40   
gb|KHG27202.1|  Glucose-6-phosphate isomerase                           150   4e-40   
ref|XP_002313401.2|  hypothetical protein POPTR_0009s04570g             150   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010520231.1|  PREDICTED: uncharacterized protein LOC104799408    149   5e-40   
ref|XP_009337383.1|  PREDICTED: uncharacterized protein LOC103929846    147   1e-39   
ref|XP_010043466.1|  PREDICTED: uncharacterized protein LOC104432672    147   2e-39   
ref|XP_008220225.1|  PREDICTED: uncharacterized protein LOC103320331    146   2e-39   
gb|KDO66747.1|  hypothetical protein CISIN_1g009038mg                   147   2e-39   
ref|XP_006424996.1|  hypothetical protein CICLE_v10028137mg             147   2e-39   
ref|XP_007205007.1|  hypothetical protein PRUPE_ppa003623mg             147   3e-39   
ref|XP_006424997.1|  hypothetical protein CICLE_v10028137mg             146   5e-39   
gb|KDO66746.1|  hypothetical protein CISIN_1g009038mg                   146   6e-39   
ref|XP_004500214.1|  PREDICTED: uncharacterized protein LOC101509407    146   6e-39   
ref|XP_006401016.1|  hypothetical protein EUTSA_v10013123mg             146   6e-39   
ref|XP_006488452.1|  PREDICTED: uncharacterized protein LOC102627701    146   6e-39   
ref|XP_008355466.1|  PREDICTED: uncharacterized protein LOC103419119    145   1e-38   
ref|XP_006401017.1|  hypothetical protein EUTSA_v10013123mg             145   1e-38   
ref|XP_009374301.1|  PREDICTED: uncharacterized protein LOC103963237    145   1e-38   
ref|XP_004294251.1|  PREDICTED: uncharacterized protein LOC101292779    145   1e-38   
ref|NP_200704.2|  protein GRAVITROPIC IN THE LIGHT                      144   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008366248.1|  PREDICTED: uncharacterized protein LOC103429898    144   2e-38   
gb|KFK27447.1|  hypothetical protein AALP_AA8G383600                    144   3e-38   
ref|XP_009120406.1|  PREDICTED: uncharacterized protein LOC103845322    144   3e-38   
ref|NP_851217.1|  protein GRAVITROPIC IN THE LIGHT                      144   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55008.1|  BnaA10g29340D                                          144   5e-38   
ref|XP_002864603.1|  hypothetical protein ARALYDRAFT_496019             144   5e-38   
ref|XP_010483510.1|  PREDICTED: uncharacterized protein LOC104761...    144   6e-38   
ref|XP_006281690.1|  hypothetical protein CARUB_v10027838mg             144   6e-38   
ref|XP_010454515.1|  PREDICTED: uncharacterized protein LOC104736254    144   6e-38   
ref|XP_010483511.1|  PREDICTED: uncharacterized protein LOC104761...    144   6e-38   
dbj|BAC43150.1|  unknown protein                                        144   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443646.1|  PREDICTED: uncharacterized protein LOC104726...    143   8e-38   
ref|XP_010443647.1|  PREDICTED: uncharacterized protein LOC104726...    143   8e-38   
emb|CDX80318.1|  BnaC09g34240D                                          142   1e-37   
ref|XP_010262745.1|  PREDICTED: uncharacterized protein LOC104601...    138   6e-36   
ref|XP_010262744.1|  PREDICTED: uncharacterized protein LOC104601...    138   7e-36   
ref|XP_010262743.1|  PREDICTED: uncharacterized protein LOC104601...    138   7e-36   
ref|XP_008785593.1|  PREDICTED: uncharacterized protein LOC103704180    135   2e-35   
ref|XP_006575731.1|  PREDICTED: uncharacterized protein LOC100780566    135   4e-35   
gb|KHN43936.1|  hypothetical protein glysoja_025975                     135   5e-35   
ref|XP_010928935.1|  PREDICTED: uncharacterized protein LOC105050556    134   7e-35   
ref|XP_008798959.1|  PREDICTED: uncharacterized protein LOC103713723    131   9e-34   
ref|XP_010923148.1|  PREDICTED: uncharacterized protein LOC105046293    128   1e-32   
ref|XP_003545078.1|  PREDICTED: uncharacterized protein LOC100808303    125   1e-31   
ref|XP_010685635.1|  PREDICTED: uncharacterized protein LOC104900017    123   1e-30   
ref|XP_009404573.1|  PREDICTED: uncharacterized protein LOC103987859    120   1e-29   
ref|XP_009421307.1|  PREDICTED: uncharacterized protein LOC104000885    120   1e-29   
gb|KHN23806.1|  hypothetical protein glysoja_028099                     119   3e-29   
ref|XP_002994075.1|  hypothetical protein SELMODRAFT_138138             110   2e-26   
ref|XP_002989113.1|  hypothetical protein SELMODRAFT_184343             110   3e-26   
ref|XP_002971576.1|  hypothetical protein SELMODRAFT_412400             110   5e-26   
ref|XP_002963441.1|  hypothetical protein SELMODRAFT_405308             110   6e-26   
ref|XP_004981210.1|  PREDICTED: uncharacterized protein LOC101782802    100   3e-22   
ref|XP_003559229.1|  PREDICTED: uncharacterized protein LOC100834963  97.4    3e-21   
ref|XP_002463607.1|  hypothetical protein SORBIDRAFT_01g002820        97.1    3e-21   Sorghum bicolor [broomcorn]
ref|XP_006848077.1|  hypothetical protein AMTR_s00029p00203020        94.7    4e-21   
ref|XP_006651976.1|  PREDICTED: uncharacterized protein LOC102716772  95.5    4e-21   
ref|NP_001051757.1|  Os03g0825600                                     94.4    8e-21   Oryza sativa Japonica Group [Japonica rice]
gb|ADE77125.1|  unknown                                               92.8    1e-20   
gb|AAK82451.1|AC091247_18  hypothetical protein                       94.4    3e-20   Oryza sativa [red rice]
gb|EAY92405.1|  hypothetical protein OsI_14140                        94.4    4e-20   Oryza sativa Indica Group [Indian rice]
gb|EMS66513.1|  hypothetical protein TRIUR3_11999                     80.5    1e-16   
ref|XP_002511684.1|  conserved hypothetical protein                   73.2    1e-12   Ricinus communis
ref|XP_006397703.1|  hypothetical protein EUTSA_v10001462mg           72.8    1e-12   
ref|XP_011098209.1|  PREDICTED: uncharacterized protein LOC105176928  72.8    2e-12   
emb|CDY68486.1|  BnaAnng27430D                                        72.4    2e-12   
ref|XP_006295880.1|  hypothetical protein CARUB_v10025010mg           71.6    3e-12   
gb|KEH29107.1|  DUF641 family protein                                 71.2    5e-12   
ref|XP_010508197.1|  PREDICTED: uncharacterized protein LOC104784808  70.9    6e-12   
ref|NP_182051.1|  uncharacterized protein                             70.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006843716.1|  hypothetical protein AMTR_s00007p00217240        70.9    8e-12   
ref|XP_010506463.1|  PREDICTED: uncharacterized protein LOC104783076  70.5    9e-12   
ref|XP_010518141.1|  PREDICTED: uncharacterized protein LOC104793483  70.5    9e-12   
ref|XP_007134841.1|  hypothetical protein PHAVU_010G080800g           70.5    1e-11   
gb|KDP28775.1|  hypothetical protein JCGZ_14546                       70.1    1e-11   
ref|XP_009143107.1|  PREDICTED: uncharacterized protein LOC103866868  70.1    1e-11   
ref|XP_004133925.1|  PREDICTED: uncharacterized protein LOC101216...  69.7    2e-11   
ref|XP_008438186.1|  PREDICTED: uncharacterized protein LOC103483367  68.9    3e-11   
ref|XP_002302528.1|  hypothetical protein POPTR_0002s14690g           68.9    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011017476.1|  PREDICTED: uncharacterized protein LOC105120794  68.9    3e-11   
gb|EMT11412.1|  hypothetical protein F775_30433                       68.6    4e-11   
emb|CDP06027.1|  unnamed protein product                              68.6    4e-11   
ref|XP_009382347.1|  PREDICTED: uncharacterized protein LOC103970336  68.6    4e-11   
gb|EMT23131.1|  hypothetical protein F775_07460                       68.2    5e-11   
ref|XP_009133719.1|  PREDICTED: uncharacterized protein LOC103858169  68.2    5e-11   
ref|XP_006573422.1|  PREDICTED: uncharacterized protein LOC100786...  68.2    5e-11   
ref|NP_001276243.1|  uncharacterized protein LOC100786595             68.2    5e-11   
ref|XP_003571690.1|  PREDICTED: uncharacterized protein LOC100825831  68.2    6e-11   
ref|XP_011093364.1|  PREDICTED: uncharacterized protein LOC105173356  67.8    7e-11   
ref|XP_010544636.1|  PREDICTED: uncharacterized protein LOC104817236  67.8    8e-11   
ref|XP_002442653.1|  hypothetical protein SORBIDRAFT_08g000530        67.0    1e-10   Sorghum bicolor [broomcorn]
ref|XP_009413741.1|  PREDICTED: uncharacterized protein LOC103994983  67.0    1e-10   
ref|XP_008343220.1|  PREDICTED: uncharacterized protein LOC103405967  67.0    1e-10   
emb|CDX95643.1|  BnaC03g25240D                                        67.0    1e-10   
ref|XP_003521912.1|  PREDICTED: uncharacterized protein LOC100499...  67.0    2e-10   
ref|XP_002450101.1|  hypothetical protein SORBIDRAFT_05g000500        66.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_010045152.1|  PREDICTED: uncharacterized protein LOC104433931  66.2    2e-10   
ref|XP_007220394.1|  hypothetical protein PRUPE_ppa006268mg           66.2    3e-10   
ref|XP_010934058.1|  PREDICTED: uncharacterized protein LOC105054...  66.2    3e-10   
ref|XP_010934060.1|  PREDICTED: uncharacterized protein LOC105054...  66.6    3e-10   
ref|XP_009768260.1|  PREDICTED: uncharacterized protein LOC104219299  66.2    3e-10   
ref|XP_009628687.1|  PREDICTED: uncharacterized protein LOC104119006  66.2    3e-10   
ref|XP_007052097.1|  Uncharacterized protein isoform 1                65.9    3e-10   
ref|XP_004983065.1|  PREDICTED: uncharacterized protein LOC101771337  65.9    3e-10   
ref|XP_009368411.1|  PREDICTED: uncharacterized protein LOC103957913  65.9    4e-10   
gb|KDO85778.1|  hypothetical protein CISIN_1g014602mg                 65.9    4e-10   
ref|XP_006445290.1|  hypothetical protein CICLE_v10023651mg           65.9    4e-10   
ref|XP_004499498.1|  PREDICTED: uncharacterized protein LOC101497862  65.5    4e-10   
dbj|BAK01990.1|  predicted protein                                    65.5    5e-10   
ref|XP_010248387.1|  PREDICTED: uncharacterized protein LOC104591282  65.5    5e-10   
ref|NP_001064481.1|  Os10g0378400                                     64.7    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661727.1|  PREDICTED: uncharacterized protein LOC102702783  65.5    6e-10   
gb|EAZ15895.1|  hypothetical protein OsJ_31316                        65.1    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002280629.1|  PREDICTED: uncharacterized protein LOC100250526  65.1    7e-10   Vitis vinifera
gb|EPS72619.1|  hypothetical protein M569_02135                       65.1    7e-10   
gb|EAY78276.1|  hypothetical protein OsI_33323                        65.1    7e-10   Oryza sativa Indica Group [Indian rice]
gb|EMS65095.1|  hypothetical protein TRIUR3_07411                     64.7    7e-10   
ref|XP_010692209.1|  PREDICTED: uncharacterized protein LOC104905379  65.1    7e-10   
gb|ABB47396.1|  expressed protein                                     65.1    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004306937.1|  PREDICTED: uncharacterized protein LOC101299519  65.1    7e-10   
ref|NP_001170462.1|  putative domain of unknown function (DUF641)...  65.1    8e-10   Zea mays [maize]
gb|KHG01819.1|  Myosin-4                                              65.1    8e-10   
ref|XP_010264192.1|  PREDICTED: uncharacterized protein LOC104602268  64.7    8e-10   
gb|KHG30155.1|  Myosin-4                                              64.7    1e-09   
emb|CDO97711.1|  unnamed protein product                              64.3    1e-09   
ref|XP_010559109.1|  PREDICTED: uncharacterized protein LOC104827613  64.3    1e-09   
ref|XP_008783573.1|  PREDICTED: uncharacterized protein LOC103702...  63.5    2e-09   
ref|XP_008372718.1|  PREDICTED: uncharacterized protein LOC103436085  63.9    2e-09   
ref|NP_001144371.1|  uncharacterized protein LOC100277294             63.9    2e-09   Zea mays [maize]
gb|EYU30553.1|  hypothetical protein MIMGU_mgv1a007035mg              63.5    3e-09   
ref|XP_008783571.1|  PREDICTED: uncharacterized protein LOC103702...  63.5    3e-09   
ref|NP_001142801.1|  uncharacterized protein LOC100275178             63.5    3e-09   Zea mays [maize]
ref|XP_008783568.1|  PREDICTED: uncharacterized protein LOC103702...  63.5    3e-09   
ref|XP_006348318.1|  PREDICTED: uncharacterized protein LOC102583964  62.4    7e-09   
ref|XP_009387295.1|  PREDICTED: uncharacterized protein LOC103974246  62.0    9e-09   
ref|XP_010919052.1|  PREDICTED: uncharacterized protein LOC105043...  62.0    9e-09   
ref|XP_010919051.1|  PREDICTED: uncharacterized protein LOC105043...  62.0    9e-09   
ref|XP_008644723.1|  PREDICTED: uncharacterized protein LOC103626121  61.6    1e-08   
ref|XP_009384547.1|  PREDICTED: uncharacterized protein LOC103972078  61.2    2e-08   
ref|XP_009768100.1|  PREDICTED: uncharacterized protein LOC104219165  61.2    2e-08   
ref|XP_011082774.1|  PREDICTED: uncharacterized protein LOC105165456  60.8    2e-08   
ref|XP_010110261.1|  hypothetical protein L484_001403                 60.8    2e-08   
gb|KFK44760.1|  hypothetical protein AALP_AA1G299400                  60.5    3e-08   
ref|XP_003517960.1|  PREDICTED: uncharacterized protein LOC100783971  60.5    3e-08   
ref|XP_002268081.1|  PREDICTED: uncharacterized protein LOC100259946  60.1    5e-08   Vitis vinifera
ref|XP_007140797.1|  hypothetical protein PHAVU_008G143000g           60.1    5e-08   
ref|XP_010098933.1|  hypothetical protein L484_025589                 59.7    5e-08   
ref|XP_011101433.1|  PREDICTED: uncharacterized protein LOC105179489  59.7    5e-08   
dbj|BAJ90506.1|  predicted protein                                    59.7    5e-08   
ref|XP_004489014.1|  PREDICTED: uncharacterized protein LOC101493041  59.7    6e-08   
emb|CDX74719.1|  BnaA05g04650D                                        59.3    6e-08   
ref|XP_008784637.1|  PREDICTED: uncharacterized protein LOC103703536  59.7    6e-08   
ref|XP_004244284.1|  PREDICTED: uncharacterized protein LOC101246157  59.7    6e-08   
ref|XP_004233052.1|  PREDICTED: uncharacterized protein LOC101250471  59.7    6e-08   
ref|XP_004982657.1|  PREDICTED: uncharacterized protein LOC101783619  59.7    6e-08   
ref|XP_003539136.1|  PREDICTED: uncharacterized protein LOC100796904  59.3    7e-08   
ref|XP_010919476.1|  PREDICTED: uncharacterized protein LOC105043593  59.3    8e-08   
ref|XP_004514207.1|  PREDICTED: uncharacterized protein LOC101508636  58.9    9e-08   
ref|XP_009602869.1|  PREDICTED: uncharacterized protein LOC104097...  58.9    1e-07   
ref|XP_009602868.1|  PREDICTED: uncharacterized protein LOC104097...  58.9    1e-07   
ref|XP_006358102.1|  PREDICTED: uncharacterized protein LOC102597251  58.5    1e-07   
ref|XP_002466967.1|  hypothetical protein SORBIDRAFT_01g017570        57.8    2e-07   Sorghum bicolor [broomcorn]
gb|EEE51244.1|  hypothetical protein OsJ_32107                        57.4    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142802.1|  putative domain of unknown function (DUF641)...  57.4    3e-07   Zea mays [maize]
ref|NP_001065020.1|  Os10g0508100                                     57.4    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010933714.1|  PREDICTED: uncharacterized protein LOC105054035  57.4    4e-07   
ref|XP_006375307.1|  hypothetical protein POPTR_0014s06310g           56.6    4e-07   
gb|AFK34989.1|  unknown                                               54.7    4e-07   
ref|XP_003574169.1|  PREDICTED: uncharacterized protein LOC100822255  57.0    4e-07   
gb|EPS62483.1|  hypothetical protein M569_12310                       57.0    4e-07   
emb|CDX71143.1|  BnaC03g12270D                                        53.1    5e-07   
ref|XP_011042511.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    6e-07   
ref|XP_010675324.1|  PREDICTED: uncharacterized protein LOC104891341  56.6    7e-07   
ref|XP_004229800.1|  PREDICTED: uncharacterized protein LOC101248815  56.2    7e-07   
gb|EYU28117.1|  hypothetical protein MIMGU_mgv1a018759mg              56.2    8e-07   
gb|KEH16455.1|  DUF641 family protein                                 56.2    9e-07   
ref|XP_010686249.1|  PREDICTED: uncharacterized protein LOC104900521  55.8    1e-06   
ref|XP_007149567.1|  hypothetical protein PHAVU_005G081200g           55.8    1e-06   
ref|XP_002320047.2|  hypothetical protein POPTR_0014s06200g           55.8    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_006347884.1|  PREDICTED: uncharacterized protein LOC102602829  55.5    1e-06   
ref|XP_011044059.1|  PREDICTED: uncharacterized protein LOC105139355  55.5    1e-06   
ref|XP_006661935.1|  PREDICTED: uncharacterized protein LOC102720079  54.3    2e-06   
ref|XP_009802869.1|  PREDICTED: uncharacterized protein LOC104248328  55.1    2e-06   
ref|XP_009778115.1|  PREDICTED: uncharacterized protein LOC104227550  55.1    2e-06   
gb|ACD56637.1|  UNE1-like protein                                     55.1    2e-06   Gossypioides kirkii
ref|XP_003540495.1|  PREDICTED: uncharacterized protein LOC100810236  55.1    2e-06   
gb|EAY79156.1|  hypothetical protein OsI_34263                        53.5    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_011085321.1|  PREDICTED: uncharacterized protein LOC105167345  54.7    3e-06   
ref|XP_003543203.1|  PREDICTED: uncharacterized protein LOC100799...  54.3    3e-06   
gb|KHN36898.1|  hypothetical protein glysoja_001629                   54.3    4e-06   
gb|EMS57586.1|  hypothetical protein TRIUR3_32464                     52.4    4e-06   
ref|XP_001765797.1|  predicted protein                                54.7    4e-06   
ref|XP_010242144.1|  PREDICTED: uncharacterized protein LOC104586564  53.9    5e-06   
ref|XP_010692185.1|  PREDICTED: uncharacterized protein LOC104905361  53.9    5e-06   
ref|XP_009624609.1|  PREDICTED: uncharacterized protein LOC104115636  53.9    5e-06   
ref|XP_008458139.1|  PREDICTED: uncharacterized protein LOC103497664  53.9    5e-06   
ref|XP_002882003.1|  hypothetical protein ARALYDRAFT_483660           53.1    5e-06   
gb|KEH19456.1|  UNE1-like protein                                     53.5    6e-06   
ref|XP_004140484.1|  PREDICTED: uncharacterized protein LOC101203555  53.5    6e-06   
ref|XP_006582118.1|  PREDICTED: uncharacterized protein LOC100818...  53.5    6e-06   
ref|XP_008451753.1|  PREDICTED: uncharacterized protein LOC103492...  53.5    6e-06   
gb|KHN46680.1|  hypothetical protein glysoja_045156                   53.5    6e-06   
ref|XP_008451754.1|  PREDICTED: uncharacterized protein LOC103492...  53.5    6e-06   
gb|KEH19457.1|  UNE1-like protein                                     53.5    6e-06   
ref|XP_010644820.1|  PREDICTED: uncharacterized protein LOC104877723  51.6    7e-06   
ref|NP_195134.2|  uncharacterized protein                             52.8    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524529.1|  conserved hypothetical protein                   53.5    7e-06   Ricinus communis
ref|XP_002316851.2|  hypothetical protein POPTR_0011s10930g           53.1    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_011080731.1|  PREDICTED: uncharacterized protein LOC105163904  52.8    1e-05   
ref|XP_007021901.1|  Uncharacterized protein isoform 1                52.8    1e-05   
gb|ACD56624.1|  UNE1-like protein                                     53.1    1e-05   Gossypium raimondii
ref|XP_007021903.1|  Uncharacterized protein isoform 3                52.8    1e-05   
gb|KHN06422.1|  hypothetical protein glysoja_010766                   52.8    1e-05   
ref|XP_004514642.1|  PREDICTED: uncharacterized protein LOC101511...  52.8    1e-05   
ref|XP_010106617.1|  hypothetical protein L484_004846                 52.8    1e-05   
emb|CDY41148.1|  BnaA09g38670D                                        52.8    1e-05   
ref|XP_011017467.1|  PREDICTED: uncharacterized protein LOC105120787  52.8    1e-05   
emb|CDX71790.1|  BnaC08g30840D                                        52.8    1e-05   
gb|KDP21137.1|  hypothetical protein JCGZ_21608                       52.8    1e-05   
ref|XP_008386266.1|  PREDICTED: uncharacterized protein LOC103448779  52.8    1e-05   
emb|CDY25713.1|  BnaC03g69620D                                        52.0    1e-05   
emb|CAN72546.1|  hypothetical protein VITISV_013476                   52.4    1e-05   Vitis vinifera
ref|XP_011033928.1|  PREDICTED: uncharacterized protein LOC105132...  52.4    2e-05   
ref|XP_009795510.1|  PREDICTED: uncharacterized protein LOC104242184  52.4    2e-05   
ref|XP_002285510.1|  PREDICTED: uncharacterized protein LOC100255640  52.4    2e-05   Vitis vinifera
ref|XP_011033920.1|  PREDICTED: uncharacterized protein LOC105132...  52.4    2e-05   
emb|CDX88677.1|  BnaA03g09720D                                        48.5    2e-05   
ref|XP_006592534.1|  PREDICTED: uncharacterized protein LOC100795...  52.4    2e-05   
ref|XP_009342903.1|  PREDICTED: uncharacterized protein LOC103934...  52.4    2e-05   
ref|XP_009342900.1|  PREDICTED: uncharacterized protein LOC103934...  52.4    2e-05   
ref|XP_009106974.1|  PREDICTED: uncharacterized protein LOC103832...  51.2    2e-05   
ref|XP_009106973.1|  PREDICTED: uncharacterized protein LOC103832...  51.6    2e-05   
ref|XP_008439717.1|  PREDICTED: uncharacterized protein LOC103484433  52.0    2e-05   
ref|XP_002522256.1|  conserved hypothetical protein                   51.6    3e-05   Ricinus communis
ref|XP_009375771.1|  PREDICTED: uncharacterized protein LOC103964550  52.0    3e-05   
ref|XP_010487299.1|  PREDICTED: uncharacterized protein LOC104765...  51.6    3e-05   
ref|XP_002301271.2|  hypothetical protein POPTR_0002s14580g           51.6    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010487300.1|  PREDICTED: uncharacterized protein LOC104765...  51.6    3e-05   
ref|XP_008463757.1|  PREDICTED: uncharacterized protein LOC103501824  51.6    3e-05   
ref|NP_191627.1|  uncharacterized protein                             51.6    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549422.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.6    3e-05   
ref|XP_007025306.1|  Intracellular protein transport protein USO1...  51.6    3e-05   
ref|XP_004134600.1|  PREDICTED: uncharacterized protein LOC101220727  51.2    3e-05   
ref|XP_006297626.1|  hypothetical protein CARUB_v10013646mg           51.2    3e-05   
ref|XP_008232636.1|  PREDICTED: uncharacterized protein LOC103331764  51.2    4e-05   
ref|XP_006297627.1|  hypothetical protein CARUB_v10013646mg           51.2    4e-05   
ref|XP_010552126.1|  PREDICTED: uncharacterized protein LOC104822570  51.2    4e-05   
ref|XP_007133271.1|  hypothetical protein PHAVU_011G165700g           51.2    4e-05   
ref|XP_010465406.1|  PREDICTED: uncharacterized protein LOC104745...  51.2    4e-05   
ref|XP_010465405.1|  PREDICTED: uncharacterized protein LOC104745...  51.2    4e-05   
emb|CBI30722.3|  unnamed protein product                              51.2    4e-05   
ref|XP_003524973.1|  PREDICTED: uncharacterized protein LOC100795349  51.2    4e-05   
emb|CDP19941.1|  unnamed protein product                              51.2    4e-05   
ref|XP_002876575.1|  hypothetical protein ARALYDRAFT_907600           50.8    5e-05   
ref|XP_008796842.1|  PREDICTED: uncharacterized protein LOC103712172  50.8    5e-05   
ref|XP_004137232.1|  PREDICTED: uncharacterized protein LOC101210747  50.4    6e-05   
ref|XP_010512402.1|  PREDICTED: uncharacterized protein LOC104788347  50.4    6e-05   
gb|KGN53571.1|  hypothetical protein Csa_4G082970                     50.4    6e-05   
ref|XP_008363167.1|  PREDICTED: uncharacterized protein LOC103426866  50.4    8e-05   
emb|CDP04056.1|  unnamed protein product                              50.4    8e-05   
emb|CDO96860.1|  unnamed protein product                              50.1    1e-04   
ref|XP_009590394.1|  PREDICTED: uncharacterized protein LOC104087586  50.1    1e-04   
ref|XP_011033907.1|  PREDICTED: uncharacterized protein LOC105132239  50.1    1e-04   
ref|XP_011002750.1|  PREDICTED: uncharacterized protein LOC105109671  50.1    1e-04   
gb|EYU43307.1|  hypothetical protein MIMGU_mgv1a025736mg              49.7    1e-04   
ref|XP_006345518.1|  PREDICTED: uncharacterized protein LOC102589527  50.1    1e-04   
gb|ACU19196.1|  unknown                                               49.7    1e-04   
ref|XP_006415589.1|  hypothetical protein EUTSA_v10007535mg           49.7    1e-04   
gb|KDP46027.1|  hypothetical protein JCGZ_13473                       49.7    1e-04   
ref|XP_006370113.1|  hypothetical protein POPTR_0001s39610g           49.7    1e-04   
ref|XP_002511671.1|  conserved hypothetical protein                   49.3    2e-04   
ref|XP_003629834.1|  hypothetical protein MTR_8g087400                49.3    2e-04   
ref|XP_003606733.1|  UNE1-like protein                                49.3    2e-04   
gb|AET04310.2|  UNE1-like protein                                     49.3    2e-04   
ref|XP_009334027.1|  PREDICTED: uncharacterized protein LOC103926871  49.3    2e-04   
ref|XP_001758024.1|  predicted protein                                49.7    2e-04   
ref|XP_007159484.1|  hypothetical protein PHAVU_002G241300g           49.3    2e-04   
ref|XP_003532763.1|  PREDICTED: uncharacterized protein LOC100791207  49.3    2e-04   
gb|KHN48018.1|  hypothetical protein glysoja_015488                   49.3    2e-04   
emb|CDY02506.1|  BnaA08g01130D                                        48.5    2e-04   
ref|XP_003596322.1|  hypothetical protein MTR_2g075910                48.9    2e-04   
ref|XP_008368804.1|  PREDICTED: uncharacterized protein LOC103432396  48.9    2e-04   
gb|EPS61202.1|  hypothetical protein M569_13597                       48.9    2e-04   
ref|XP_009403501.1|  PREDICTED: uncharacterized protein LOC103987041  48.9    2e-04   
ref|XP_007212024.1|  hypothetical protein PRUPE_ppa004948mg           48.9    2e-04   
ref|XP_008225230.1|  PREDICTED: uncharacterized protein LOC103324897  48.5    3e-04   
ref|XP_009346563.1|  PREDICTED: uncharacterized protein LOC103938284  48.9    3e-04   
ref|XP_007212832.1|  hypothetical protein PRUPE_ppa020743mg           48.5    3e-04   
ref|XP_008226390.1|  PREDICTED: uncharacterized protein LOC103325972  48.5    3e-04   
ref|XP_011090385.1|  PREDICTED: uncharacterized protein LOC105171071  48.5    3e-04   
ref|XP_001765841.1|  predicted protein                                48.9    3e-04   
ref|XP_006402555.1|  hypothetical protein EUTSA_v10005850mg           48.5    3e-04   
emb|CDX77580.1|  BnaA07g07180D                                        48.1    3e-04   
ref|XP_009794206.1|  PREDICTED: uncharacterized protein LOC104241004  48.5    3e-04   
ref|XP_009135403.1|  PREDICTED: uncharacterized protein LOC103859596  48.5    3e-04   
ref|XP_004146088.1|  PREDICTED: uncharacterized protein LOC101223201  48.5    3e-04   
ref|XP_007052116.1|  Uncharacterized protein TCM_005551               48.5    3e-04   
ref|XP_010056344.1|  PREDICTED: uncharacterized protein LOC104444386  48.5    4e-04   
ref|XP_010538219.1|  PREDICTED: uncharacterized protein LOC104812644  48.1    4e-04   
ref|XP_009596633.1|  PREDICTED: uncharacterized protein LOC104092680  48.1    4e-04   
ref|XP_002882898.1|  hypothetical protein ARALYDRAFT_478905           48.1    4e-04   
ref|XP_010502231.1|  PREDICTED: uncharacterized protein LOC104779...  48.1    4e-04   
ref|XP_010502239.1|  PREDICTED: uncharacterized protein LOC104779...  48.1    4e-04   
ref|XP_007219494.1|  hypothetical protein PRUPE_ppa022267mg           48.1    5e-04   
ref|XP_011015929.1|  PREDICTED: uncharacterized protein LOC105119481  47.8    5e-04   
ref|XP_008232593.1|  PREDICTED: uncharacterized protein LOC103331725  48.1    5e-04   
ref|XP_004293973.1|  PREDICTED: uncharacterized protein LOC101303973  47.8    5e-04   
gb|EYU45677.1|  hypothetical protein MIMGU_mgv1a006616mg              47.8    5e-04   
gb|KFK35269.1|  hypothetical protein AALP_AA5G263300                  47.8    5e-04   
ref|XP_010259024.1|  PREDICTED: uncharacterized protein LOC104598580  47.8    5e-04   
ref|XP_004490710.1|  PREDICTED: uncharacterized protein LOC101490225  47.8    5e-04   
ref|XP_004296023.1|  PREDICTED: uncharacterized protein LOC101305254  47.8    5e-04   
emb|CDY62077.1|  BnaC06g41500D                                        47.8    5e-04   
ref|NP_001030696.1|  uncharacterized protein                          47.8    6e-04   
ref|NP_188105.3|  uncharacterized protein                             47.8    6e-04   
ref|NP_001030697.1|  uncharacterized protein                          47.8    6e-04   
emb|CDY63208.1|  BnaC03g76000D                                        47.8    6e-04   
gb|KDO85744.1|  hypothetical protein CISIN_1g040591mg                 47.8    6e-04   
ref|XP_006445303.1|  hypothetical protein CICLE_v10019751mg           47.8    6e-04   
ref|XP_010264213.1|  PREDICTED: uncharacterized protein LOC104602292  47.8    7e-04   
ref|XP_004240051.1|  PREDICTED: uncharacterized protein LOC101266639  47.4    7e-04   
ref|XP_009352725.1|  PREDICTED: uncharacterized protein LOC103944056  47.4    7e-04   
ref|XP_001752778.1|  predicted protein                                47.4    0.001   



