BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4724_g2_i1 len=777 path=[755:0-776]

Length=777
                                                                      Score     E

ref|XP_009798576.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    353   4e-116   
emb|CDO97475.1|  unnamed protein product                                353   6e-116   
ref|XP_009612013.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    351   2e-115   
ref|XP_011087845.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    350   7e-115   
ref|XP_006351803.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    346   2e-113   
ref|XP_004230575.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    346   3e-113   
gb|EYU18504.1|  hypothetical protein MIMGU_mgv1a005796mg                341   1e-111   
ref|XP_009379649.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    332   7e-108   
ref|XP_008391485.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    331   2e-107   
ref|XP_009362492.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    328   7e-107   
ref|XP_009362487.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    329   1e-106   
ref|XP_010261182.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    325   2e-105   
ref|XP_008218897.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    325   5e-105   
ref|XP_007222837.1|  hypothetical protein PRUPE_ppa005123mg             324   8e-105   
ref|XP_008339217.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    323   2e-104   
ref|XP_004300699.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    321   1e-103   
gb|KDO56540.1|  hypothetical protein CISIN_1g011952mg                   321   1e-103   
ref|XP_006432474.1|  hypothetical protein CICLE_v10001026mg             320   3e-103   
ref|XP_006493294.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    320   4e-103   
ref|XP_006493293.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    320   5e-103   
emb|CBI20047.3|  unnamed protein product                                317   9e-103   
ref|XP_010916926.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    317   4e-102   
ref|XP_004485556.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    317   9e-102   
ref|XP_004485555.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    317   1e-101   
ref|XP_010269155.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    315   2e-101   
gb|AFK39946.1|  unknown                                                 308   2e-101   
ref|XP_008798422.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    315   2e-101   
ref|XP_002271882.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    315   2e-101   Vitis vinifera
ref|XP_010047937.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    315   3e-101   
ref|XP_007159083.1|  hypothetical protein PHAVU_002G207100g             315   5e-101   
ref|XP_007043021.1|  Galactose oxidase/kelch repeat superfamily p...    314   6e-101   
ref|XP_004136863.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    314   7e-101   
ref|XP_002285816.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    313   1e-100   Vitis vinifera
ref|XP_002534256.1|  conserved hypothetical protein                     313   2e-100   Ricinus communis
gb|EPS71394.1|  hypothetical protein M569_03361                         317   3e-100   
ref|XP_006434051.1|  hypothetical protein CICLE_v10001023mg             311   5e-100   
ref|XP_003593163.1|  F-box/kelch-repeat protein                         311   6e-100   
ref|XP_006472657.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    311   7e-100   
ref|XP_003531046.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    311   9e-100   
gb|AFY26883.1|  F-box family protein                                    311   1e-99    
ref|XP_008455232.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    310   2e-99    
ref|XP_011027666.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    308   8e-99    
ref|XP_002302274.2|  hypothetical protein POPTR_0002s09250g             308   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_004515647.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    308   2e-98    
ref|XP_010105865.1|  F-box/kelch-repeat protein                         307   4e-98    
gb|KHN06826.1|  F-box/kelch-repeat protein                              306   9e-98    
ref|XP_003524750.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    306   9e-98    
ref|XP_006416237.1|  hypothetical protein EUTSA_v10007536mg             306   1e-97    
gb|KEH34863.1|  galactose oxidase/kelch repeat protein                  305   3e-97    
gb|KDP37916.1|  hypothetical protein JCGZ_05355                         304   5e-97    
ref|NP_173623.1|  F-box/kelch-repeat protein                            303   7e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KDP32711.1|  hypothetical protein JCGZ_12003                         303   8e-97    
ref|XP_011010352.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    303   8e-97    
ref|XP_003526599.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    303   1e-96    
ref|XP_009347210.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    303   2e-96    
ref|XP_010905931.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    303   2e-96    
emb|CAN63480.1|  hypothetical protein VITISV_011508                     303   3e-96    Vitis vinifera
ref|XP_006307263.1|  hypothetical protein CARUB_v10008879mg             303   5e-96    
ref|XP_010459928.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    301   6e-96    
ref|XP_008352663.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    301   7e-96    
ref|XP_010477456.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    301   7e-96    
ref|XP_010498664.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    301   9e-96    
ref|XP_009145380.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    300   1e-95    
ref|XP_007136207.1|  hypothetical protein PHAVU_009G027300g             300   2e-95    
ref|XP_002890487.1|  kelch repeat-containing F-box family protein       300   2e-95    
ref|XP_002306596.1|  kelch repeat-containing F-box family protein       298   9e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008347767.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    298   1e-94    
ref|XP_008378506.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    297   2e-94    
ref|XP_008233978.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    296   1e-93    
ref|NP_001064441.1|  Os10g0363600                                       295   1e-93    Oryza sativa Japonica Group [Japonica rice]
gb|EAY78181.1|  hypothetical protein OsI_33229                          295   1e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_009345524.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    295   2e-93    
ref|XP_006827020.1|  hypothetical protein AMTR_s00010p00220140          295   2e-93    
ref|XP_003544176.2|  PREDICTED: F-box/kelch-repeat protein At1g22...    293   9e-93    
gb|KHN26062.1|  F-box/kelch-repeat protein                              293   9e-93    
ref|XP_010691533.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    293   1e-92    
ref|XP_010539614.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    292   2e-92    
ref|XP_007222822.1|  hypothetical protein PRUPE_ppa005093mg             292   2e-92    
ref|NP_001047209.1|  Os02g0574900                                       291   3e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403337.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    292   3e-92    
ref|XP_006661717.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    292   3e-92    
ref|XP_002513866.1|  conserved hypothetical protein                     291   7e-92    Ricinus communis
ref|XP_004983240.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    290   1e-91    
ref|XP_003542593.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    289   3e-91    
ref|XP_006647411.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    289   3e-91    
ref|