>ref|XP_009617780.1| PREDICTED: uncharacterized protein LOC104110064 [Nicotiana tomentosiformis]
Length=480

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S     TA   V G NHAK+ALESYVNRKMFQGFD+ETFYMD   +SL+HP
Sbjct  260  AVRSIEAASSNTNTPTADSIV-GANHAKYALESYVNRKMFQGFDHETFYMDGSLSSLIHP  318

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +QHRRDCF QYRDMKA+DP+ELLGILPTCSFGNFCFKK+L +VHPKMEESL
Sbjct  319  DQHRRDCFTQYRDMKAMDPMELLGILPTCSFGNFCFKKYLAIVHPKMEESL  369



>ref|XP_004232545.1| PREDICTED: uncharacterized protein LOC101250947 [Solanum lycopersicum]
Length=476

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S +   TA   V G NHAK+ALESYVNRKMFQGFD+ETFYMD   +SLLHP
Sbjct  256  AVRSIEAASSNSTTPTADSIV-GANHAKYALESYVNRKMFQGFDHETFYMDGSLSSLLHP  314

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +QHRR+C+ QYRDMKA+DP+ELLGILPTCSFGNFCFKK+L +VHPKMEESL
Sbjct  315  DQHRRECYTQYRDMKAMDPMELLGILPTCSFGNFCFKKYLAIVHPKMEESL  365



>ref|XP_006340808.1| PREDICTED: uncharacterized protein LOC102585334 [Solanum tuberosum]
Length=479

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S +   TA   V G NHAK+ALESYVNRKMFQGFD+ETFYMD   +SLLHP
Sbjct  259  AVRSIEAASSNSTTPTADSIV-GANHAKYALESYVNRKMFQGFDHETFYMDGSLSSLLHP  317

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +QHRR+C+ QYRDMKA+DP+ELLGILPTCSFGNFCFKK+L +VHPKMEESL
Sbjct  318  DQHRRECYTQYRDMKAMDPMELLGILPTCSFGNFCFKKYLAIVHPKMEESL  368



>emb|CDP09140.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
            G NHAK+ALESYVNRKMFQGFD+ETFYMD   +SL+HP+QHRRDCF QYRDMKA+DP+EL
Sbjct  315  GANHAKYALESYVNRKMFQGFDHETFYMDGSLSSLIHPDQHRRDCFTQYRDMKAMDPIEL  374

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LGILPTCSFGNFCFKK+L +VHPKMEESL
Sbjct  375  LGILPTCSFGNFCFKKYLAIVHPKMEESL  403



>ref|XP_009791934.1| PREDICTED: uncharacterized protein LOC104239101 [Nicotiana sylvestris]
Length=480

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S     TA   V G NHAK+ALESYVN KMFQGFD+ETFY+D   +SLLHP
Sbjct  260  AVRSIEAASSNTNTPTADSIV-GSNHAKYALESYVNHKMFQGFDHETFYLDGSLSSLLHP  318

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +QHRRDCF QYRDMKA+DP+ELLGILPTCSFGNFCFKK+L +VHPKMEESL
Sbjct  319  DQHRRDCFTQYRDMKAMDPMELLGILPTCSFGNFCFKKYLAIVHPKMEESL  369



>gb|EYU38462.1| hypothetical protein MIMGU_mgv1a005921mg [Erythranthe guttata]
Length=464

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvG---INHAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA STA + TA     G    NHAK+ALESYVNRK+FQGFD+ETFYMD   +S+
Sbjct  249  AVRSIEAASSTAASFTATSFTGGDSLTNHAKYALESYVNRKIFQGFDHETFYMDGSLSSI  308

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LHP+QHR DCF QYRDMKA+DP ELLGILP+C FGNFCFKK+L +VHPKMEESL
Sbjct  309  LHPDQHRTDCFTQYRDMKAMDPAELLGILPSCGFGNFCFKKYLAVVHPKMEESL  362



>gb|EPS73426.1| hypothetical protein M569_01325 [Genlisea aurea]
Length=531

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +2

Query  2    AVRSIEaahstav-aataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLH  178
            AVRSIEAA S        A   +G NHA++ALESYVNRK+F GFD+ETFYMD   +S+LH
Sbjct  315  AVRSIEAASSAVNFNPYPAALTLGANHARYALESYVNRKIFLGFDHETFYMDGSLSSILH  374

Query  179  PEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            P+QHRRDCF QYRDMKA+DP+ELLGILPTC+FGNFCFKK+L++VHPKMEESL
Sbjct  375  PDQHRRDCFTQYRDMKAMDPIELLGILPTCAFGNFCFKKYLSIVHPKMEESL  426



>ref|XP_011080844.1| PREDICTED: uncharacterized protein LOC105164004 [Sesamum indicum]
Length=557

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
            G NHAK+ALESYV+RK++QGFD+ETFYMD   +S+LHP+QHRRDCF QYRDMKA+DP+EL
Sbjct  366  GGNHAKYALESYVSRKIYQGFDHETFYMDGSLSSILHPDQHRRDCFTQYRDMKAMDPIEL  425

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L ILPTCSFGNFCFKK+L++VHPKMEESL
Sbjct  426  LSILPTCSFGNFCFKKYLSIVHPKMEESL  454



>emb|CBI16015.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   157 bits (398),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
            G +HAK+ALESYV RK+FQGFD+ETFYMD   +SLLHP+Q+RRDCFAQYRDMKA+DPVEL
Sbjct  196  GSHHAKYALESYVCRKIFQGFDHETFYMDGSLSSLLHPDQYRRDCFAQYRDMKAMDPVEL  255

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LGILPTC FG FC KK+L +VHPKMEESL
Sbjct  256  LGILPTCHFGKFCTKKYLAIVHPKMEESL  284



>ref|XP_010650952.1| PREDICTED: uncharacterized protein LOC100265690 [Vitis vinifera]
Length=544

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
            G +HAK+ALESYV RK+FQGFD+ETFYMD   +SLLHP+Q+RRDCFAQYRDMKA+DPVEL
Sbjct  352  GSHHAKYALESYVCRKIFQGFDHETFYMDGSLSSLLHPDQYRRDCFAQYRDMKAMDPVEL  411

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LGILPTC FG FC KK+L +VHPKMEESL
Sbjct  412  LGILPTCHFGKFCTKKYLAIVHPKMEESL  440



>ref|XP_002520441.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41854.1| conserved hypothetical protein [Ricinus communis]
Length=412

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI--NHAKFALESYVNRKMFQGFDNETFYMDSRYASLL  175
            AVRSIEAA +T            I  +HAK+ALESY++RK+FQGFD+ETFYMD   +SLL
Sbjct  196  AVRSIEAAAATNNNINTTAIASTIITHHAKYALESYISRKIFQGFDHETFYMDGSLSSLL  255

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+Q RRDCF QYRDMKA+DPVELLGILPTC FG FCFKK++ +VHPKMEESL
Sbjct  256  NPDQFRRDCFTQYRDMKAMDPVELLGILPTCHFGKFCFKKYVAIVHPKMEESL  308



>gb|KHN01792.1| hypothetical protein glysoja_028464 [Glycine soja]
Length=259

 Score =   149 bits (377),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI---NHAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA ++        S   I   +HAK+AL+SY++RK+FQGFD+ETFYMD   +SL
Sbjct  42   AVRSIEAATASTDKFHNTSSTTSIVSAHHAKYALDSYISRKIFQGFDHETFYMDGSLSSL  101

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+P+Q RRDCF QYRDMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  102  LNPDQFRRDCFTQYRDMKSMDPTELLGILPTCHFGKFCSKKYLAIVHPKMEESL  155



>ref|XP_010262742.1| PREDICTED: uncharacterized protein LOC104601190 isoform X2 [Nelumbo 
nucifera]
Length=542

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE A +         ++V  +HAK+ALESYV RK+F GFD+ETFYMD   +SL+HP
Sbjct  328  AVRSIEVATNPNAIEDHTTAIVEAHHAKYALESYVCRKIFHGFDHETFYMDGSLSSLIHP  387

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCFAQ+RDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  388  EQFRRDCFAQFRDMKAMDPTELLGILPTCPFGKFCSKKYLSIVHPKMEESL  438



>ref|XP_010262741.1| PREDICTED: uncharacterized protein LOC104601190 isoform X1 [Nelumbo 
nucifera]
Length=544

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE A +         ++V  +HAK+ALESYV RK+F GFD+ETFYMD   +SL+HP
Sbjct  330  AVRSIEVATNPNAIEDHTTAIVEAHHAKYALESYVCRKIFHGFDHETFYMDGSLSSLIHP  389

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCFAQ+RDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  390  EQFRRDCFAQFRDMKAMDPTELLGILPTCPFGKFCSKKYLSIVHPKMEESL  440



>gb|KDP46563.1| hypothetical protein JCGZ_08535 [Jatropha curcas]
Length=499

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HAK+A+ESY++RK+FQGFD+ETFYMD   +SLL+P+Q RRDCFAQYRDMK +DPVELLG
Sbjct  309  HHAKYAVESYISRKIFQGFDHETFYMDGSLSSLLNPDQFRRDCFAQYRDMKGMDPVELLG  368

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FCFKK++ +VHPKMEESL
Sbjct  369  ILPTCHFGKFCFKKYVAIVHPKMEESL  395



>ref|XP_010256702.1| PREDICTED: uncharacterized protein LOC104597022 isoform X4 [Nelumbo 
nucifera]
Length=467

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA +         ++VG +HAK+ LESYV RK+F GFDNETFYMD   +SLL+P
Sbjct  254  AVRSIEAATNPNAIEDRTSAIVGAHHAKYVLESYVCRKIFHGFDNETFYMDGSLSSLLNP  313

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF+Q+RDMKA+DP ELLGILPTC FG FC KK+L++VH KMEESL
Sbjct  314  EQFRRDCFSQFRDMKAMDPAELLGILPTCQFGKFCSKKYLSIVHSKMEESL  364



>ref|XP_010256700.1| PREDICTED: uncharacterized protein LOC104597022 isoform X2 [Nelumbo 
nucifera]
Length=542

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA +         ++VG +HAK+ LESYV RK+F GFDNETFYMD   +SLL+P
Sbjct  329  AVRSIEAATNPNAIEDRTSAIVGAHHAKYVLESYVCRKIFHGFDNETFYMDGSLSSLLNP  388

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF+Q+RDMKA+DP ELLGILPTC FG FC KK+L++VH KMEESL
Sbjct  389  EQFRRDCFSQFRDMKAMDPAELLGILPTCQFGKFCSKKYLSIVHSKMEESL  439



>ref|XP_010256701.1| PREDICTED: uncharacterized protein LOC104597022 isoform X3 [Nelumbo 
nucifera]
Length=540

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA +         ++VG +HAK+ LESYV RK+F GFDNETFYMD   +SLL+P
Sbjct  327  AVRSIEAATNPNAIEDRTSAIVGAHHAKYVLESYVCRKIFHGFDNETFYMDGSLSSLLNP  386

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF+Q+RDMKA+DP ELLGILPTC FG FC KK+L++VH KMEESL
Sbjct  387  EQFRRDCFSQFRDMKAMDPAELLGILPTCQFGKFCSKKYLSIVHSKMEESL  437



>gb|KHN06269.1| hypothetical protein glysoja_030335 [Glycine soja]
Length=395

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI---NHAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA ++        S   I    HAK+ALESY++RK+FQGFD+ETFYMD   +SL
Sbjct  178  AVRSIEAATASTDKFHNTSSTTSIVSAYHAKYALESYISRKIFQGFDHETFYMDGSLSSL  237

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+P+Q RRDCF QYRDMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  238  LNPDQFRRDCFTQYRDMKSMDPTELLGILPTCHFGKFCSKKYLAIVHPKMEESL  291



>ref|XP_010256699.1| PREDICTED: uncharacterized protein LOC104597022 isoform X1 [Nelumbo 
nucifera]
Length=544

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA +         ++VG +HAK+ LESYV RK+F GFDNETFYMD   +SLL+P
Sbjct  331  AVRSIEAATNPNAIEDRTSAIVGAHHAKYVLESYVCRKIFHGFDNETFYMDGSLSSLLNP  390

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF+Q+RDMKA+DP ELLGILPTC FG FC KK+L++VH KMEESL
Sbjct  391  EQFRRDCFSQFRDMKAMDPAELLGILPTCQFGKFCSKKYLSIVHSKMEESL  441



>ref|XP_003551325.1| PREDICTED: uncharacterized protein LOC100812857 isoform X1 [Glycine 
max]
 ref|XP_006602106.1| PREDICTED: uncharacterized protein LOC100812857 isoform X2 [Glycine 
max]
Length=475

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGIN---HAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA ++        S   I    HAK+ALESY++RK+FQGFD+ETFYMD   +SL
Sbjct  258  AVRSIEAATASTDKFHNTSSTTSIVSAYHAKYALESYISRKIFQGFDHETFYMDGSLSSL  317

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+P+Q RRDCF QYRDMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  318  LNPDQFRRDCFTQYRDMKSMDPTELLGILPTCHFGKFCSKKYLAIVHPKMEESL  371



>ref|XP_007016206.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY33825.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=478

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H+K+ALESYV+RK+FQGFD+ETFYMD   +SLL+P+Q+RR+CF QYRDMKA+DPVELLG
Sbjct  288  HHSKYALESYVSRKIFQGFDHETFYMDGSLSSLLNPDQYRRECFTQYRDMKAMDPVELLG  347

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L +VHPKMEESL
Sbjct  348  ILPTCHFGKFCSKKYLAIVHPKMEESL  374



>gb|KEH34146.1| DUF641 family protein [Medicago truncatula]
Length=481

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGIN--HAKFALESYVNRKMFQGFDNETFYMDSRYASLL  175
            AVRSIEAA ++        +   ++  HAK+AL+SY++RK+FQGFD+ETFYMD   +SLL
Sbjct  265  AVRSIEAATASTDKYQNVSTSSIVSSHHAKYALDSYISRKIFQGFDHETFYMDGSLSSLL  324

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+Q RRDCF QY+DMK++DP ELLGILPTC FG FCFKK+L +VHPKMEESL
Sbjct  325  NPDQFRRDCFTQYKDMKSMDPAELLGILPTCHFGKFCFKKYLAIVHPKMEESL  377



>ref|XP_007146717.1| hypothetical protein PHAVU_006G063700g [Phaseolus vulgaris]
 gb|ESW18711.1| hypothetical protein PHAVU_006G063700g [Phaseolus vulgaris]
Length=475

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI---NHAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA ++     +  S   I   +HAK+ALESY++RK+FQGFD+ETFYMD   +SL
Sbjct  258  AVRSIEAATASTEKYHSTSSTTSIVSAHHAKYALESYISRKIFQGFDHETFYMDGSLSSL  317

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+P+Q RRDCF QYRDMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  318  LNPDQFRRDCFTQYRDMKSMDPTELLGILPTCHFGKFCSKKYLAIVHPKMEESL  371



>ref|XP_003532215.1| PREDICTED: uncharacterized protein LOC100789256 [Glycine max]
Length=477

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI---NHAKFALESYVNRKMFQGFDNETFYMDSRYASL  172
            AVRSIEAA ++        S   I   +HAK+AL+SY++RK+FQGFD+ETFYMD   +SL
Sbjct  260  AVRSIEAATASTDKFHNTSSTTSIVSAHHAKYALDSYISRKIFQGFDHETFYMDGSLSSL  319

Query  173  LHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+P+Q RRDCF QYRDMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  320  LNPDQFRRDCFTQYRDMKSMDPTELLGILPTCHFGKFCSKKYLAIVHPKMEESL  373



>ref|XP_004160182.1| PREDICTED: uncharacterized LOC101208715 [Cucumis sativus]
Length=489

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE+A + +            +HAKFALESY++RK+F GFD+ETFYMD   +SLL+P
Sbjct  276  AVRSIESAIAESDNTYLDTVATP-HHAKFALESYISRKIFHGFDHETFYMDGSLSSLLNP  334

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF QYRDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  335  EQFRRDCFTQYRDMKAMDPAELLGILPTCHFGKFCSKKYLSIVHPKMEESL  385



>ref|XP_004143140.1| PREDICTED: uncharacterized protein LOC101208715 [Cucumis sativus]
Length=489

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE+A + +            +HAKFALESY++RK+F GFD+ETFYMD   +SLL+P
Sbjct  276  AVRSIESAIAESDNTYLDTVATP-HHAKFALESYISRKIFHGFDHETFYMDGSLSSLLNP  334

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF QYRDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  335  EQFRRDCFTQYRDMKAMDPAELLGILPTCHFGKFCSKKYLSIVHPKMEESL  385



>ref|XP_008464068.1| PREDICTED: uncharacterized protein LOC103502046 [Cucumis melo]
Length=562

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE+A + +            +HAKFALESY++RK+F GFD+ETFYMD   +SLL+P
Sbjct  349  AVRSIESAIAESDNTYLDTVAT-THHAKFALESYISRKIFHGFDHETFYMDGSLSSLLNP  407

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF QYRDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  408  EQFRRDCFTQYRDMKAMDPAELLGILPTCHFGKFCSKKYLSIVHPKMEESL  458



>ref|XP_011032187.1| PREDICTED: uncharacterized protein LOC105131089 isoform X2 [Populus 
euphratica]
 ref|XP_011013996.1| PREDICTED: uncharacterized protein LOC105117890 isoform X2 [Populus 
euphratica]
Length=569

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+ALESY++RK+FQGFD+ETFYMD   +SLL+P+Q RRDCFAQYRDMKA+DP+ELLGI
Sbjct  380  HAKYALESYISRKVFQGFDHETFYMDGSLSSLLNPDQFRRDCFAQYRDMKAMDPIELLGI  439

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  440  LPTCHFGKFCSKKYLEIVHPKMEESL  465



>ref|XP_011032186.1| PREDICTED: uncharacterized protein LOC105131089 isoform X1 [Populus 
euphratica]
 ref|XP_011013995.1| PREDICTED: uncharacterized protein LOC105117890 isoform X1 [Populus 
euphratica]
Length=572

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+ALESY++RK+FQGFD+ETFYMD   +SLL+P+Q RRDCFAQYRDMKA+DP+ELLGI
Sbjct  383  HAKYALESYISRKVFQGFDHETFYMDGSLSSLLNPDQFRRDCFAQYRDMKAMDPIELLGI  442

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  443  LPTCHFGKFCSKKYLEIVHPKMEESL  468



>ref|XP_007016205.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY33824.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=553

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H+K+ALESYV+RK+FQGFD+ETFYMD   +SLL+P+Q+RR+CF QYRDMKA+DPVELLG
Sbjct  363  HHSKYALESYVSRKIFQGFDHETFYMDGSLSSLLNPDQYRRECFTQYRDMKAMDPVELLG  422

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L +VHPKMEESL
Sbjct  423  ILPTCHFGKFCSKKYLAIVHPKMEESL  449



>ref|XP_007016204.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY33823.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=602

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H+K+ALESYV+RK+FQGFD+ETFYMD   +SLL+P+Q+RR+CF QYRDMKA+DPVELLGI
Sbjct  413  HSKYALESYVSRKIFQGFDHETFYMDGSLSSLLNPDQYRRECFTQYRDMKAMDPVELLGI  472

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  473  LPTCHFGKFCSKKYLAIVHPKMEESL  498



>ref|XP_010104697.1| hypothetical protein L484_022081 [Morus notabilis]
 gb|EXC01503.1| hypothetical protein L484_022081 [Morus notabilis]
Length=670

 Score =   151 bits (381),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+ALESYV+RK+FQGFD+ETFYMD   +SLL+PEQ RRDCF QYRDMKA+DP ELLGI
Sbjct  481  HAKYALESYVSRKVFQGFDHETFYMDGSLSSLLNPEQFRRDCFTQYRDMKAMDPSELLGI  540

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG F  KK+L +VHPKMEESL
Sbjct  541  LPTCHFGKFSSKKYLAVVHPKMEESL  566



>gb|KGN47111.1| hypothetical protein Csa_6G188040 [Cucumis sativus]
Length=565

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIE+A + +            +HAKFALESY++RK+F GFD+ETFYMD   +SLL+P
Sbjct  352  AVRSIESAIAESDNTYLDTVATP-HHAKFALESYISRKIFHGFDHETFYMDGSLSSLLNP  410

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            EQ RRDCF QYRDMKA+DP ELLGILPTC FG FC KK+L++VHPKMEESL
Sbjct  411  EQFRRDCFTQYRDMKAMDPAELLGILPTCHFGKFCSKKYLSIVHPKMEESL  461



>gb|KHG27202.1| Glucose-6-phosphate isomerase [Gossypium arboreum]
Length=549

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+ALESYV+RK+FQGFD+ETFYMD   +SLL+P+Q+ R+CF QYRDMKA+DPVELLGI
Sbjct  360  HAKYALESYVSRKIFQGFDHETFYMDGSLSSLLNPDQYHRECFTQYRDMKAMDPVELLGI  419

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC+FG FC KK+L +VHPKMEESL
Sbjct  420  LPTCNFGKFCSKKYLAIVHPKMEESL  445



>ref|XP_002313401.2| hypothetical protein POPTR_0009s04570g [Populus trichocarpa]
 gb|EEE87356.2| hypothetical protein POPTR_0009s04570g [Populus trichocarpa]
Length=573

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HAK+ALESY++RK+FQGFD+ETFYMD   +SLL+P+Q RRDCFAQYRDMKA+DP+ELLG
Sbjct  383  HHAKYALESYISRKVFQGFDHETFYMDGSLSSLLNPDQFRRDCFAQYRDMKAMDPIELLG  442

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC K++L +VHPKMEESL
Sbjct  443  ILPTCHFGKFCSKRYLEIVHPKMEESL  469



>ref|XP_010520231.1| PREDICTED: uncharacterized protein LOC104799408 [Tarenaya hassleriana]
Length=559

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAK+ALESY+ RK+FQGFD+ETFYMD   +SLL+P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  366  QHAKYALESYICRKIFQGFDHETFYMDGSLSSLLNPDQYRRDCFAQFKDMKAMDPIELLG  425

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L +VHPKMEESL
Sbjct  426  ILPTCHFGKFCSKKYLAIVHPKMEESL  452



>ref|XP_009337383.1| PREDICTED: uncharacterized protein LOC103929846 [Pyrus x bretschneideri]
Length=479

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI--NHAKFALESYVNRKMFQGFDNETFYMDSRYASLL  175
            AVRSIEAA +T        SV+     +AK+AL+SY++RK+FQGFD+ETFYMD   +SLL
Sbjct  263  AVRSIEAATATTGGINMTSSVIATQNGNAKYALQSYISRKLFQGFDHETFYMDGSLSSLL  322

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+QHRRDCFA+YRD KA+DP ELLGILPTC FG FC  K+L +VHPKMEESL
Sbjct  323  NPDQHRRDCFARYRDFKAMDPTELLGILPTCQFGKFCSTKYLAVVHPKMEESL  375



>ref|XP_010043466.1| PREDICTED: uncharacterized protein LOC104432672 [Eucalyptus grandis]
 gb|KCW85478.1| hypothetical protein EUGRSUZ_B02281 [Eucalyptus grandis]
Length=481

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
            G++HAK+ALESYV RK+FQGFD+ETFYMD   +SLL+P Q+RRDCF +YRDMKA+DPVEL
Sbjct  289  GVHHAKYALESYVARKIFQGFDHETFYMDGSLSSLLNPGQYRRDCFGRYRDMKAMDPVEL  348

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEES  331
            LG+LP+C FG FC KK+L +VH KMEES
Sbjct  349  LGVLPSCDFGKFCAKKYLAIVHAKMEES  376



>ref|XP_008220225.1| PREDICTED: uncharacterized protein LOC103320331 [Prunus mume]
Length=398

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             +AK+AL+SY++RK+FQGFD+ETFYMD   +SLL+P+QHRRDCFA+YRD KA+DP ELLG
Sbjct  208  GNAKYALQSYISRKLFQGFDHETFYMDGSLSSLLNPDQHRRDCFARYRDFKAMDPTELLG  267

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC  K+L +VHPKMEESL
Sbjct  268  ILPTCQFGKFCNAKYLAIVHPKMEESL  294



>gb|KDO66747.1| hypothetical protein CISIN_1g009038mg [Citrus sinensis]
Length=471

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+AL+SY++ K+FQGFD+ETFYMD   +SL++P+Q+RRDCF QYRDMKA+DPVELLGI
Sbjct  282  HAKYALQSYISCKIFQGFDHETFYMDGSLSSLINPDQYRRDCFTQYRDMKAMDPVELLGI  341

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  342  LPTCHFGKFCAKKYLAIVHPKMEESL  367



>ref|XP_006424996.1| hypothetical protein CICLE_v10028137mg [Citrus clementina]
 gb|ESR38236.1| hypothetical protein CICLE_v10028137mg [Citrus clementina]
Length=471

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+AL+SY++ K+FQGFD+ETFYMD   +SL++P+Q+RRDCF QYRDMKA+DPVELLGI
Sbjct  282  HAKYALQSYISCKIFQGFDHETFYMDGSLSSLINPDQYRRDCFTQYRDMKAMDPVELLGI  341

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  342  LPTCHFGKFCAKKYLAIVHPKMEESL  367



>ref|XP_007205007.1| hypothetical protein PRUPE_ppa003623mg [Prunus persica]
 gb|EMJ06206.1| hypothetical protein PRUPE_ppa003623mg [Prunus persica]
Length=561

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 4/115 (3%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI----NHAKFALESYVNRKMFQGFDNETFYMDSRYAS  169
            AVRSIEAA  TA+ A +  +   I     +AK+AL+SY++RK+FQGFD+ETFYMD   +S
Sbjct  343  AVRSIEAATVTAITAGSLSTSSIIATQNGNAKYALQSYISRKLFQGFDHETFYMDGSLSS  402

Query  170  LLHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LL+P+QHRRDCFA+YRD KA+DP ELLGILPTC FG FC  K+L +VHPKMEESL
Sbjct  403  LLNPDQHRRDCFARYRDFKAMDPTELLGILPTCQFGKFCNAKYLAIVHPKMEESL  457



>ref|XP_006424997.1| hypothetical protein CICLE_v10028137mg [Citrus clementina]
 gb|ESR38237.1| hypothetical protein CICLE_v10028137mg [Citrus clementina]
Length=546

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+AL+SY++ K+FQGFD+ETFYMD   +SL++P+Q+RRDCF QYRDMKA+DPVELLGI
Sbjct  357  HAKYALQSYISCKIFQGFDHETFYMDGSLSSLINPDQYRRDCFTQYRDMKAMDPVELLGI  416

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  417  LPTCHFGKFCAKKYLAIVHPKMEESL  442



>gb|KDO66746.1| hypothetical protein CISIN_1g009038mg [Citrus sinensis]
Length=546

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+AL+SY++ K+FQGFD+ETFYMD   +SL++P+Q+RRDCF QYRDMKA+DPVELLGI
Sbjct  357  HAKYALQSYISCKIFQGFDHETFYMDGSLSSLINPDQYRRDCFTQYRDMKAMDPVELLGI  416

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  417  LPTCHFGKFCAKKYLAIVHPKMEESL  442



>ref|XP_004500214.1| PREDICTED: uncharacterized protein LOC101509407 [Cicer arietinum]
Length=470

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGIN--HAKFALESYVNRKMFQGFDNETFYMDSRYASLL  175
            AVRSIEAA ++        +   ++  HAK AL+SY++RK+FQGFD+ETFYMD   +SLL
Sbjct  254  AVRSIEAATASTDKYHNTSTSSIVSSHHAKHALDSYISRKIFQGFDHETFYMDGSLSSLL  313

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+Q RRDCF QY+DMK++DP ELLGILPTC FG FC KK+L +VHPKMEESL
Sbjct  314  NPDQFRRDCFTQYKDMKSMDPAELLGILPTCHFGKFCSKKYLAIVHPKMEESL  366



>ref|XP_006401016.1| hypothetical protein EUTSA_v10013123mg [Eutrema salsugineum]
 gb|ESQ42469.1| hypothetical protein EUTSA_v10013123mg [Eutrema salsugineum]
Length=491

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGIN------HAKFALESYVNRKMFQGFDNETFYMDSRY  163
            AVRSIEAA + +    A+     +       HAKFALESY+ RK+FQGFD+ETFYMD   
Sbjct  268  AVRSIEAASAASDGMAASTIGSSVQSSVPNQHAKFALESYICRKIFQGFDHETFYMDGSL  327

Query  164  ASLLHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGILPTC FG FC KK+L+++H KMEESL
Sbjct  328  SSLINPDQYRRDCFAQFKDMKAMDPMELLGILPTCHFGKFCSKKYLSIIHNKMEESL  384



>ref|XP_006488452.1| PREDICTED: uncharacterized protein LOC102627701 [Citrus sinensis]
Length=552

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+AL+SY++ K+FQGFD+ETFYMD   +SL++P+Q+RRDCF QYRDMKA+DPVELLGI
Sbjct  363  HAKYALQSYISCKIFQGFDHETFYMDGSLSSLINPDQYRRDCFTQYRDMKAMDPVELLGI  422

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L +VHPKMEESL
Sbjct  423  LPTCHFGKFCAKKYLAIVHPKMEESL  448



>ref|XP_008355466.1| PREDICTED: uncharacterized protein LOC103419119 [Malus domestica]
Length=471

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK+AL+SY++RK+FQGFD+ETFYMD   +SLL+P+QHRRDCFA+YRD KA+DP ELLGIL
Sbjct  283  AKYALQSYISRKLFQGFDHETFYMDGSLSSLLNPDQHRRDCFARYRDFKAMDPTELLGIL  342

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC FG FC  K+L +VHPKMEESL
Sbjct  343  PTCQFGKFCSAKYLAVVHPKMEESL  367



>ref|XP_006401017.1| hypothetical protein EUTSA_v10013123mg [Eutrema salsugineum]
 gb|ESQ42470.1| hypothetical protein EUTSA_v10013123mg [Eutrema salsugineum]
Length=566

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGIN------HAKFALESYVNRKMFQGFDNETFYMDSRY  163
            AVRSIEAA + +    A+     +       HAKFALESY+ RK+FQGFD+ETFYMD   
Sbjct  343  AVRSIEAASAASDGMAASTIGSSVQSSVPNQHAKFALESYICRKIFQGFDHETFYMDGSL  402

Query  164  ASLLHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGILPTC FG FC KK+L+++H KMEESL
Sbjct  403  SSLINPDQYRRDCFAQFKDMKAMDPMELLGILPTCHFGKFCSKKYLSIIHNKMEESL  459



>ref|XP_009374301.1| PREDICTED: uncharacterized protein LOC103963237 [Pyrus x bretschneideri]
Length=485

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK+AL+SY++RK+FQGFD+ETFYMD   +SLL+P+QHRRDCFA+YRD KA+DP ELLGIL
Sbjct  297  AKYALQSYISRKLFQGFDHETFYMDGSLSSLLNPDQHRRDCFARYRDFKAMDPTELLGIL  356

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC FG FC  K+L +VHPKMEESL
Sbjct  357  PTCQFGKFCSAKYLAVVHPKMEESL  381



>ref|XP_004294251.1| PREDICTED: uncharacterized protein LOC101292779 [Fragaria vesca 
subsp. vesca]
Length=478

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             +AK+AL+SY++ KMFQGFD+ETFYMD   +SLL+P+Q+RRDCF QYRDMKA+DP ELLG
Sbjct  288  GNAKYALQSYISSKMFQGFDHETFYMDGSLSSLLNPDQYRRDCFTQYRDMKAMDPAELLG  347

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC  K+L +VHPKMEESL
Sbjct  348  ILPTCHFGKFCSNKYLAIVHPKMEESL  374



>ref|NP_200704.2| protein GRAVITROPIC IN THE LIGHT [Arabidopsis thaliana]
 ref|NP_001032100.1| protein GRAVITROPIC IN THE LIGHT [Arabidopsis thaliana]
 dbj|BAB09639.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL91642.1| AT5g58960/k19m22_160 [Arabidopsis thaliana]
 gb|AAO11539.1| At5g58960/k19m22_160 [Arabidopsis thaliana]
 gb|ABD59217.1| gravitropic in the light 1 [Arabidopsis thaliana]
 dbj|BAH20054.1| AT5G58960 [Arabidopsis thaliana]
 gb|AED97122.1| uncharacterized protein AT5G58960 [Arabidopsis thaliana]
 gb|AED97123.1| uncharacterized protein AT5G58960 [Arabidopsis thaliana]
Length=484

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  291  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  350

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  351  ILPTCHFGKFCSKKYLSIIHQKMEESL  377



>ref|XP_008366248.1| PREDICTED: uncharacterized protein LOC103429898 [Malus domestica]
Length=473

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGI--NHAKFALESYVNRKMFQGFDNETFYMDSRYASLL  175
            AVRSIEAA +T        S +     +AK+AL+SY++RK+FQGFD+ETFYMD   +SLL
Sbjct  257  AVRSIEAATATTGGINPTSSXIATQSGNAKYALQSYISRKLFQGFDHETFYMDGSLSSLL  316

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+QHRRDCFA+Y D KA+DP ELLGILPTC FG FC  K+L +VHPKMEESL
Sbjct  317  NPDQHRRDCFARYHDFKAMDPAELLGILPTCQFGKFCSTKYLAVVHPKMEESL  369



>gb|KFK27447.1| hypothetical protein AALP_AA8G383600 [Arabis alpina]
Length=557

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGI
Sbjct  365  HAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLGI  424

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L+++H KMEESL
Sbjct  425  LPTCHFGKFCSKKYLSIIHQKMEESL  450



>ref|XP_009120406.1| PREDICTED: uncharacterized protein LOC103845322 [Brassica rapa]
Length=550

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  357  GHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  416

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  417  ILPTCHFGKFCSKKYLSIIHNKMEESL  443



>ref|NP_851217.1| protein GRAVITROPIC IN THE LIGHT [Arabidopsis thaliana]
 gb|AED97121.1| uncharacterized protein AT5G58960 [Arabidopsis thaliana]
Length=559

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGI
Sbjct  367  HAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLGI  426

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L+++H KMEESL
Sbjct  427  LPTCHFGKFCSKKYLSIIHQKMEESL  452



>emb|CDY55008.1| BnaA10g29340D [Brassica napus]
Length=540

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  347  GHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  406

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  407  ILPTCHFGKFCSKKYLSIIHNKMEESL  433



>ref|XP_002864603.1| hypothetical protein ARALYDRAFT_496019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40862.1| hypothetical protein ARALYDRAFT_496019 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  366  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  425

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  426  ILPTCHFGKFCSKKYLSIIHHKMEESL  452



>ref|XP_010483510.1| PREDICTED: uncharacterized protein LOC104761999 isoform X1 [Camelina 
sativa]
Length=560

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  362  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  421

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  422  ILPTCHFGKFCSKKYLSIIHHKMEESL  448



>ref|XP_006281690.1| hypothetical protein CARUB_v10027838mg [Capsella rubella]
 gb|EOA14588.1| hypothetical protein CARUB_v10027838mg [Capsella rubella]
Length=561

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  368  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  427

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  428  ILPTCHFGKFCSKKYLSIIHHKMEESL  454



>ref|XP_010454515.1| PREDICTED: uncharacterized protein LOC104736254 [Camelina sativa]
Length=558

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  365  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  424

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  425  ILPTCHFGKFCSKKYLSIIHHKMEESL  451



>ref|XP_010483511.1| PREDICTED: uncharacterized protein LOC104761999 isoform X2 [Camelina 
sativa]
Length=559

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  361  QHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLG  420

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  421  ILPTCHFGKFCSKKYLSIIHHKMEESL  447



>dbj|BAC43150.1| unknown protein [Arabidopsis thaliana]
Length=559

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGI
Sbjct  367  HAKFALESYICRKIFQGFDHETFYMDGGLSSLINPDQYRRDCFAQFKDMKAMDPMELLGI  426

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L+++H KMEESL
Sbjct  427  LPTCHFGKFCSKKYLSIIHQKMEESL  452



>ref|XP_010443646.1| PREDICTED: uncharacterized protein LOC104726477 isoform X1 [Camelina 
sativa]
Length=560

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGI
Sbjct  368  HAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLGI  427

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L+++H KMEESL
Sbjct  428  LPTCHFGKFCSKKYLSIIHHKMEESL  453



>ref|XP_010443647.1| PREDICTED: uncharacterized protein LOC104726477 isoform X2 [Camelina 
sativa]
Length=559

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P+Q+RRDCFAQ++DMKA+DP+ELLGI
Sbjct  367  HAKFALESYICRKIFQGFDHETFYMDGSLSSLINPDQYRRDCFAQFKDMKAMDPMELLGI  426

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG FC KK+L+++H KMEESL
Sbjct  427  LPTCHFGKFCSKKYLSIIHHKMEESL  452



>emb|CDX80318.1| BnaC09g34240D [Brassica napus]
Length=543

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
             HAKFALESY+ RK+FQGFD+ETFYMD   +SL++P Q+RRDCFAQ++DMKA+DP+ELLG
Sbjct  350  GHAKFALESYICRKIFQGFDHETFYMDGSLSSLINPAQYRRDCFAQFKDMKAMDPMELLG  409

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            ILPTC FG FC KK+L+++H KMEESL
Sbjct  410  ILPTCHFGKFCSKKYLSIIHNKMEESL  436



>ref|XP_010262745.1| PREDICTED: uncharacterized protein LOC104601191 isoform X3 [Nelumbo 
nucifera]
Length=525

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S    +         +HA +ALESYV RKMF GFD+ETFYMD+   S LHP
Sbjct  316  AVRSIEAATSPNTTSIVKA-----HHASYALESYVCRKMFYGFDHETFYMDNNVPSFLHP  370

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +Q RRDC AQ++DMKA DPVELL I PTC FG FC  KFL+++HPKMEESL
Sbjct  371  DQFRRDCLAQFQDMKATDPVELLSIFPTCGFGKFCSMKFLSLIHPKMEESL  421



>ref|XP_010262744.1| PREDICTED: uncharacterized protein LOC104601191 isoform X2 [Nelumbo 
nucifera]
Length=535

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S    +         +HA +ALESYV RKMF GFD+ETFYMD+   S LHP
Sbjct  326  AVRSIEAATSPNTTSIVKA-----HHASYALESYVCRKMFYGFDHETFYMDNNVPSFLHP  380

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +Q RRDC AQ++DMKA DPVELL I PTC FG FC  KFL+++HPKMEESL
Sbjct  381  DQFRRDCLAQFQDMKATDPVELLSIFPTCGFGKFCSMKFLSLIHPKMEESL  431



>ref|XP_010262743.1| PREDICTED: uncharacterized protein LOC104601191 isoform X1 [Nelumbo 
nucifera]
Length=561

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            AVRSIEAA S    +         +HA +ALESYV RKMF GFD+ETFYMD+   S LHP
Sbjct  352  AVRSIEAATSPNTTSIVKA-----HHASYALESYVCRKMFYGFDHETFYMDNNVPSFLHP  406

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +Q RRDC AQ++DMKA DPVELL I PTC FG FC  KFL+++HPKMEESL
Sbjct  407  DQFRRDCLAQFQDMKATDPVELLSIFPTCGFGKFCSMKFLSLIHPKMEESL  457



>ref|XP_008785593.1| PREDICTED: uncharacterized protein LOC103704180 [Phoenix dactylifera]
Length=415

 Score =   135 bits (341),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK A+ESYVNRK+F GF+NETFY++    SLL P + RRDCFAQ++DM+ +DP ELLG+
Sbjct  223  HAKHAVESYVNRKVFHGFENETFYIEGSLTSLLRPAEFRRDCFAQFKDMRGMDPAELLGV  282

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG F  KK+L +VHPKMEESL
Sbjct  283  LPTCQFGRFAAKKYLGIVHPKMEESL  308



>ref|XP_006575731.1| PREDICTED: uncharacterized protein LOC100780566 [Glycine max]
Length=456

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaa-taadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSR-YASLL  175
            AVRSIEAA          + + V   HAK+ALESY+ RKMFQGFD+E+FYMD+   +SLL
Sbjct  240  AVRSIEAASDKYYNNPATSTTTVSTLHAKYALESYIFRKMFQGFDHESFYMDNNTLSSLL  299

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P Q RRDCF+QY DMK+ DP ELLG+LPTC FG FC  K+L++VHPKMEESL
Sbjct  300  NPAQFRRDCFSQYHDMKSTDPSELLGVLPTCHFGKFCSNKYLSVVHPKMEESL  352



>gb|KHN43936.1| hypothetical protein glysoja_025975 [Glycine soja]
Length=454

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 2/113 (2%)
 Frame = +2

Query  2    AVRSIEaahstavaa-taadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSR-YASLL  175
            AVRSIEAA          + + V   HAK+ALESY+ RKMFQGFD+E+FYMD+   +SLL
Sbjct  238  AVRSIEAASDKYYNNPATSTTTVSTLHAKYALESYIFRKMFQGFDHESFYMDNNTLSSLL  297

Query  176  HPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P Q RRDCF+QY DMK+ DP ELLG+LPTC FG FC  K+L++VHPKMEESL
Sbjct  298  NPAQFRRDCFSQYHDMKSTDPSELLGVLPTCHFGKFCSNKYLSVVHPKMEESL  350



>ref|XP_010928935.1| PREDICTED: uncharacterized protein LOC105050556 [Elaeis guineensis]
Length=468

 Score =   134 bits (338),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HAK ALESYVNRK+F GF+NETFY++    SLL P + R DCFAQ++DM+ +DP ELLG
Sbjct  275  HHAKHALESYVNRKVFHGFENETFYIEGSLTSLLRPAEFRNDCFAQFKDMRGMDPAELLG  334

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +LPTC FG F  KK+L +VHPKMEESL
Sbjct  335  VLPTCQFGRFAAKKYLAIVHPKMEESL  361



>ref|XP_008798959.1| PREDICTED: uncharacterized protein LOC103713723 [Phoenix dactylifera]
Length=481

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HAK ALESYVNRK+F GF+NETFY++    SLL P + R DCFAQ++DM+ +DP ELLG
Sbjct  288  HHAKHALESYVNRKVFHGFENETFYIEGSLTSLLRPAEFRIDCFAQFKDMRGMDPAELLG  347

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +LPTC FG F  KK+L +VHPKMEESL
Sbjct  348  VLPTCQFGRFAAKKYLAIVHPKMEESL  374



>ref|XP_010923148.1| PREDICTED: uncharacterized protein LOC105046293 [Elaeis guineensis]
Length=533

 Score =   128 bits (322),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK A+ESYVNRK+F GF+NETFY++    SLL P   RRDCF+Q++DM+ ++P ELLG+
Sbjct  341  HAKHAVESYVNRKVFHGFENETFYIEGSLTSLLRPADFRRDCFSQFKDMRGMEPAELLGV  400

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LPTC FG F  KK+L +VH KMEESL
Sbjct  401  LPTCQFGRFAAKKYLAVVHAKMEESL  426



>ref|XP_003545078.1| PREDICTED: uncharacterized protein LOC100808303 [Glycine max]
Length=473

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMD-SRYASLLHPEQHRRDCFAQYRDMKALDPVELL-  250
            HAK+ALESY+ +KMFQGFD+E+FYMD S  +SLL+P Q RRDCF+QY  MK++DP EL+ 
Sbjct  282  HAKYALESYIYKKMFQGFDHESFYMDNSTLSSLLNPAQFRRDCFSQYCHMKSVDPSELIG  341

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
            G+L TC+FG FC KK+L++VHPKMEESL
Sbjct  342  GVLATCNFGKFCSKKYLSIVHPKMEESL  369



>ref|XP_010685635.1| PREDICTED: uncharacterized protein LOC104900017 [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +2

Query  2    AVRSIEaahstavaataadsvvGINHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHP  181
            A+RSIEAA ST  +   + +    +  K ALESYV RK+FQGFD+ETFYMD   +SLL+P
Sbjct  298  AIRSIEAAISTNGSTMTSTNPHQ-HQTKHALESYVLRKIFQGFDHETFYMDGTLSSLLNP  356

Query  182  EQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
             Q R +CF+++RDMK++DP ELLGILP+  FG FC KK+  +VHPKMEESL
Sbjct  357  LQFRNECFSKFRDMKSMDPSELLGILPSSPFGVFCSKKYQEIVHPKMEESL  407



>ref|XP_009404573.1| PREDICTED: uncharacterized protein LOC103987859 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404574.1| PREDICTED: uncharacterized protein LOC103987859 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   120 bits (300),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            HAK+ALE+YVN K+FQGF+NETFY++   +SL++P + RRDCF Q++DM+ ++P +LLGI
Sbjct  271  HAKYALEAYVNGKLFQGFENETFYLEGSLSSLINPAEFRRDCFTQFQDMRGMEPEQLLGI  330

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
            LP C FG F   K+L +VH KM ESL
Sbjct  331  LPGCPFGRFAASKYLAVVHDKMGESL  356



>ref|XP_009421307.1| PREDICTED: uncharacterized protein LOC104000885 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421308.1| PREDICTED: uncharacterized protein LOC104000885 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   120 bits (300),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK+ALESYVNRK+FQGF+NETFY++   +SL++P + RRD F Q+RDM+ ++P +LLGIL
Sbjct  287  AKYALESYVNRKLFQGFENETFYLEGSLSSLINPAEFRRDRFTQFRDMRGMEPEQLLGIL  346

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            P C FG F   K+L +VH K+EESL
Sbjct  347  PRCPFGRFAASKYLAVVHAKLEESL  371



>gb|KHN23806.1| hypothetical protein glysoja_028099 [Glycine soja]
Length=468

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMD-SRYASLLHPEQHRRDCFAQYRDMKALDPVELL-  250
            HAK+ALESY+ +KM QGFD+E+FYMD S  +SLL+P Q R DCF+QY  MK++DP EL+ 
Sbjct  277  HAKYALESYIYKKMLQGFDHESFYMDNSTLSSLLNPAQFRGDCFSQYCHMKSVDPSELIG  336

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
            G+L TC+FG FC  K+L++VHPKMEESL
Sbjct  337  GVLATCNFGKFCSNKYLSIVHPKMEESL  364



>ref|XP_002994075.1| hypothetical protein SELMODRAFT_138138 [Selaginella moellendorffii]
 gb|EFJ04862.1| hypothetical protein SELMODRAFT_138138 [Selaginella moellendorffii]
Length=438

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H +FA ESYV ++MF GF+NE FY+    +S+L P +HR DCF Q++DM+++DP+EL+  
Sbjct  242  HTRFAFESYVCQRMFNGFENENFYLSGSLSSILDPGKHRHDCFLQFQDMRSIDPLELVST  301

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P C FG FC +K+L +VH KMEES
Sbjct  302  TPDCLFGKFCLRKYLQIVHEKMEES  326



>ref|XP_002989113.1| hypothetical protein SELMODRAFT_184343 [Selaginella moellendorffii]
 gb|EFJ09907.1| hypothetical protein SELMODRAFT_184343 [Selaginella moellendorffii]
Length=438

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H +FA ESYV ++MF GF+NE FY+    +S+L P +HR DCF Q++DM+++DP+EL+  
Sbjct  242  HTRFAFESYVCQRMFNGFENENFYLSGSLSSILDPGKHRHDCFLQFQDMRSIDPLELVST  301

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P C FG FC +K+L +VH KMEES
Sbjct  302  TPDCLFGKFCLRKYLQIVHEKMEES  326



>ref|XP_002971576.1| hypothetical protein SELMODRAFT_412400 [Selaginella moellendorffii]
 gb|EFJ27325.1| hypothetical protein SELMODRAFT_412400 [Selaginella moellendorffii]
Length=539

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H +FA ESYV  ++F GF+NE FY++   +S+L P +HR +CF Q+RDM+A+DP +LLGI
Sbjct  343  HRRFAFESYVCHRIFCGFENENFYINGSLSSILDPVKHRAECFRQFRDMRAVDPADLLGI  402

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P C FG FC +K+L +VH KMEES
Sbjct  403  TPECLFGKFCHRKYLQIVHEKMEES  427



>ref|XP_002963441.1| hypothetical protein SELMODRAFT_405308 [Selaginella moellendorffii]
 gb|EFJ35312.1| hypothetical protein SELMODRAFT_405308 [Selaginella moellendorffii]
Length=539

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H +FA ESYV  ++F GF+NE FY++   +S+L P +HR +CF Q+RDM+A+DP +LLGI
Sbjct  343  HRRFAFESYVCHRIFCGFENENFYINGSLSSILDPVKHRAECFRQFRDMRAVDPADLLGI  402

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P C FG FC +K+L +VH KMEES
Sbjct  403  TPECLFGKFCHRKYLQIVHEKMEES  427



>ref|XP_004981210.1| PREDICTED: uncharacterized protein LOC101782802 [Setaria italica]
Length=476

 Score =   100 bits (248),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ +AQ+RDM+ ++P ELLG+L
Sbjct  285  AKHALEAHVTRSLLGGFEHESFYLDGSLSSLLDPAAFRRERYAQFRDMRGMEPAELLGVL  344

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC+FG +   KF +++ P++EE++
Sbjct  345  PTCAFGRYAATKFASLLPPRVEEAI  369



>ref|XP_003559229.1| PREDICTED: uncharacterized protein LOC100834963 [Brachypodium 
distachyon]
Length=494

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK A+E++V R +  GF++E+FY+D   +SLL P   RRD  AQ+RDM+ +DP ELLG+L
Sbjct  299  AKHAMEAHVTRVLLGGFEHESFYLDGSLSSLLDPAASRRDRHAQFRDMRGMDPAELLGVL  358

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            P C+FG +   KF +++ P++EE++
Sbjct  359  PDCAFGRYAAAKFASLLPPRVEEAV  383



>ref|XP_002463607.1| hypothetical protein SORBIDRAFT_01g002820 [Sorghum bicolor]
 gb|EER90605.1| hypothetical protein SORBIDRAFT_01g002820 [Sorghum bicolor]
Length=479

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ + Q+RDM+ ++P ELLG+L
Sbjct  289  AKHALEAHVTRALLGGFEHESFYLDGSLSSLLDPASFRRERYVQFRDMRGMEPAELLGVL  348

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC+FG +   KF  ++ P++EE++
Sbjct  349  PTCAFGRYAAAKFTALLPPRVEEAV  373



>ref|XP_006848077.1| hypothetical protein AMTR_s00029p00203020 [Amborella trichopoda]
 gb|ERN09658.1| hypothetical protein AMTR_s00029p00203020 [Amborella trichopoda]
Length=247

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            A+ A+ESYV  KMFQGF+NE+FY+    + LL PE+HR+DCFAQ++ M +LDP ELL +L
Sbjct  62   ARLAVESYVCCKMFQGFENESFYISGMLSCLLEPEKHRQDCFAQFKAMLSLDPPELLSLL  121

Query  260  PTCSFGNFCFKKFLTMVHPKMEES  331
                FG F  KK++ +VHPKMEE+
Sbjct  122  SESLFGKFSAKKYMKIVHPKMEEA  145



>ref|XP_006651976.1| PREDICTED: uncharacterized protein LOC102716772 [Oryza brachyantha]
Length=302

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ + Q+RDM+ ++P ELLG+L
Sbjct  113  AKHALEAHVTRVLLGGFEHESFYLDGSLSSLLDPAAFRRERYTQFRDMRGMEPAELLGLL  172

Query  260  PTCSFGNFCFKKFLTMVHPKMEES  331
            PTC FG +   KF +++ P++E++
Sbjct  173  PTCPFGRYAASKFASLLPPRVEQA  196



>ref|NP_001051757.1| Os03g0825600 [Oryza sativa Japonica Group]
 dbj|BAF13671.1| Os03g0825600, partial [Oryza sativa Japonica Group]
Length=317

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ + Q+RDM+ ++P ELLG+L
Sbjct  127  AKHALEAHVTRVLLVGFEHESFYLDGSLSSLLDPAAFRRERYTQFRDMRGMEPAELLGLL  186

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC FG +   KF  ++ P++E+++
Sbjct  187  PTCPFGRYAASKFAALLPPRVEQAV  211



>gb|ADE77125.1| unknown [Picea sitchensis]
Length=214

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  116  MFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELL-GILPTCSFGNFCFK  292
            MF GF+NE FY+    +S++ PE+HR DCF Q+ DM+ ++P EL+  I P C FG FC K
Sbjct  1    MFNGFENENFYLTGSLSSIIDPEKHRNDCFTQFLDMQNMEPSELVSNITPDCLFGKFCMK  60

Query  293  KFLTMVHPKMEESL  334
            KFL +VHP+MEES 
Sbjct  61   KFLHVVHPRMEESF  74



>gb|AAK82451.1|AC091247_18 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99636.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00553.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ + Q+RDM+ ++P ELLG+L
Sbjct  303  AKHALEAHVTRVLLVGFEHESFYLDGSLSSLLDPAAFRRERYTQFRDMRGMEPAELLGLL  362

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC FG +   KF  ++ P++E+++
Sbjct  363  PTCPFGRYAASKFAALLPPRVEQAV  387



>gb|EAY92405.1| hypothetical protein OsI_14140 [Oryza sativa Indica Group]
Length=493

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++V R +  GF++E+FY+D   +SLL P   RR+ + Q+RDM+ ++P ELLG+L
Sbjct  303  AKHALEAHVTRVLLVGFEHESFYLDGSLSSLLDPAAFRRERYTQFRDMRGMEPAELLGLL  362

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            PTC FG +   KF  ++ P++E+++
Sbjct  363  PTCPFGRYAASKFAALLPPRVEQAV  387



>gb|EMS66513.1| hypothetical protein TRIUR3_11999 [Triticum urartu]
Length=129

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   AKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGIL  259
            AK ALE++    +  GF++E+FY+D   +SLL P   RR+ +AQ+RDM+ +DP ELLG+L
Sbjct  62   AKHALEAHATAVLLGGFEHESFYLDGSLSSLLDPAAFRRERYAQFRDMRGMDPGELLGVL  121

Query  260  PTCSFG  277
            PTC+FG
Sbjct  122  PTCAFG  127



>ref|XP_002511684.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50353.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F + S   +       +   F QY  +K +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQESFSIKSDDVTF-----SKESFFPQYLALKEMDPLDVLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  SFG FC  K+L +VHPKME S
Sbjct  290  NPDSSFGKFCRSKYLVVVHPKMEAS  314



>ref|XP_006397703.1| hypothetical protein EUTSA_v10001462mg [Eutrema salsugineum]
 gb|ESQ39156.1| hypothetical protein EUTSA_v10001462mg [Eutrema salsugineum]
Length=422

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F +DS  A+    E      F Q+  +K +DP++ LG 
Sbjct  234  HKKYAFESYICQRMFSGFQEKNFSVDSESATADDTETF----FRQFLALKDMDPLDALGT  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  290  NPDSNFGQFCRSKYLILIHPKMEAS  314



>ref|XP_011098209.1| PREDICTED: uncharacterized protein LOC105176928 [Sesamum indicum]
 ref|XP_011098211.1| PREDICTED: uncharacterized protein LOC105176928 [Sesamum indicum]
 ref|XP_011098212.1| PREDICTED: uncharacterized protein LOC105176928 [Sesamum indicum]
Length=441

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            NH  FA ES+V R+MF GF++  F   +R  SL   ++ RR  F ++ ++K++ PVE L 
Sbjct  256  NHICFAFESFVCRQMFDGFNHPNF--SNRTESLPEGDKRRRLFFDRFTELKSVRPVEYLA  313

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P  +F  FC  K+L ++HPKME SL
Sbjct  314  WKPKSTFAAFCRNKYLRLIHPKMEASL  340



>emb|CDY68486.1| BnaAnng27430D [Brassica napus]
Length=416

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  ETF +DS        +      F Q+  +K +DP++ L  
Sbjct  232  HKKYAFESYICQRMFSGFQQETFSLDS--------DNDTETFFTQFLALKDMDPLDALAT  283

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  284  NPDSNFGKFCRSKYLILIHPKMEAS  308



>ref|XP_006295880.1| hypothetical protein CARUB_v10025010mg [Capsella rubella]
 gb|EOA28778.1| hypothetical protein CARUB_v10025010mg [Capsella rubella]
Length=425

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S  +S++  +      F Q+  +K +DP++ LG 
Sbjct  234  HKKYAFESYICQRMFSGFQQKNFSVNSE-SSMVMADDDTDTFFRQFLALKDMDPLDALGT  292

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  293  NPDSNFGIFCRSKYLILVHPKMEAS  317



>gb|KEH29107.1| DUF641 family protein [Medicago truncatula]
Length=419

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF+ E+F + S   ++     ++   F Q+  ++ +DP+++LG 
Sbjct  232  HKKYAFESYICQRMFGGFEQESFSVKSDNITI-----NKESFFHQFLALREIDPLDMLGQ  286

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  287  NPDSIFGKFCRSKYLVVVHPKMEAS  311



>ref|XP_010508197.1| PREDICTED: uncharacterized protein LOC104784808 [Camelina sativa]
Length=429

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S   +++  +      F Q+  +K +DP++ LG 
Sbjct  238  HKKYAFESYICQRMFSGFQQKNFSVNSESTTVM-ADDDTDTFFRQFLALKDMDPLDALGT  296

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  297  SPDSNFGVFCRSKYLILVHPKMEAS  321



>ref|NP_182051.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAB82637.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14081.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45055.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10531.1| uncharacterized protein AT2G45260 [Arabidopsis thaliana]
Length=425

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S  A+++  +      F Q+  +K +DP++ LG 
Sbjct  234  HKKYAFESYICQRMFSGFQQKNFSVNSESAAVMANDD-TDTFFRQFLALKDMDPLDALGT  292

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  293  NPDSNFGIFCRSKYLLLVHPKMEAS  317



>ref|XP_006843716.1| hypothetical protein AMTR_s00007p00217240 [Amborella trichopoda]
 gb|ERN05391.1| hypothetical protein AMTR_s00007p00217240 [Amborella trichopoda]
Length=487

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 13/98 (13%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSR---YASL-----LHPEQH-----RRDCFAQYR  217
            H K+A ESYV R+MF GF  E+F ++S     ASL     L  E       +   F Q+ 
Sbjct  281  HKKYAFESYVCRRMFSGFKEESFSLESHPSLKASLSLDSNLSQELEGLSVSKEGFFHQFL  340

Query  218  DMKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEES  331
             ++A+DP++++ + P C FG FC  K++ +VHPKME S
Sbjct  341  AVRAMDPLDIVSLNPNCVFGKFCRSKYVNLVHPKMEAS  378



>ref|XP_010506463.1| PREDICTED: uncharacterized protein LOC104783076 [Camelina sativa]
Length=426

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S   +++  +      F Q+  +K +DP++ LG 
Sbjct  235  HKKYAFESYICQRMFSGFQQKNFSVNSESTTVM-ADDDTDTFFRQFLALKDMDPLDALGT  293

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  294  NPDSNFGIFCRSKYLILVHPKMEAS  318



>ref|XP_010518141.1| PREDICTED: uncharacterized protein LOC104793483 [Camelina sativa]
Length=427

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S   +++  +      F Q+  +K +DP++ LG 
Sbjct  236  HKKYAFESYICQRMFSGFQQKNFSVNSESTTVM-ADDDTDTFFRQFLALKDMDPLDALGT  294

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  295  NPDSNFGIFCRSKYLILVHPKMEAS  319



>ref|XP_007134841.1| hypothetical protein PHAVU_010G080800g [Phaseolus vulgaris]
 ref|XP_007134842.1| hypothetical protein PHAVU_010G080800g [Phaseolus vulgaris]
 gb|ESW06835.1| hypothetical protein PHAVU_010G080800g [Phaseolus vulgaris]
 gb|ESW06836.1| hypothetical protein PHAVU_010G080800g [Phaseolus vulgaris]
Length=419

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF+ ETF + S   ++      +   F Q+  ++ +DP+++LG 
Sbjct  232  HKKYAFESYICQRMFSGFELETFSVKSDNITVT-----KESFFHQFLALREMDPLDMLGQ  286

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  287  NPDSIFGKFCRSKYLVVVHPKMEAS  311



>gb|KDP28775.1| hypothetical protein JCGZ_14546 [Jatropha curcas]
Length=421

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F + S    +      R   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQESFSIKSDNVMV-----SRESFFHQYLALREMDPLDVLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  DPDSDFGKFCRSKYLVVVHPKMEGS  314



>ref|XP_009143107.1| PREDICTED: uncharacterized protein LOC103866868 [Brassica rapa]
 ref|XP_009143108.1| PREDICTED: uncharacterized protein LOC103866868 [Brassica rapa]
 ref|XP_009143109.1| PREDICTED: uncharacterized protein LOC103866868 [Brassica rapa]
Length=427

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDC---FAQYRDMKALDPVEL  247
            H K+A ESY+ ++MF GF   TF +DS  +S +  +    D    F Q+  +K +DP++ 
Sbjct  232  HKKYAFESYICQRMFSGFQQRTFSLDSERSSTMDDDDDDDDTETFFRQFLSLKDMDPLDA  291

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEES  331
            L   P  +FG FC  K+L ++HPKME S
Sbjct  292  LCANPDSNFGKFCRGKYLVLIHPKMEAS  319



>ref|XP_004133925.1| PREDICTED: uncharacterized protein LOC101216772 isoform 1 [Cucumis 
sativus]
 ref|XP_004133926.1| PREDICTED: uncharacterized protein LOC101216772 isoform 2 [Cucumis 
sativus]
 ref|XP_004133927.1| PREDICTED: uncharacterized protein LOC101216772 isoform 3 [Cucumis 
sativus]
 ref|XP_004155781.1| PREDICTED: uncharacterized protein LOC101228678 isoform 1 [Cucumis 
sativus]
 ref|XP_004155782.1| PREDICTED: uncharacterized protein LOC101228678 isoform 2 [Cucumis 
sativus]
 ref|XP_004155783.1| PREDICTED: uncharacterized protein LOC101228678 isoform 3 [Cucumis 
sativus]
 gb|KGN56613.1| hypothetical protein Csa_3G126770 [Cucumis sativus]
Length=422

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +ETF +     +L      + D F Q+  +K +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFCGFQHETFSIKVDDVALT-----KEDFFRQFISLKDMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLLVVHPKMEAS  314



>ref|XP_008438186.1| PREDICTED: uncharacterized protein LOC103483367 [Cucumis melo]
 ref|XP_008438187.1| PREDICTED: uncharacterized protein LOC103483367 [Cucumis melo]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +ETF +     +L      + D F Q+  +K +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFCGFQHETFSIKVDDLALT-----KEDFFRQFISLKDMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLLVVHPKMEAS  314



>ref|XP_002302528.1| hypothetical protein POPTR_0002s14690g [Populus trichocarpa]
 gb|EEE81801.1| hypothetical protein POPTR_0002s14690g [Populus trichocarpa]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E F +     ++      +   F Q+  M+ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQHENFSIKVDSGAV-----SKETFFHQFLSMREMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  290  NPDSAFGKFCRSKYLVVVHPKMEAS  314



>ref|XP_011017476.1| PREDICTED: uncharacterized protein LOC105120794 [Populus euphratica]
Length=422

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E F +     ++      +   F Q+  M+ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQHENFSIKVDSGAV-----SKETFFHQFLSMREMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  290  NPDSAFGKFCRSKYLVVVHPKMEAS  314



>gb|EMT11412.1| hypothetical protein F775_30433 [Aegilops tauschii]
Length=388

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +  AS+          F Q+  ++A+DP+++L  
Sbjct  201  HKKYAFESYICQRMFSGFHEESFSIKAATASV-----SNEAFFHQFLAVRAMDPLDVLSQ  255

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  256  NPDSVFGKFCRSKYLLLVHPKMEGS  280



>emb|CDP06027.1| unnamed protein product [Coffea canephora]
Length=447

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H  +A ES+V R+MF GF+   + +     SL   ++ RR  F  +R++K++ P++ L 
Sbjct  259  SHKCYAFESFVCREMFDGFNQPDYSISKE--SLPEQKKRRRVFFEGFRELKSVKPMDYLA  316

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P  +F  FC  K+LT++HPKME SL
Sbjct  317  WKPKSAFAKFCRAKYLTLIHPKMETSL  343



>ref|XP_009382347.1| PREDICTED: uncharacterized protein LOC103970336 [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++A+ SY+   +F+GFD+     D     L  +     R D   Q+ +  ALDP+EL+
Sbjct  249  HCRYAILSYICLGIFEGFDSYDSCDDGSRVELDDIDVTIRRNDSLQQFVEHSALDPIELM  308

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               PTC F NFC KK+  ++HP +E SL
Sbjct  309  RDFPTCDFANFCQKKYAKLIHPGIESSL  336



>gb|EMT23131.1| hypothetical protein F775_07460 [Aegilops tauschii]
Length=388

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ +++F GF  E F +D+  A++          F Q+  ++A+DP+++L  
Sbjct  201  HKKYAFESYICQRIFSGFHQENFLIDAANATV-----SNEAFFHQFLAVRAMDPLDVLSQ  255

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  256  NPDSVFGKFCRSKYLLLVHPKMEGS  280



>ref|XP_009133719.1| PREDICTED: uncharacterized protein LOC103858169 [Brassica rapa]
 ref|XP_009133721.1| PREDICTED: uncharacterized protein LOC103858169 [Brassica rapa]
 ref|XP_009133722.1| PREDICTED: uncharacterized protein LOC103858169 [Brassica rapa]
Length=414

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  +TF +DS        +      F Q+  +K +DP++ L  
Sbjct  230  HKKYAFESYICQRMFSGFQQDTFSLDS--------DDDTETFFTQFLALKDMDPLDALAT  281

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG  C  K+L ++HPKME S
Sbjct  282  NPHSNFGKLCKSKYLILIHPKMEAS  306



>ref|XP_006573422.1| PREDICTED: uncharacterized protein LOC100786595 isoform X2 [Glycine 
max]
 ref|XP_006573423.1| PREDICTED: uncharacterized protein LOC100786595 isoform X3 [Glycine 
max]
 ref|XP_006573424.1| PREDICTED: uncharacterized protein LOC100786595 isoform X4 [Glycine 
max]
 gb|KHN25553.1| hypothetical protein glysoja_035681 [Glycine soja]
Length=419

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 9/87 (10%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFY--MDSRYASLLHPEQHRRDCFAQYRDMKALDPVELL  250
            H K+A ESY+ ++MF GF+ E F   +D+  A+       +   F Q+  ++ +DP+++L
Sbjct  232  HKKYAFESYICQRMFSGFEQENFSVKLDNTTAT-------KESFFHQFLALREMDPLDML  284

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
            G  P   FG FC  K+L +VHPKME S
Sbjct  285  GQNPDSIFGKFCRSKYLVVVHPKMEAS  311



>ref|NP_001276243.1| uncharacterized protein LOC100786595 [Glycine max]
 gb|ACU18890.1| unknown [Glycine max]
Length=419

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 9/87 (10%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFY--MDSRYASLLHPEQHRRDCFAQYRDMKALDPVELL  250
            H K+A ESY+ ++MF GF+ E F   +D+  A+       +   F Q+  ++ +DP+++L
Sbjct  232  HKKYAFESYICQRMFSGFEQENFSVKLDNTTAT-------KESFFHQFLALREMDPLDML  284

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
            G  P   FG FC  K+L +VHPKME S
Sbjct  285  GQNPDSIFGKFCRSKYLVVVHPKMEAS  311



>ref|XP_003571690.1| PREDICTED: uncharacterized protein LOC100825831 [Brachypodium 
distachyon]
Length=422

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + S  A++          F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESYICQRMFSGFHEESFSIKSANATV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHPKMEGS  314



>ref|XP_011093364.1| PREDICTED: uncharacterized protein LOC105173356 [Sesamum indicum]
 ref|XP_011093365.1| PREDICTED: uncharacterized protein LOC105173356 [Sesamum indicum]
Length=422

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E+F M      L +P + +   F QY  ++ +DP++ +G 
Sbjct  235  HKKYAFESHICQRMFIGFQDESFSM-----KLDNPVETKESFFQQYLALREMDPLDAVGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VH KME S
Sbjct  290  SPDSMFGKFCQSKYLVVVHQKMEAS  314



>ref|XP_010544636.1| PREDICTED: uncharacterized protein LOC104817236 [Tarenaya hassleriana]
 ref|XP_010544637.1| PREDICTED: uncharacterized protein LOC104817236 [Tarenaya hassleriana]
Length=422

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E F + S       P       F Q+  +K +DP++ L  
Sbjct  235  HKKYAFESYICQRMFVGFQQENFSIQSE-----SPSDDAEASFRQFLALKDMDPLDALCQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L+++HPKME S
Sbjct  290  SPDSTFGKFCRSKYLSVIHPKMEIS  314



>ref|XP_002442653.1| hypothetical protein SORBIDRAFT_08g000530 [Sorghum bicolor]
 gb|EES16491.1| hypothetical protein SORBIDRAFT_08g000530 [Sorghum bicolor]
Length=422

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KFA ESY+ ++MF GF  E+F +     S+          F Q+  ++A+DP+++L  
Sbjct  235  HKKFAFESYICQRMFSGFQEESFSIKDSNISV-----SSEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHPKMEGS  314



>ref|XP_009413741.1| PREDICTED: uncharacterized protein LOC103994983 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413742.1| PREDICTED: uncharacterized protein LOC103994983 [Musa acuminata 
subsp. malaccensis]
Length=422

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ +KMF GF  E F M+     + H        F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESHICQKMFSGFQEENFSMEPSELPISH-----EGFFRQFLAIRAMDPLDILSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG F  KK+L +VHPKME S
Sbjct  290  NPDSVFGKFSRKKYLLVVHPKMEAS  314



>ref|XP_008343220.1| PREDICTED: uncharacterized protein LOC103405967 [Malus domestica]
Length=422

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F +     ++      +   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQESFSLQVDNLTVT-----KEGFFHQYVTLRDMDPLDVLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGRFCRSKYLVVVHPKMETS  314



>emb|CDX95643.1| BnaC03g25240D [Brassica napus]
Length=413

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 8/85 (9%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  +TF +DS        +      F Q+  +K +D ++ L  
Sbjct  229  HKKYAFESYICQRMFSGFQQDTFSLDS--------DDDTETFFTQFLALKDMDVLDALAT  280

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  281  NPDSNFGKFCRSKYLILIHPKMEAS  305



>ref|XP_003521912.1| PREDICTED: uncharacterized protein LOC100499972 isoformX1 [Glycine 
max]
 ref|XP_003521913.1| PREDICTED: uncharacterized protein LOC100499972 isoformX2 [Glycine 
max]
 ref|XP_006576421.1| PREDICTED: uncharacterized protein LOC100499972 isoform X3 [Glycine 
max]
 ref|XP_006576422.1| PREDICTED: uncharacterized protein LOC100499972 isoform X4 [Glycine 
max]
 ref|XP_006576423.1| PREDICTED: uncharacterized protein LOC100499972 isoform X5 [Glycine 
max]
 ref|XP_006576424.1| PREDICTED: uncharacterized protein LOC100499972 isoform X6 [Glycine 
max]
 gb|KHN35626.1| hypothetical protein glysoja_030978 [Glycine soja]
Length=419

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A E Y+ ++MF GF+ E F + S   ++      +   F Q+  ++ +DP+++LG 
Sbjct  232  HKKYAFEFYICQRMFSGFEQENFSVKSDNITVT-----KESFFHQFLALREMDPLDMLGQ  286

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  287  NPDSIFGKFCRSKYLVVVHPKMEAS  311



>ref|XP_002450101.1| hypothetical protein SORBIDRAFT_05g000500 [Sorghum bicolor]
 gb|EES09089.1| hypothetical protein SORBIDRAFT_05g000500 [Sorghum bicolor]
Length=422

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KFA ESY+ ++MF GF  E+F +     S           F Q+  ++A+DP+++L  
Sbjct  235  HKKFAFESYICQRMFSGFQEESFAIKDSNISF-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHPKMEGS  314



>ref|XP_010045152.1| PREDICTED: uncharacterized protein LOC104433931 [Eucalyptus grandis]
 gb|KCW88573.1| hypothetical protein EUGRSUZ_A00953 [Eucalyptus grandis]
Length=422

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF  F  E+F ++S   ++     ++   F Q+  +K +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFGAFQEESFGIESDTLAV-----NKESFFHQFLALKEMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLLVVHPKMEAS  314



>ref|XP_007220394.1| hypothetical protein PRUPE_ppa006268mg [Prunus persica]
 ref|XP_007220395.1| hypothetical protein PRUPE_ppa006268mg [Prunus persica]
 gb|EMJ21593.1| hypothetical protein PRUPE_ppa006268mg [Prunus persica]
 gb|EMJ21594.1| hypothetical protein PRUPE_ppa006268mg [Prunus persica]
Length=420

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F ++    ++      +   F Q+  ++ +DP+++LG 
Sbjct  233  HKKYAFESHICQRMFSGFQQESFSLNLDNLTVT-----KESFFHQFLTLRDMDPLDMLGQ  287

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  288  NPDSVFGRFCRSKYLVVVHPKMETS  312



>ref|XP_010934058.1| PREDICTED: uncharacterized protein LOC105054267 isoform X1 [Elaeis 
guineensis]
 ref|XP_010934059.1| PREDICTED: uncharacterized protein LOC105054267 isoform X1 [Elaeis 
guineensis]
Length=423

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A ES++ ++MF GFD E+F +++   S+          F Q+  ++A+DP+++L 
Sbjct  235  SHKKYAFESHICQRMFIGFDEESFSVEAGNLSI-----SNEGFFHQFLAVRAMDPLDILS  289

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FG FC  K+L +VHPKME S
Sbjct  290  QNPDSVFGRFCRMKYLMVVHPKMEGS  315



>ref|XP_010934060.1| PREDICTED: uncharacterized protein LOC105054267 isoform X2 [Elaeis 
guineensis]
Length=491

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A ES++ ++MF GFD E+F +++   S+          F Q+  ++A+DP+++L 
Sbjct  303  SHKKYAFESHICQRMFIGFDEESFSVEAGNLSI-----SNEGFFHQFLAVRAMDPLDILS  357

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FG FC  K+L +VHPKME S
Sbjct  358  QNPDSVFGRFCRMKYLMVVHPKMEGS  383



>ref|XP_009768260.1| PREDICTED: uncharacterized protein LOC104219299 [Nicotiana sylvestris]
 ref|XP_009768261.1| PREDICTED: uncharacterized protein LOC104219299 [Nicotiana sylvestris]
 ref|XP_009768262.1| PREDICTED: uncharacterized protein LOC104219299 [Nicotiana sylvestris]
 ref|XP_009768264.1| PREDICTED: uncharacterized protein LOC104219299 [Nicotiana sylvestris]
 ref|XP_009768265.1| PREDICTED: uncharacterized protein LOC104219299 [Nicotiana sylvestris]
Length=422

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E F +    +++      +   F QY  ++ +DP++ +G 
Sbjct  235  HKKYAFESHICQRMFTGFQDEFFSVKHENSAVT-----KDSFFHQYLALREMDPLDAVGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FGNFC  K++ +VHPKME S
Sbjct  290  SPDSLFGNFCRSKYIVVVHPKMEAS  314



>ref|XP_009628687.1| PREDICTED: uncharacterized protein LOC104119006 [Nicotiana tomentosiformis]
 ref|XP_009628688.1| PREDICTED: uncharacterized protein LOC104119006 [Nicotiana tomentosiformis]
 ref|XP_009628689.1| PREDICTED: uncharacterized protein LOC104119006 [Nicotiana tomentosiformis]
Length=422

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E F +    +++      +   F QY  ++ +DP++ +G 
Sbjct  235  HKKYAFESHICQRMFTGFQDEFFSVKHENSAVT-----KDSFFHQYLALREMDPLDAVGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FGNFC  K++ +VHPKME S
Sbjct  290  SPDSLFGNFCRSKYIVVVHPKMEAS  314



>ref|XP_007052097.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007052098.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007052099.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007052100.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96254.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96255.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96256.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX96257.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=422

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E F +     ++      +   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQENFSIKLDNLTVT-----KESFFHQYLALREMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLVVVHPKMEAS  314



>ref|XP_004983065.1| PREDICTED: uncharacterized protein LOC101771337 [Setaria italica]
Length=422

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F +     S+          F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESYICQRMFSGFQEESFSIKDSNISV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLLLVHPKMEGS  314



>ref|XP_009368411.1| PREDICTED: uncharacterized protein LOC103957913 [Pyrus x bretschneideri]
 ref|XP_009368412.1| PREDICTED: uncharacterized protein LOC103957913 [Pyrus x bretschneideri]
Length=422

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF G   E+F +     ++      +   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGLQQESFSLKLDNLTVT-----KESSFHQYLALRDMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSMFGRFCRSKYLVVVHPKMETS  314



>gb|KDO85778.1| hypothetical protein CISIN_1g014602mg [Citrus sinensis]
 gb|KDO85779.1| hypothetical protein CISIN_1g014602mg [Citrus sinensis]
 gb|KDO85780.1| hypothetical protein CISIN_1g014602mg [Citrus sinensis]
Length=422

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E F + S    +     ++   F Q+  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFTGFQQEDFSVKSENLIV-----NKESFFHQFLALREIDPLDVLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  290  NPDSNFGKFCRSKYLAVLHPKMEAS  314



>ref|XP_006445290.1| hypothetical protein CICLE_v10023651mg [Citrus clementina]
 ref|XP_006490892.1| PREDICTED: uncharacterized protein LOC102618291 [Citrus sinensis]
 gb|ESR58530.1| hypothetical protein CICLE_v10023651mg [Citrus clementina]
Length=422

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E F + S    +     ++   F Q+  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFTGFQQEDFSVKSENLIV-----NKESFFHQFLALREIDPLDVLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  290  NPDSNFGKFCRSKYLAVLHPKMEAS  314



>ref|XP_004499498.1| PREDICTED: uncharacterized protein LOC101497862 [Cicer arietinum]
 ref|XP_004515951.1| PREDICTED: uncharacterized protein LOC101505868 [Cicer arietinum]
 ref|XP_004516614.1| PREDICTED: uncharacterized protein LOC101509722 isoform X1 [Cicer 
arietinum]
 ref|XP_004516615.1| PREDICTED: uncharacterized protein LOC101509722 isoform X2 [Cicer 
arietinum]
Length=419

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF  F+NE+F + S    +      +   F Q+  ++ +DP+++LG 
Sbjct  232  HKKYAFESYICQRMFGCFENESFSVKSDNIIV-----DKESFFHQFLALREMDPLDMLGQ  286

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K++ +VHPKME S
Sbjct  287  NPDSIFGKFCRSKYVVVVHPKMEAS  311



>dbj|BAK01990.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K A ESY+ +++F GF  E F +D+  A++          F Q+  ++A+DP+++L  
Sbjct  230  HKKCAFESYICQRIFSGFHQENFSIDAANATV-----SNEAFFHQFLAVRAMDPLDVLSQ  284

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  285  NPDSVFGKFCRSKYLLLVHPKMEGS  309



>ref|XP_010248387.1| PREDICTED: uncharacterized protein LOC104591282 [Nelumbo nucifera]
 ref|XP_010248388.1| PREDICTED: uncharacterized protein LOC104591282 [Nelumbo nucifera]
Length=460

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H  FA E +V R+MF GF+N  F + +    L   +Q RR  F ++ ++K++   E L  
Sbjct  265  HKSFAFECFVCREMFDGFNNPEFSLPNE--PLPERKQRRRHFFDRFTELKSMRVKEFLSH  322

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L++VHPKME S
Sbjct  323  KPNSTFGKFCRAKYLSLVHPKMEAS  347



>ref|NP_001064481.1| Os10g0378400 [Oryza sativa Japonica Group]
 dbj|BAF26395.1| Os10g0378400 [Oryza sativa Japonica Group]
Length=338

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +   ++          F Q+  ++A+DP+++L  
Sbjct  151  HKKYAFESYICQRMFGGFQEESFSVKAANITV-----SNEAFFHQFLAVRAMDPLDVLSQ  205

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  206  NPDSVFGKFCRSKYLLLVHPKMEGS  230



>ref|XP_006661727.1| PREDICTED: uncharacterized protein LOC102702783 [Oryza brachyantha]
Length=422

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F +     S+          F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESYICQRMFGGFQEESFSVKGSNISV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLLLVHPKMEGS  314



>gb|EAZ15895.1| hypothetical protein OsJ_31316 [Oryza sativa Japonica Group]
Length=391

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +   ++          F Q+  ++A+DP+++L  
Sbjct  204  HKKYAFESYICQRMFGGFQEESFSVKAANITV-----SNEAFFHQFLAVRAMDPLDVLSQ  258

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  259  NPDSVFGKFCRSKYLLLVHPKMEGS  283



>ref|XP_002280629.1| PREDICTED: uncharacterized protein LOC100250526 [Vitis vinifera]
 ref|XP_002280612.1| PREDICTED: uncharacterized protein LOC100250526 [Vitis vinifera]
 ref|XP_010661659.1| PREDICTED: uncharacterized protein LOC100250526 [Vitis vinifera]
 ref|XP_010661660.1| PREDICTED: uncharacterized protein LOC100250526 [Vitis vinifera]
 ref|XP_010661661.1| PREDICTED: uncharacterized protein LOC100250526 [Vitis vinifera]
Length=422

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E+F + S   ++      +   F Q+  ++ +DP++ LG 
Sbjct  235  HKKYAFESHICQRMFSGFQHESFSIKSDNLTVT-----KESFFHQFLALREMDPLDTLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKM+ S
Sbjct  290  NPDSIFGKFCRSKYLVVVHPKMDAS  314



>gb|EPS72619.1| hypothetical protein M569_02135, partial [Genlisea aurea]
Length=406

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KF  ES++++KMF GF +E+F         + PE  +   F QY  ++  DP+  +  
Sbjct  222  HKKFTFESHISQKMFVGFQDESFS--------VKPETAKETFFQQYLSLRETDPLNAVCS  273

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
                SFGNFC  K+ T+VH KME S
Sbjct  274  SEESSFGNFCRSKYATVVHEKMEAS  298



>gb|EAY78276.1| hypothetical protein OsI_33323 [Oryza sativa Indica Group]
Length=422

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +   ++          F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESYICQRMFGGFQEESFSVKAANITV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHPKMEGS  314



>gb|EMS65095.1| hypothetical protein TRIUR3_07411 [Triticum urartu]
Length=388

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +  AS+          F Q+  ++A+DP+++L  
Sbjct  201  HKKYAFESYICQRMFSGFHEESFSIKAATASV-----SNEAFFHQFLAVRAMDPLDVLSQ  255

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VH KME S
Sbjct  256  NPDSVFGKFCRSKYLLLVHQKMEGS  280



>ref|XP_010692209.1| PREDICTED: uncharacterized protein LOC104905379 [Beta vulgaris 
subsp. vulgaris]
Length=422

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KFA ES + +++F GF  E+F       S+     +R   F QY  ++ +DP++ LG 
Sbjct  235  HKKFAFESCICQRIFLGFQQESFTEKREDLSV-----NRESFFHQYLALREMDPLDALGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSIFGKFCRSKYLILVHPKMEAS  314



>gb|ABB47396.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABG66055.1| expressed protein [Oryza sativa Japonica Group]
Length=422

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E+F + +   ++          F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESYICQRMFGGFQEESFSVKAANITV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHPKMEGS  314



>ref|XP_004306937.1| PREDICTED: uncharacterized protein LOC101299519 [Fragaria vesca 
subsp. vesca]
Length=422

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E F +     ++      +   F Q+  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQENFSIKLDNLTIT-----KESFFHQFLTLRDMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  SPDSIFGRFCRSKYLVVVHPKMETS  314



>ref|NP_001170462.1| putative domain of unknown function (DUF641) containing family 
protein [Zea mays]
 gb|ACN37069.1| unknown [Zea mays]
 gb|AFW55793.1| putative domain of unknown function (DUF641) containing family 
protein [Zea mays]
Length=422

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KFA ESY+ ++MF GF  E+F +     S+          F Q+  ++A+DP+++L  
Sbjct  235  HKKFAFESYICQRMFSGFQEESFSIKDSNISV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L++VH KME S
Sbjct  290  NPDSVFGKFCRSKYLSLVHQKMEGS  314



>gb|KHG01819.1| Myosin-4 [Gossypium arboreum]
Length=467

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E F ++    ++     ++   F QY  ++ +DP+++LG 
Sbjct  280  HKKYAFESHICQRMFSGFQEENFSINLDNLTV-----NKESFFHQYLALREMDPLDMLGQ  334

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+  +VHPKME S
Sbjct  335  NPDSVFGKFCRSKYPAVVHPKMEAS  359



>ref|XP_010264192.1| PREDICTED: uncharacterized protein LOC104602268 [Nelumbo nucifera]
Length=422

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F +     ++      +   F Q+  ++ +DP+++L  
Sbjct  235  HKKYAFESHICQRMFSGFQEESFSIKPENITV-----SKESFFHQFLALRTMDPLDILSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLVVVHPKMEAS  314



>gb|KHG30155.1| Myosin-4 [Gossypium arboreum]
Length=422

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F +     ++     ++   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQESFSIKLDNVTV-----NKESFFQQYLALREMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG F   K+L +VHPKME S
Sbjct  290  NPDSLFGKFSQSKYLMVVHPKMEAS  314



>emb|CDO97711.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A E+++ ++MF GF  E+F +      L +    +   F QY  ++ +DP++ +G 
Sbjct  212  HKKYAFEAHICQRMFSGFQEESFSL-----KLDNVTMDKGSFFNQYLALRDMDPLDAVGQ  266

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  267  SPDSPFGKFCRSKYLVVVHPKMEAS  291



>ref|XP_010559109.1| PREDICTED: uncharacterized protein LOC104827613 [Tarenaya hassleriana]
 ref|XP_010559110.1| PREDICTED: uncharacterized protein LOC104827613 [Tarenaya hassleriana]
 ref|XP_010559111.1| PREDICTED: uncharacterized protein LOC104827613 [Tarenaya hassleriana]
 ref|XP_010559112.1| PREDICTED: uncharacterized protein LOC104827613 [Tarenaya hassleriana]
Length=421

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  E F ++S  +S           F Q+  +K +DP++ LG 
Sbjct  235  HKKYAFESYICQRMFSGFRQENFSVESDSSS-----VDAEGSFRQFLALKDMDPLDALGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L+++HPKME S
Sbjct  290  NPDSIFGKFCRSKYLSLIHPKMEAS  314



>ref|XP_008783573.1| PREDICTED: uncharacterized protein LOC103702786 isoform X3 [Phoenix 
dactylifera]
Length=344

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A ES++ ++MF GF  E+F +++   ++          F Q+  ++A+DP+++L 
Sbjct  156  SHKKYAFESHICQRMFSGFHEESFSVEAGNLAI-----SNEGFFHQFLAVRAMDPLDILS  210

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FG FC  K+L +VHPKME S
Sbjct  211  QNPDSVFGKFCRMKYLMVVHPKMEGS  236



>ref|XP_008372718.1| PREDICTED: uncharacterized protein LOC103436085 [Malus domestica]
 ref|XP_008372719.1| PREDICTED: uncharacterized protein LOC103436085 [Malus domestica]
Length=422

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  E+F +     ++      +   F QY  ++ +DP+++LG 
Sbjct  235  HKKYAFESHICQRMFSGFQQESFSLKLDNLTVT-----KESSFHQYLALRDMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
                 FG FC  K+L +VHPKME S
Sbjct  290  NXDSIFGRFCRSKYLVVVHPKMETS  314



>ref|NP_001144371.1| uncharacterized protein LOC100277294 [Zea mays]
 gb|ACG40040.1| hypothetical protein [Zea mays]
 gb|AFW64555.1| putative domain of unknown function (DUF641) containing family 
protein isoform 1 [Zea mays]
 gb|AFW64556.1| putative domain of unknown function (DUF641) containing family 
protein isoform 2 [Zea mays]
Length=422

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H KFA ESY+ ++MF GF  E+F +     S+          F Q+  ++A+DP+++L  
Sbjct  235  HKKFAFESYICQRMFSGFQEESFSIKDSNISV-----SNEAFFHQFLAVRAMDPLDVLSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VH KME S
Sbjct  290  NPDSVFGKFCRSKYLLLVHQKMEGS  314



>gb|EYU30553.1| hypothetical protein MIMGU_mgv1a007035mg [Erythranthe guttata]
Length=422

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 3/85 (4%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF +E F M        +P + +   F QY  ++ +DP++ +G 
Sbjct  233  HKKYAFESHICQRMFVGFQDENFSMKKPEK---NPIETKESFFQQYLALREMDPLDAVGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++H KME S
Sbjct  290  DPDSTFGIFCQSKYLEVLHQKMEAS  314



>ref|XP_008783571.1| PREDICTED: uncharacterized protein LOC103702786 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008783572.1| PREDICTED: uncharacterized protein LOC103702786 isoform X2 [Phoenix 
dactylifera]
Length=423

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A ES++ ++MF GF  E+F +++   ++          F Q+  ++A+DP+++L 
Sbjct  235  SHKKYAFESHICQRMFSGFHEESFSVEAGNLAI-----SNEGFFHQFLAVRAMDPLDILS  289

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FG FC  K+L +VHPKME S
Sbjct  290  QNPDSVFGKFCRMKYLMVVHPKMEGS  315



>ref|NP_001142801.1| uncharacterized protein LOC100275178 [Zea mays]
 gb|ACG26853.1| hypothetical protein [Zea mays]
Length=479

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +  A L    P   R +   Q+ +    DP+EL+
Sbjct  273  HCRYALLSRVCLSMFDGFDSHQFGATAGTAELGGADPASLRNESLRQFIEHSDADPMELV  332

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP ME SL
Sbjct  333  NSSPDCEFAQFCDRKYKQLIHPGMESSL  360



>ref|XP_008783568.1| PREDICTED: uncharacterized protein LOC103702786 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008783570.1| PREDICTED: uncharacterized protein LOC103702786 isoform X1 [Phoenix 
dactylifera]
Length=459

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A ES++ ++MF GF  E+F +++   ++          F Q+  ++A+DP+++L 
Sbjct  271  SHKKYAFESHICQRMFSGFHEESFSVEAGNLAI-----SNEGFFHQFLAVRAMDPLDILS  325

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FG FC  K+L +VHPKME S
Sbjct  326  QNPDSVFGKFCRMKYLMVVHPKMEGS  351



>ref|XP_006348318.1| PREDICTED: uncharacterized protein LOC102583964 [Solanum tuberosum]
Length=455

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 12/92 (13%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRR-----DCFAQYRDMKALDP  238
            N   +A ES+V+R+MF GF+  TF + +       PEQ +R     D F + R MK   P
Sbjct  267  NDIYYAFESFVSREMFDGFNYPTFSISTEPL----PEQKKRQKLFYDRFTELRSMK---P  319

Query  239  VELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
             + L   P  +F  FC  K+L ++HPKME+S+
Sbjct  320  ADYLAWKPKSTFSIFCRAKYLKLIHPKMEDSI  351



>ref|XP_009387295.1| PREDICTED: uncharacterized protein LOC103974246 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387296.1| PREDICTED: uncharacterized protein LOC103974246 [Musa acuminata 
subsp. malaccensis]
Length=421

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ +KMF GF  E F M+    +  H        F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESHICQKMFSGF-QENFSMEPSNLTASH-----EGFFHQFLAIRAMDPLDVLSQ  288

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG F  KK+L +VHPKME S
Sbjct  289  NPDSVFGKFSRKKYLLVVHPKMEAS  313



>ref|XP_010919052.1| PREDICTED: uncharacterized protein LOC105043269 isoform X2 [Elaeis 
guineensis]
 ref|XP_010919054.1| PREDICTED: uncharacterized protein LOC105043269 isoform X2 [Elaeis 
guineensis]
Length=422

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  ++F +++   S           F Q+  ++A+DP+++L  
Sbjct  235  HKKYAFESHICQRMFSGFHEKSFSVEAGGLST-----SNEGFFHQFLAVRAMDPLDILSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRSKYLMVVHPKMEGS  314



>ref|XP_010919051.1| PREDICTED: uncharacterized protein LOC105043269 isoform X1 [Elaeis 
guineensis]
Length=436

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  ++F +++   S           F Q+  ++A+DP+++L  
Sbjct  249  HKKYAFESHICQRMFSGFHEKSFSVEAGGLST-----SNEGFFHQFLAVRAMDPLDILSQ  303

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  304  NPDSVFGKFCRSKYLMVVHPKMEGS  328



>ref|XP_008644723.1| PREDICTED: uncharacterized protein LOC103626121 [Zea mays]
 gb|AFW68439.1| putative domain of unknown function (DUF641) containing family 
protein [Zea mays]
Length=480

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRR-DCFAQYRDMKALDPVEL  247
            H ++AL S V   MF GFD+  F   +  A L    P   RR +   Q+ +    DP+EL
Sbjct  273  HCRYALLSRVCLSMFDGFDSHQFGATAGTAELGGTEPATTRRNESLRQFIEHSDADPMEL  332

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +   P C F  FC +K+  ++HP ME SL
Sbjct  333  VNSRPDCEFARFCDRKYKQLIHPGMESSL  361



>ref|XP_009384547.1| PREDICTED: uncharacterized protein LOC103972078 [Musa acuminata 
subsp. malaccensis]
Length=456

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++A+ SY+   MF GFD+  F  D     +  +     R D   Q+ +  ALDP+EL+
Sbjct  258  HCRYAILSYICLGMFGGFDSYDFCDDGDGVDMDEIDVSIRRTDSLQQFIEHSALDPLELM  317

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P+  F  FC KK+  ++HP +E SL
Sbjct  318  RDFPSSDFVKFCKKKYAKLIHPGIESSL  345



>ref|XP_009768100.1| PREDICTED: uncharacterized protein LOC104219165 [Nicotiana sylvestris]
 ref|XP_009768101.1| PREDICTED: uncharacterized protein LOC104219165 [Nicotiana sylvestris]
Length=456

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRD--CFAQYRDMKALDPVEL  247
            N   +A ES+V R+MF GF+   F + +       PEQ +R    F ++ +++++ PV+ 
Sbjct  268  NDICYAFESFVCREMFDGFNYPNFSISTEPL----PEQTKRQRLFFDRFMELRSVKPVDY  323

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L   P  +F  FC  K+L ++HPK+EES+
Sbjct  324  LAWKPKSTFARFCRAKYLKLIHPKIEESI  352



>ref|XP_011082774.1| PREDICTED: uncharacterized protein LOC105165456 [Sesamum indicum]
 ref|XP_011082775.1| PREDICTED: uncharacterized protein LOC105165456 [Sesamum indicum]
Length=452

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            NH  FA ES+V R+MF GF++  F   +      H  QHR   F ++ ++K+  P + L 
Sbjct  264  NHKCFAFESFVCREMFDGFNHPNFSTRTSAEQGGH-HQHRL-FFDRFMELKSARPADYLA  321

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P   F  FC KK+L ++HPK+E SL
Sbjct  322  WKPKSLFATFCRKKYLRLIHPKLEASL  348



>ref|XP_010110261.1| hypothetical protein L484_001403 [Morus notabilis]
 gb|EXC25674.1| hypothetical protein L484_001403 [Morus notabilis]
Length=493

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H  FA ES+V+R+MF  F    F++    +S +   + R   FA++ ++K++   + L  
Sbjct  283  HKCFAFESFVSREMFDCFCYPNFHLQKEPSSSVDKRKQREKFFARFMELKSVKTKDYLLA  342

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +F NFC  K+L +VHPKME S
Sbjct  343  KPRSAFANFCRVKYLKLVHPKMEHS  367



>gb|KFK44760.1| hypothetical protein AALP_AA1G299400 [Arabis alpina]
Length=474

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H  FA ES+V RKM + F++ +F  +S        +    + F ++++++++DPV+ L 
Sbjct  271  SHRCFAFESFVCRKMLENFESPSFSQNSD-----EKQPSSFEFFNRFKNLRSVDPVQYLT  325

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P CSF  F   K+L++VH KME SL
Sbjct  326  RNPACSFAKFVITKYLSVVHAKMECSL  352



>ref|XP_003517960.1| PREDICTED: uncharacterized protein LOC100783971 [Glycine max]
Length=506

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPE--QHRRDCFAQYRDMKALDPVELL  250
            H ++AL SYV   MF GFD+  F M+       H    + R  C  Q  +  + +P++LL
Sbjct  313  HNQYALLSYVCLGMFHGFDSLNFGMEEPVVLNGHGSDLEDRDGCLKQLLEHVSSNPMDLL  372

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
            GI P C F  FC  K+  ++HP +E S+
Sbjct  373  GIHPGCKFSRFCEHKYERLIHPSIESSI  400



>ref|XP_002268081.1| PREDICTED: uncharacterized protein LOC100259946 [Vitis vinifera]
Length=482

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYM-DSRYASLLHPEQHRRDCFAQYRDMKALDPVELL  250
             H  FA ES+V R MF+GF++  F + +S  A     +Q R+  F +++ +K+++P+  L
Sbjct  286  THRCFAFESFVCRAMFEGFNSPNFSLSESSSAPEGKGKQRRQLFFERFKKLKSVNPIHFL  345

Query  251  GILPTCSFGNFCFKKFLTMVHPKME  325
               P  +FG F   K+L++VH KME
Sbjct  346  SQNPRSTFGKFVRAKYLSLVHAKME  370



>ref|XP_007140797.1| hypothetical protein PHAVU_008G143000g [Phaseolus vulgaris]
 gb|ESW12791.1| hypothetical protein PHAVU_008G143000g [Phaseolus vulgaris]
Length=513

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYAS--LLHPEQHRRDCFAQYRDMKALDPVEL  247
             H ++AL SYV   MF GFD+  F M+   ++  +      R  C     +  + +P++L
Sbjct  317  GHNQYALLSYVCLGMFHGFDSLNFGMEETVSNEQVCSDVDKRDSCLKHLLEHVSSNPMDL  376

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LGI P C F  FC  K+  ++HP ME S+
Sbjct  377  LGIHPGCEFSRFCEHKYEKLIHPSMESSI  405



>ref|XP_010098933.1| hypothetical protein L484_025589 [Morus notabilis]
 gb|EXB76235.1| hypothetical protein L484_025589 [Morus notabilis]
Length=422

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES + ++MF GF  E+F + +    +      +   F Q+  ++ +DP+++LG 
Sbjct  235  HKKYAFESNICQQMFSGFQQESFGIKADDLVVT-----KESFFNQFLALREMDPLDMLGQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VH KME S
Sbjct  290  NPDSIFGKFCRSKYLVVVHQKMEAS  314



>ref|XP_011101433.1| PREDICTED: uncharacterized protein LOC105179489 [Sesamum indicum]
Length=459

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDC--FAQYRDMKALDPVEL  247
            +H  FA ESYV R++F GF++  F + S   S L  E H+R    F Q++ +++   +  
Sbjct  263  DHKAFAFESYVCREIFTGFNDPGFSIQSNDQSTLPSEIHQRRIFFFEQFKKLRSASVIHF  322

Query  248  LGILPTCSFGNFCFKKFLTMVHPKME  325
            L   P   FG     K+L +VHPKME
Sbjct  323  LKQNPNSLFGKLLKSKYLHLVHPKME  348



>dbj|BAJ90506.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   S  A+L  +     R +   Q+ +    DP+EL+
Sbjct  257  HCRYALLSRVCLSMFDGFDSYQFGGTSDAAALEGMELAVRRNESLQQFIEHSDADPMELM  316

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  317  SSSPDCEFSQFCDRKYKQLIHPGIESSL  344



>ref|XP_004489014.1| PREDICTED: uncharacterized protein LOC101493041 [Cicer arietinum]
Length=446

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 9/87 (10%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQ-YRDMKALDPVELL  250
            +H  FA+ESYV ++MF GF    F +++        EQ  + CF + + ++K++   E L
Sbjct  259  DHKCFAIESYVCKEMFDGFQFPFFNLEN--------EQQNQKCFLEKFNELKSMKVKEYL  310

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
             + P+ SF  FC  K+L +VHPKME S
Sbjct  311  AMNPSSSFAKFCRVKYLRLVHPKMELS  337



>emb|CDX74719.1| BnaA05g04650D [Brassica napus]
Length=409

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 45/85 (53%), Gaps = 16/85 (19%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF   TF +DS            R+      DM   DP++ L  
Sbjct  233  HKKYAFESYICQRMFSGFQQRTFSLDSE-----------RNVLPS--DM---DPLDALCA  276

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L ++HPKME S
Sbjct  277  NPDSNFGKFCRGKYLVLIHPKMEAS  301



>ref|XP_008784637.1| PREDICTED: uncharacterized protein LOC103703536 [Phoenix dactylifera]
 ref|XP_008784638.1| PREDICTED: uncharacterized protein LOC103703536 [Phoenix dactylifera]
Length=422

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ES++ ++MF GF  ++F +++   S           F Q+  ++ +DP+++L  
Sbjct  235  HKKYAFESHICQRMFSGFHEKSFSVEAGGLST-----SNEGFFHQFLAVRVMDPLDILSQ  289

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC  K+L +VHPKME S
Sbjct  290  NPDSVFGKFCRMKYLLVVHPKMEGS  314



>ref|XP_004244284.1| PREDICTED: uncharacterized protein LOC101246157 [Solanum lycopersicum]
Length=455

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDC--FAQYRDMKALDPVELLGIL  259
            +A ES+++R+MF GF+   F + +       PEQ +R    + ++ +++++ P + L   
Sbjct  271  YAFESFISREMFDGFNYPNFSISAEPL----PEQKKRQKLFYDRFTELRSVKPADYLAWK  326

Query  260  PTCSFGNFCFKKFLTMVHPKMEESL  334
            P  +F  FC  K+L ++HPKME+S+
Sbjct  327  PQSTFSRFCRAKYLQLIHPKMEDSI  351



>ref|XP_004233052.1| PREDICTED: uncharacterized protein LOC101250471 [Solanum lycopersicum]
Length=456

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 8/88 (9%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYM---DSRYASLLHPEQHRRDCF-AQYRDMKALDPV  241
            NH  FA ES+V R++F GF+  TF +   DS ++ ++     RRD F  Q++ +K+++  
Sbjct  262  NHRAFAFESFVCREIFSGFNEPTFSVQNDDSLFSGVIQ----RRDFFFDQFKKLKSVNVT  317

Query  242  ELLGILPTCSFGNFCFKKFLTMVHPKME  325
              L   P+  FG F   K+L +VHPKME
Sbjct  318  PFLKQNPSSLFGKFLKAKYLHLVHPKME  345



>ref|XP_004982657.1| PREDICTED: uncharacterized protein LOC101783619 [Setaria italica]
Length=469

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQ--HRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +  A L   E    R +   Q+ +    DP+EL+
Sbjct  266  HCRYALLSRVCLSMFDGFDSYEFGAAADNAELEGIELAIRRNESLQQFIEHSDADPIELM  325

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  326  NSSPDCEFAQFCDRKYKQLIHPGIESSL  353



>ref|XP_003539136.1| PREDICTED: uncharacterized protein LOC100796904 [Glycine max]
Length=510

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 8/94 (9%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQH-------RRDCFAQYRDMKAL  232
             H ++AL SYV   +F GFD+  F M+     L+    H       R  C  Q  +  + 
Sbjct  312  GHNQYALLSYVCLGIFHGFDSMNFGMEDG-EELVVSNGHGSLDLEDRDGCLKQLLEHVSS  370

Query  233  DPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +P+ELLGI P C F  FC  K+  ++HP ME S+
Sbjct  371  NPMELLGIHPGCEFSRFCEHKYERLIHPSMESSI  404



>ref|XP_010919476.1| PREDICTED: uncharacterized protein LOC105043593 [Elaeis guineensis]
Length=462

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 3/90 (3%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFY---MDSRYASLLHPEQHRRDCFAQYRDMKALDPVE  244
             H  +A+ SY+   MF+GFD+E F     D      +     R +   Q+ +  A+DP+E
Sbjct  258  GHCPYAILSYIYLGMFRGFDSEGFSREGSDGIGLDGIDVNTRRMNSLTQFIEHSAVDPLE  317

Query  245  LLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L+    +C F  FC +K+  ++HP ME +L
Sbjct  318  LISGSSSCDFAKFCERKYRQLIHPGMESTL  347



>ref|XP_004514207.1| PREDICTED: uncharacterized protein LOC101508636 [Cicer arietinum]
Length=501

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 10/96 (10%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPE----------QHRRDCFAQYRDMK  226
            H ++AL SYV   MFQGFD+  F + S   +               + R D   Q  +  
Sbjct  300  HNQYALLSYVCLGMFQGFDSLCFKLSSEINANEESTSNGDLCDLGYKERNDFLKQLLEHV  359

Query  227  ALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            + +P+ELLGI P C F  FC  K+  ++HP ME S+
Sbjct  360  SSNPMELLGIHPGCEFSRFCEMKYEKLIHPSMESSI  395



>ref|XP_009602869.1| PREDICTED: uncharacterized protein LOC104097945 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009602870.1| PREDICTED: uncharacterized protein LOC104097945 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009602871.1| PREDICTED: uncharacterized protein LOC104097945 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009602872.1| PREDICTED: uncharacterized protein LOC104097945 isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRD--CFAQYRDMKALDPVEL  247
            N   +A ES+V R+MF GF+   F + +       PEQ +R    F ++ +++++ P + 
Sbjct  268  NDICYAFESFVCREMFDGFNYPNFSISTEPL----PEQKKRPRLFFDRFMELRSVKPADY  323

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L   P  +F  FC  K+L ++HPK+EES+
Sbjct  324  LAWKPKSTFARFCRAKYLKLIHPKIEESI  352



>ref|XP_009602868.1| PREDICTED: uncharacterized protein LOC104097945 isoform X1 [Nicotiana 
tomentosiformis]
Length=457

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRD--CFAQYRDMKALDPVEL  247
            N   +A ES+V R+MF GF+   F + +       PEQ +R    F ++ +++++ P + 
Sbjct  269  NDICYAFESFVCREMFDGFNYPNFSISTEPL----PEQKKRPRLFFDRFMELRSVKPADY  324

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L   P  +F  FC  K+L ++HPK+EES+
Sbjct  325  LAWKPKSTFARFCRAKYLKLIHPKIEESI  353



>ref|XP_006358102.1| PREDICTED: uncharacterized protein LOC102597251 [Solanum tuberosum]
Length=458

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            NH  FA ES+V R++F GF+  TF + +  +      Q R   F Q++ +K+++    L 
Sbjct  264  NHRAFAFESFVCREIFSGFNEPTFSVQNDDSLFSGVTQRRNFFFDQFKKLKSVNVSPFLK  323

Query  254  ILPTCSFGNFCFKKFLTMVHPKME  325
              P+  FG F   K+L +VHPKME
Sbjct  324  QNPSSLFGKFLKAKYLHLVHPKME  347



>ref|XP_002466967.1| hypothetical protein SORBIDRAFT_01g017570 [Sorghum bicolor]
 gb|EER93965.1| hypothetical protein SORBIDRAFT_01g017570 [Sorghum bicolor]
Length=448

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +    L  +     R +   Q+ +    DP+EL+
Sbjct  245  HCRYALLSRVCLSMFDGFDSYQFGATADTTELGGIELATRRNESLQQFIEHSDADPMELM  304

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  305  NSSPDCEFAQFCDRKYKQLIHPGIESSL  332



>gb|EEE51244.1| hypothetical protein OsJ_32107 [Oryza sativa Japonica Group]
Length=397

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +   +L  +     R +   Q+ +    DP+EL+
Sbjct  196  HCRYALLSRVCLSMFDGFDSYQFGGSTDATTLEGIDLAIRRNESLQQFIEHSDADPMELI  255

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  256  NSSPDCEFAQFCDRKYKQLIHPGIESSL  283



>ref|NP_001142802.1| putative domain of unknown function (DUF641) containing family 
protein [Zea mays]
 gb|ACG26872.1| hypothetical protein [Zea mays]
 tpg|DAA49366.1| TPA: putative domain of unknown function (DUF641) containing 
family protein [Zea mays]
Length=470

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +    L        R +   Q+ +    DP+EL+
Sbjct  266  HCRYALLSRVCLSMFDGFDSYQFGATADTTELGGTQLAARRNESLQQFIEHSDADPMELM  325

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  326  NSSPDCDFARFCDRKYRQLIHPGIESSL  353



>ref|NP_001065020.1| Os10g0508100 [Oryza sativa Japonica Group]
 gb|AAM94919.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAM95693.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54541.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26934.1| Os10g0508100 [Oryza sativa Japonica Group]
Length=470

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELL  250
            H ++AL S V   MF GFD+  F   +   +L  +     R +   Q+ +    DP+EL+
Sbjct  269  HCRYALLSRVCLSMFDGFDSYQFGGSTDATTLEGIDLAIRRNESLQQFIEHSDADPMELI  328

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEESL  334
               P C F  FC +K+  ++HP +E SL
Sbjct  329  NSSPDCEFAQFCDRKYKQLIHPGIESSL  356



>ref|XP_010933714.1| PREDICTED: uncharacterized protein LOC105054035 [Elaeis guineensis]
Length=457

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRY---ASLLHPEQHRRDCFAQYRDMKALDPVE  244
             H ++A+ SY+   MF GFD+  F ++      +  +     R +   Q+ +   +DP+E
Sbjct  257  GHCRYAILSYICLGMFGGFDSAGFCLEDSGGVGSDGIDVSTRRMNSLVQFIEHSTVDPLE  316

Query  245  LLGILPTCSFGNFCFKKFLTMVHPKMEES  331
            L+   P+C F  FC +K+  ++HP ME +
Sbjct  317  LISGSPSCDFAKFCERKYHQLIHPGMEST  345



>ref|XP_006375307.1| hypothetical protein POPTR_0014s06310g, partial [Populus trichocarpa]
 gb|ERP53104.1| hypothetical protein POPTR_0014s06310g, partial [Populus trichocarpa]
Length=327

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H ++A ES+++++MF GF +E F + +   ++      +   F Q+   + +DP+++L  
Sbjct  175  HKQYAFESHISQRMFIGFHHENFSIKADGGAV-----SKESFFHQFLATREMDPLDMLCQ  229

Query  257  LPTCSFGNFCFKKFLTMVHPK  319
             P   FG FC  K+L +VHPK
Sbjct  230  NPNSVFGKFCTSKYLVVVHPK  250



>gb|AFK34989.1| unknown [Lotus japonicus]
Length=175

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = +2

Query  116  MFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPTCSFGNFCFKK  295
            MF GF+ E+F + S   ++      +   F Q+  ++ +DP+++LG  P   FG FC  K
Sbjct  1    MFGGFEQESFSVKSDSITVT-----KESFFHQFLALREMDPLDMLGQNPDSIFGKFCKSK  55

Query  296  FLTMVHPKMEES  331
            +L +VHPKME S
Sbjct  56   YLVVVHPKMEVS  67



>ref|XP_003574169.1| PREDICTED: uncharacterized protein LOC100822255 [Brachypodium 
distachyon]
Length=454

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/89 (34%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQ---HRRDCFAQYRDMKALDPVEL  247
            H ++AL S V   MF GFD+  F   S     L   +    R +   Q+ +    DP+EL
Sbjct  261  HCRYALLSRVCLSMFDGFDSYQFGAASDDGGALEGIELAIRRNESLQQFIEHSDTDPIEL  320

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +   P C F  FC +K+  ++HP +E SL
Sbjct  321  MHSSPDCEFAQFCDRKYKQLIHPGIESSL  349



>gb|EPS62483.1| hypothetical protein M569_12310 [Genlisea aurea]
Length=437

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H   A+ES+V+R MF GF++  F +           + R+  F+++  MK  +P + + 
Sbjct  252  SHLFLAIESFVSRVMFDGFNDSDFLV-LTRRRRKKKRRTRKRLFSKFLRMKQRNPFDYVS  310

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P  SF +FC  K+L +VHPKMEESL
Sbjct  311  GRPDSSFASFCRSKYLKLVHPKMEESL  337



>emb|CDX71143.1| BnaC03g12270D [Brassica napus]
Length=59

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  221  MKALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEES  331
            MKA+DP+ELLG+LPTC FG  C KK+L+++H ++  S
Sbjct  1    MKAMDPMELLGVLPTCHFGKLCSKKYLSVIHHRVLGS  37



>ref|XP_011042511.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105138181 
[Populus euphratica]
Length=420

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 5/85 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H  +A ES+++++MF GF +E F + +   ++      +   F Q+   + +DP+++L  
Sbjct  233  HKXYAFESHISQRMFSGFHHENFSIKAAGGAV-----SKESFFHQFLATREMDPLDMLCQ  287

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P   FG FC    L +VHPK+E S
Sbjct  288  NPNSVFGKFCTSNDLVVVHPKLEAS  312



>ref|XP_010675324.1| PREDICTED: uncharacterized protein LOC104891341 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675325.1| PREDICTED: uncharacterized protein LOC104891341 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H  F  ES+V+++MF  F    F + +   SL   +Q RR  F ++ ++K++   + L  
Sbjct  291  HRCFTFESFVSKEMFDSFHIPNFALPNE--SLPENKQRRRLFFERFTELKSVKAKDYLCQ  348

Query  257  LPTCSFGNFCFKKFLTMVHPKMEES  331
             P  +FG FC  K+L +VHPKME S
Sbjct  349  KPKSTFGKFCRAKYLRLVHPKMESS  373



>ref|XP_004229800.1| PREDICTED: uncharacterized protein LOC101248815 [Solanum lycopersicum]
Length=421

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELLG  253
            H K+A ES++ ++MF  F NE F +  +Y +   P     D F  QY  ++  DP++++ 
Sbjct  235  HKKYAFESHICQRMFAEFQNEFFSV--KYENSAVP----NDSFYHQYLALRESDPLDVVV  288

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FGNFC KK+L +VH KME +
Sbjct  289  QNPKSLFGNFCRKKYLEVVHSKMESA  314



>gb|EYU28117.1| hypothetical protein MIMGU_mgv1a018759mg, partial [Erythranthe 
guttata]
Length=452

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF--AQYRDMKALDPVEL  247
            +H  FA ES+V R++F GF++  F + S+ +SL     H+R  F   +++ ++++  V  
Sbjct  261  DHKAFAFESFVCREIFGGFNDPGFSLQSK-SSLSGDNIHQRRVFFFEEFKKLRSVGVVHF  319

Query  248  LGILPTCSFGNFCFKKFLTMVHPKME  325
            L   P   FG F   K+L +VHPKME
Sbjct  320  LKRNPNSLFGKFLKSKYLQLVHPKME  345



>gb|KEH16455.1| DUF641 family protein [Medicago truncatula]
Length=529

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 10/96 (10%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRY---ASLLHPEQ-------HRRDCFAQYRDMK  226
            H ++AL SYV   MFQGFD  +F + S       L+   +        R  C  Q  +  
Sbjct  328  HNQYALLSYVCLGMFQGFDLVSFGLSSERRDEEELMSSGEFFDLDLKGRDSCLKQLLEHV  387

Query  227  ALDPVELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            + +P+ELL I P C F  FC  K+  ++HP ME S+
Sbjct  388  SSNPMELLSIHPGCEFSRFCEMKYERLIHPSMESSI  423



>ref|XP_010686249.1| PREDICTED: uncharacterized protein LOC104900521 [Beta vulgaris 
subsp. vulgaris]
Length=471

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 5/84 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYM-DSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            H  FALESYV++ MF GF++  FY+ D      L+    R   F  ++ +++L P ++  
Sbjct  284  HEIFALESYVSQVMFDGFNHHNFYLPDEGTKQTLN----RNFFFENFQKIQSLTPSQIFT  339

Query  254  ILPTCSFGNFCFKKFLTMVHPKME  325
              P   F  FC  K+L ++HPKME
Sbjct  340  QNPKYPFARFCKGKYLKLMHPKME  363



>ref|XP_007149567.1| hypothetical protein PHAVU_005G081200g [Phaseolus vulgaris]
 ref|XP_007149568.1| hypothetical protein PHAVU_005G081200g [Phaseolus vulgaris]
 gb|ESW21561.1| hypothetical protein PHAVU_005G081200g [Phaseolus vulgaris]
 gb|ESW21562.1| hypothetical protein PHAVU_005G081200g [Phaseolus vulgaris]
Length=474

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 6/88 (7%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDC--FAQYRDMKALDPVEL  247
            +H  FA+E++V R+MF  F    F + +   SL  P++ RR    F ++ +MK++   + 
Sbjct  268  DHKCFAIEAFVCREMFDAFHFPNFSLSNE--SL--PDRSRRQQWFFGRFNEMKSMKAKDF  323

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEES  331
            L   P  SF  FC  K+L +VHPKME S
Sbjct  324  LAEKPRSSFAKFCRVKYLKLVHPKMESS  351



>ref|XP_002320047.2| hypothetical protein POPTR_0014s06200g [Populus trichocarpa]
 gb|EEE98362.2| hypothetical protein POPTR_0014s06200g [Populus trichocarpa]
Length=486

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQ----HRRDCFAQYRDMKALDPVE  244
            H ++A  SYV   MF+GFD E F + S    L +              Q  +  + +P+E
Sbjct  291  HNRYAFLSYVCLGMFKGFDLEGFGLKSDGEILCNGHDSVSVKSNSALKQLLEHVSSNPME  350

Query  245  LLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LL + PTC F  FC KK+  ++HP ME S+
Sbjct  351  LLSMNPTCEFLRFCEKKYQELIHPTMESSI  380



>ref|XP_006347884.1| PREDICTED: uncharacterized protein LOC102602829 [Solanum tuberosum]
Length=421

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELLG  253
            H K+A ES++ ++MF  F NE F +  +Y +   P     D F  QY  ++  DP++++ 
Sbjct  235  HKKYAFESHICQRMFAEFQNEFFCV--KYENSAVP----NDSFYHQYLALRESDPLDVVV  288

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P   FGNFC KK+L +VH KME +
Sbjct  289  QNPKSLFGNFCRKKYLEVVHSKMESA  314



>ref|XP_011044059.1| PREDICTED: uncharacterized protein LOC105139355 [Populus euphratica]
 ref|XP_011044060.1| PREDICTED: uncharacterized protein LOC105139355 [Populus euphratica]
 ref|XP_011044061.1| PREDICTED: uncharacterized protein LOC105139355 [Populus euphratica]
 ref|XP_011044063.1| PREDICTED: uncharacterized protein LOC105139355 [Populus euphratica]
 ref|XP_011044064.1| PREDICTED: uncharacterized protein LOC105139355 [Populus euphratica]
Length=462

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            FA ES+V+R+MF GF    F +  +  SL   +  ++  F ++ ++K+    E + + P 
Sbjct  271  FAFESFVSREMFDGFHLPNFSL--KEESLPEKKNQQQLFFRRFTELKSAKATEYIALKPK  328

Query  266  CSFGNFCFKKFLTMVHPKMEES  331
             +F  FC  K+L ++HP+ME S
Sbjct  329  STFAKFCRAKYLQLIHPQMETS  350



>ref|XP_006661935.1| PREDICTED: uncharacterized protein LOC102720079, partial [Oryza 
brachyantha]
Length=266

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVEL  247
             H ++AL S V   MF GFD+  F       +L  +     R +   Q+ +    DP+EL
Sbjct  64   GHCRYALLSRVCLSMFDGFDSYQFGSTGDADTLEGIDLTIRRNESLQQFIEHSDADPMEL  123

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +   P C F  FC +K+  ++HP +E SL
Sbjct  124  INSSPDCEFAQFCDRKYKQLIHPGIESSL  152



>ref|XP_009802869.1| PREDICTED: uncharacterized protein LOC104248328 [Nicotiana sylvestris]
Length=456

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            NH  FA ES+V R++F GF+   F + +   SL     +RR  F  Q++ +K++     L
Sbjct  262  NHRAFAFESFVCREIFSGFNEPAFSVQND-DSLFSGGTNRRSFFFEQFKKLKSVSVTHFL  320

Query  251  GILPTCSFGNFCFKKFLTMVHPKME  325
               P+  FG F   K+L +VHPKME
Sbjct  321  KQNPSSLFGKFLKAKYLHLVHPKME  345



>ref|XP_009778115.1| PREDICTED: uncharacterized protein LOC104227550 [Nicotiana sylvestris]
Length=449

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            +A ES+V R+MF GF++  F +     S    ++ +R  F ++  +++ +  + L   P 
Sbjct  265  YAFESFVCREMFDGFNHPQFLISKE--STTEEKKQQRLFFNRFLKLRSANVADYLAWKPK  322

Query  266  CSFGNFCFKKFLTMVHPKMEESL  334
             +F  FC  K+L +VHPKME SL
Sbjct  323  SAFARFCCAKYLKLVHPKMESSL  345



>gb|ACD56637.1| UNE1-like protein [Gossypioides kirkii]
Length=439

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 8/84 (10%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HA F  ES+V + M QGFD+  F         LHPEQ+    F  ++ +K+ +P   L 
Sbjct  248  SHACFLFESFVCKTMLQGFDSHDF----NGLKGLHPEQY----FNAFKTLKSANPKSFLV  299

Query  254  ILPTCSFGNFCFKKFLTMVHPKME  325
              P   F  F   K+L +VHPKME
Sbjct  300  QNPKSGFAKFIRDKYLKLVHPKME  323



>ref|XP_003540495.1| PREDICTED: uncharacterized protein LOC100810236 [Glycine max]
Length=470

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H  FA+E++V R+MF  F    F + S   SLL   + ++  F ++ +MK++     L 
Sbjct  268  DHKCFAIEAFVCREMFDAFHIPNFALSSE--SLLDKNRRQQWFFGKFNEMKSMKAKYYLA  325

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P  SF  FC  K+  +VHPKME S
Sbjct  326  EKPRSSFAKFCRVKYSRLVHPKMESS  351



>gb|EAY79156.1| hypothetical protein OsI_34263 [Oryza sativa Indica Group]
Length=256

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVEL  247
             H ++ L S V   MF GFD+  F   +   +L  +     R +   Q+ +    DP+EL
Sbjct  54   GHCRYVLLSRVCLSMFDGFDSYQFGGSTDATTLEGIDLAIRRNESLQQFIEHSDADPMEL  113

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +   P C F  FC +K+  ++HP +E SL
Sbjct  114  INSSPDCEFAQFCDRKYKQLIHPGIESSL  142



>ref|XP_011085321.1| PREDICTED: uncharacterized protein LOC105167345 [Sesamum indicum]
Length=455

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA ES+V R++F GF++  F + +   SL      RR  F  Q++ +++++    L
Sbjct  262  DHKAFAFESFVCREIFAGFNDPNFSVQTNEQSLPKENHQRRIFFFEQFKKLRSVNLNHFL  321

Query  251  GILPTCSFGNFCFKKFLTMVHPKME  325
               P   FG F   K+L  VHPKME
Sbjct  322  KQNPNSLFGKFLKSKYLHFVHPKME  346



>ref|XP_003543203.1| PREDICTED: uncharacterized protein LOC100799419 isoformX2 [Glycine 
max]
 ref|XP_006594726.1| PREDICTED: uncharacterized protein LOC100799419 isoform X3 [Glycine 
max]
 ref|XP_006594727.1| PREDICTED: uncharacterized protein LOC100799419 isoform X4 [Glycine 
max]
Length=474

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H  FA+E++V R+MF  F    F + S   S L   + ++  F ++ ++K++   + L 
Sbjct  268  DHKCFAMEAFVCREMFDAFHIPNFSLSSE--SPLEKNRRQQWFFGKFNELKSMKAKDYLA  325

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P  SF  +C  K+L +VHPKME S
Sbjct  326  ERPRSSFAKYCRVKYLGLVHPKMESS  351



>gb|KHN36898.1| hypothetical protein glysoja_001629 [Glycine soja]
Length=474

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H  FA+E++V R+MF  F    F + S   S L   + ++  F ++ ++K++   + L 
Sbjct  268  DHKCFAMEAFVCREMFDAFHIPNFSLSSE--SPLEKNRRQQWFFGKFNELKSMKAKDYLA  325

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P  SF  +C  K+L +VHPKME S
Sbjct  326  ERPRSSFAKYCRVKYLGLVHPKMESS  351



>gb|EMS57586.1| hypothetical protein TRIUR3_32464 [Triticum urartu]
Length=195

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
 Frame = +2

Query  83   KFALESYVNRKMFQGFDNETFYMDSRYASL--LHPEQHRRDCFAQYRDMKALDPVELLGI  256
            ++AL S V   MF GFD+  F   S  ++L  +     R +   Q+      DP+EL+  
Sbjct  5    RYALLSRVCLSMFDGFDSYQFGGTSDASALEGIELAVRRNESLQQFIAHSDADPMELMSS  64

Query  257  LPTCSFGNFCFKKFLTMVHPKMEESL  334
             P C F  FC +K+  ++HP +E SL
Sbjct  65   SPDCEFSQFCDRKYKQLIHPGIESSL  90



>ref|XP_001765797.1| predicted protein [Physcomitrella patens]
 gb|EDQ69388.1| predicted protein [Physcomitrella patens]
Length=1366

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +2

Query  83    KFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKAL-DPVELLGIL  259
             KF ++S++ R+MF  FD+E F ++S  + + + E+H + CF +Y   + + + V LL   
Sbjct  1072  KFLVQSFILRRMFLDFDSECFNIESCMSEIFNIEEHSKACFQEYLKHRTVSETVTLLTDN  1131

Query  260   PTCS--FGNFCFKKFLTMVHPKMEESL  334
              + S     FCFKKFL +V    EE+ 
Sbjct  1132  RSHSAFLREFCFKKFLHIVSESTEEAF  1158



>ref|XP_010242144.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
 ref|XP_010242145.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
 ref|XP_010242146.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
 ref|XP_010242147.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
 ref|XP_010242148.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
 ref|XP_010242149.1| PREDICTED: uncharacterized protein LOC104586564 [Nelumbo nucifera]
Length=449

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = +2

Query  95   ESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPTCSF  274
            E +V R+MF GF    F +      L   +Q +R  F ++ +MK++   E L   P  +F
Sbjct  271  EYFVCREMFDGFHQPNFSLP--VEPLSEKKQMQRHFFDKFTEMKSIRVKEFLSRNPNSTF  328

Query  275  GNFCFKKFLTMVHPKMEES  331
            G FC  K+L +VHPKME S
Sbjct  329  GKFCRAKYLRLVHPKMEAS  347



>ref|XP_010692185.1| PREDICTED: uncharacterized protein LOC104905361 [Beta vulgaris 
subsp. vulgaris]
Length=470

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMD------SRYASLLHPEQHRRDCFAQYRDMKALDP  238
            H ++AL SYV  +MFQGFD E F +       + + S  + E+  +    Q ++  + +P
Sbjct  275  HNRYALLSYVCLRMFQGFDLEDFGLGEDGGVCNGHISSCNGEE--KASLRQLKEHVSGNP  332

Query  239  VELLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            +E+L   P C F  FC +K+  ++HP ME S+
Sbjct  333  LEILRKNPDCEFSKFCERKYQELIHPTMESSI  364



>ref|XP_009624609.1| PREDICTED: uncharacterized protein LOC104115636 [Nicotiana tomentosiformis]
Length=456

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            NH  FA ES+V R++F GF+   F + +   SL     +RR+ F  Q++ +K++     L
Sbjct  262  NHRAFAFESFVCREIFCGFNEPAFSVQND-DSLFSGGTNRRNFFFEQFKKLKSVGVTHFL  320

Query  251  GILPTCSFGNFCFKKFLTMVHPKME  325
               P+  FG F   K+L +VHPKME
Sbjct  321  KQNPSSLFGKFLKAKYLHLVHPKME  345



>ref|XP_008458139.1| PREDICTED: uncharacterized protein LOC103497664 [Cucumis melo]
Length=494

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDC---FAQYRDMKALDPVEL  247
            H ++A  SYV   MF+ FD+E F +    +      Q+         Q  +  + +P+EL
Sbjct  298  HIRYAFLSYVCLWMFRSFDSEVFGVIETESFCTEQSQNLDGISISLKQLLEHVSSNPMEL  357

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L + P C+F  FC KK+  ++HP ME S+
Sbjct  358  LSVNPQCAFAKFCEKKYQELIHPTMESSI  386



>ref|XP_002882003.1| hypothetical protein ARALYDRAFT_483660 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58262.1| hypothetical protein ARALYDRAFT_483660 [Arabidopsis lyrata subsp. 
lyrata]
Length=270

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H K+A ESY+ ++MF GF  + F ++S  A ++  +      F Q+  +K +DP++ LG 
Sbjct  199  HKKYAFESYICQRMFSGFQQKNFSVNSESA-MVMADDDTDTFFRQFLALKDMDPLDALGT  257

Query  257  LPTCSFGNFCFKK  295
             P  +FG FC  K
Sbjct  258  NPDSNFGIFCRSK  270



>gb|KEH19456.1| UNE1-like protein [Medicago truncatula]
Length=450

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA+ES+V R+MF  F+    Y D+R   L  P++++   F  ++ ++K+++  E L
Sbjct  254  DHKCFAIESFVCREMFDSFN--LPYFDNRNDFL--PDKNKTQFFFGRFNELKSVNAKEFL  309

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
             + P   F  FC+ K+L +VH KME S
Sbjct  310  ALKPKSPFAIFCWVKYLRLVHSKMEAS  336



>ref|XP_004140484.1| PREDICTED: uncharacterized protein LOC101203555 [Cucumis sativus]
 ref|XP_004162373.1| PREDICTED: uncharacterized protein LOC101226600 [Cucumis sativus]
 gb|KGN46576.1| hypothetical protein Csa_6G109710 [Cucumis sativus]
Length=494

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 5/90 (6%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFA----QYRDMKALDPVE  244
            H ++A  SYV   MF+ FD+E  Y  +   S    +    D  +    Q  +  + +P+E
Sbjct  298  HIRYAFLSYVCLWMFRSFDSEV-YGVTETESFCTEQSQNFDGISISLKQLLEHVSSNPME  356

Query  245  LLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LL + P C+F  FC KK+  ++HP ME S+
Sbjct  357  LLSVNPQCAFAKFCEKKYQELIHPTMESSI  386



>ref|XP_006582118.1| PREDICTED: uncharacterized protein LOC100818091 isoform X1 [Glycine 
max]
 ref|XP_006582119.1| PREDICTED: uncharacterized protein LOC100818091 isoform X2 [Glycine 
max]
Length=462

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA+ES+V R+MF  F+   F + +   SL  P++++R  F  ++ ++K +   + L
Sbjct  261  DHKCFAIESFVCREMFDSFNFPNFSLPNE--SL--PDKNKRQLFFGRFNELKPVKAKDFL  316

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
               P   F  FC  K+L +VHPKME S
Sbjct  317  AGKPRSPFAKFCRNKYLRLVHPKMEAS  343



>ref|XP_008451753.1| PREDICTED: uncharacterized protein LOC103492946 isoform X1 [Cucumis 
melo]
Length=468

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPE--QHRRDCFAQYRDMKALDPVELL  250
            H  FA E++V R MF+GF    F + +     L P+  Q ++    ++ + K+L   ELL
Sbjct  262  HKCFAFEAFVCRVMFEGFHFPNFALPNES---LPPDKNQQKKLYLRRFAETKSLKSKELL  318

Query  251  G--ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            G    P+ +F  FC  K+L +VHPKME SL
Sbjct  319  GHGQKPSSTFAKFCRVKYLQLVHPKMESSL  348



>gb|KHN46680.1| hypothetical protein glysoja_045156 [Glycine soja]
Length=461

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA+ES+V R+MF  F+   F + +   SL  P++++R  F  ++ ++K +   + L
Sbjct  261  DHKCFAIESFVCREMFDSFNFPNFSLPNE--SL--PDKNKRQLFFGRFNELKPVKAKDFL  316

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
               P   F  FC  K+L +VHPKME S
Sbjct  317  AGKPRSPFAKFCRNKYLRLVHPKMEAS  343



>ref|XP_008451754.1| PREDICTED: uncharacterized protein LOC103492946 isoform X2 [Cucumis 
melo]
Length=467

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPE--QHRRDCFAQYRDMKALDPVELL  250
            H  FA E++V R MF+GF    F + +     L P+  Q ++    ++ + K+L   ELL
Sbjct  261  HKCFAFEAFVCRVMFEGFHFPNFALPNES---LPPDKNQQKKLYLRRFAETKSLKSKELL  317

Query  251  G--ILPTCSFGNFCFKKFLTMVHPKMEESL  334
            G    P+ +F  FC  K+L +VHPKME SL
Sbjct  318  GHGQKPSSTFAKFCRVKYLQLVHPKMESSL  347



>gb|KEH19457.1| UNE1-like protein [Medicago truncatula]
Length=459

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA+ES+V R+MF  F+    Y D+R   L  P++++   F  ++ ++K+++  E L
Sbjct  263  DHKCFAIESFVCREMFDSFN--LPYFDNRNDFL--PDKNKTQFFFGRFNELKSVNAKEFL  318

Query  251  GILPTCSFGNFCFKKFLTMVHPKMEES  331
             + P   F  FC+ K+L +VH KME S
Sbjct  319  ALKPKSPFAIFCWVKYLRLVHSKMEAS  345



>ref|XP_010644820.1| PREDICTED: uncharacterized protein LOC104877723 [Vitis vinifera]
Length=188

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  68   GINHAKFALESYVNRKMFQGFDNETFYMDSRYAS  169
            G +H K+ALESYV +K+FQGFD+ETFYMD   +S
Sbjct  145  GSHHVKYALESYVCQKIFQGFDHETFYMDGNLSS  178



>ref|NP_195134.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86322.1| uncharacterized protein AT4G34080 [Arabidopsis thaliana]
Length=270

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H ++A ESY+ ++MF GF  + F ++S  A+++  +      F Q+  +K +DP++ LG 
Sbjct  199  HKEYAFESYICQRMFSGFQQKNFSVNSESATVM-ADDDTDTFFRQFLALKDMDPLDALGT  257

Query  257  LPTCSFGNFCFKK  295
             P  +FG FC  K
Sbjct  258  NPDSNFGIFCRSK  270



>ref|XP_002524529.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37856.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            FA ES+V R++F GF    F + S  +SLL  +   +  F ++ +++++   + L   P 
Sbjct  271  FAFESFVCREIFDGFHLPNFSLPSE-SSLLERKNQNQLFFKRFTELRSVKAKDYLAQKPK  329

Query  266  CSFGNFCFKKFLTMVHPKMEES  331
             +F  FC  K+L +VHP+ME S
Sbjct  330  STFAKFCRAKYLQLVHPQMETS  351



>ref|XP_002316851.2| hypothetical protein POPTR_0011s10930g [Populus trichocarpa]
 gb|EEE97463.2| hypothetical protein POPTR_0011s10930g [Populus trichocarpa]
Length=436

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 45/82 (55%), Gaps = 2/82 (2%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            FA ES+V+R+MF GF    F +     SL   +  ++  F ++ ++K+    E +   P 
Sbjct  243  FAFESFVSREMFDGFHLPNFSLQEE--SLPEKKNQQQLFFRRFTELKSAKATEYIAHKPK  300

Query  266  CSFGNFCFKKFLTMVHPKMEES  331
             +F  FC  K+L ++HP+ME S
Sbjct  301  STFAKFCRAKYLQLIHPQMETS  322



>ref|XP_011080731.1| PREDICTED: uncharacterized protein LOC105163904 [Sesamum indicum]
Length=460

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 43/86 (50%), Gaps = 20/86 (23%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +H K+A E+YV R+MF GF  +  ++++                     MK  DP+  L 
Sbjct  280  SHKKYAFEAYVARRMFYGFSPQPCFLENI--------------------MKLDDPIVALM  319

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEES  331
              P  SF  FC  K+L ++HPKMEES
Sbjct  320  EDPKSSFAKFCRTKYLLVIHPKMEES  345



>ref|XP_007021901.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007021902.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007021904.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY13426.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY13427.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY13429.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=458

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            FA ES++ R+MF+ F +  F++     S+   ++H +  F ++ ++K+    E L   P 
Sbjct  269  FAFESFICREMFKAFHHPYFFLLGD--SVPEGKKHPQVFFERFMELKSTKAKEYLATKPK  326

Query  266  CSFGNFCFKKFLTMVHPKMEES  331
             +F  FC  K+L +VHPKME S
Sbjct  327  STFAKFCRIKYLQVVHPKMESS  348



>gb|ACD56624.1| UNE1-like protein [Gossypium raimondii]
Length=646

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 8/84 (10%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            +HA F  ES+V + M QGFD+  F   S   SL     HR   F  ++ +K+ +P   L 
Sbjct  245  SHACFLFESFVCKTMLQGFDSHDF---SGLKSL-----HREQYFNAFKTLKSANPKSFLV  296

Query  254  ILPTCSFGNFCFKKFLTMVHPKME  325
              P   F  F   K+L +VHPKME
Sbjct  297  QNPKSGFAKFIRDKYLKLVHPKME  320



>ref|XP_007021903.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY13428.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=418

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +2

Query  86   FALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGILPT  265
            FA ES++ R+MF+ F +  F++     S+   ++H +  F ++ ++K+    E L   P 
Sbjct  269  FAFESFICREMFKAFHHPYFFLLGD--SVPEGKKHPQVFFERFMELKSTKAKEYLATKPK  326

Query  266  CSFGNFCFKKFLTMVHPKMEES  331
             +F  FC  K+L +VHPKME S
Sbjct  327  STFAKFCRIKYLQVVHPKMESS  348



>gb|KHN06422.1| hypothetical protein glysoja_010766 [Glycine soja]
Length=420

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLGI  256
            H  FA ES+V   MF+GF+   F ++     +LH +  +   F +++ +K+L+P + L  
Sbjct  221  HQTFAFESFVCITMFEGFNYPNFNVEED--KILHKQGAQSLYFDKFKKLKSLNPKQYLTH  278

Query  257  LPTCSFGNFCFKKFLTMVHPKME  325
             P  SF  F   K+L +VH KME
Sbjct  279  NPNSSFSKFLKSKYLQVVHAKME  301



>ref|XP_004514642.1| PREDICTED: uncharacterized protein LOC101511857 isoform X1 [Cicer 
arietinum]
 ref|XP_004514643.1| PREDICTED: uncharacterized protein LOC101511857 isoform X2 [Cicer 
arietinum]
 ref|XP_004514644.1| PREDICTED: uncharacterized protein LOC101511857 isoform X3 [Cicer 
arietinum]
Length=459

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCF-AQYRDMKALDPVELL  250
            +H  FA+ES+V R+MF  F+   F + +       P++++   F  ++ ++K++   E L
Sbjct  256  DHKCFAIESFVCREMFDSFNFPNFNLSNESI----PDRNKTQFFFGRFNELKSMKAREFL  311

Query  251  GILPT-CSFGNFCFKKFLTMVHPKMEES  331
             + P+  SF  FC  K+L +VHPKME S
Sbjct  312  ALKPSSTSFAKFCRVKYLRLVHPKMEAS  339



>ref|XP_010106617.1| hypothetical protein L484_004846 [Morus notabilis]
 gb|EXC10947.1| hypothetical protein L484_004846 [Morus notabilis]
Length=477

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 0/87 (0%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDSRYASLLHPEQHRRDCFAQYRDMKALDPVELLG  253
            NH  FA ES+V++ MF+GF+  TF +++    +   +      F +++ ++ + P  L  
Sbjct  273  NHRCFAFESFVSKTMFEGFNFPTFNLENDSKIVGECDSQSEIFFDKFKKLRPVSPKHLFT  332

Query  254  ILPTCSFGNFCFKKFLTMVHPKMEESL  334
              P  SFG F   K+  +VH KME S+
Sbjct  333  QNPNSSFGKFLRVKYTQLVHAKMECSV  359



>emb|CDY41148.1| BnaA09g38670D [Brassica napus]
Length=464

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 45/89 (51%), Gaps = 13/89 (15%)
 Frame = +2

Query  74   NHAKFALESYVNRKMFQGFDNETFYMDS--RYASLLHPEQHRRDCFAQYRDMKALDPVEL  247
             H ++AL SYV   MF+GFD E F +D     +SL    QH            + +P+EL
Sbjct  278  GHNRYALLSYVCLGMFRGFDGEGFGLDGGEDSSSLRELMQH-----------VSSNPMEL  326

Query  248  LGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            L     C F  FC KK+  ++HP ME S+
Sbjct  327  LERDKECGFSRFCDKKYHELIHPNMESSI  355



>ref|XP_011017467.1| PREDICTED: uncharacterized protein LOC105120787 [Populus euphratica]
Length=487

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 4/90 (4%)
 Frame = +2

Query  77   HAKFALESYVNRKMFQGFDNETFYMDSRYA----SLLHPEQHRRDCFAQYRDMKALDPVE  244
            H ++A  SYV+  MF+GF+ E F ++S        L            Q  +  + +P+E
Sbjct  297  HNRYAFLSYVSLVMFKGFNLEGFGLESEGEVSCNRLGLDSVKSNSSLKQLLEHVSSNPME  356

Query  245  LLGILPTCSFGNFCFKKFLTMVHPKMEESL  334
            LL   PTC F  FC KK+  ++HP ME S+
Sbjct  357  LLSRNPTCEFSRFCEKKYQELMHPAMESSI  386



Lambda      K        H        a         alpha
   0.316    0.136    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517432785088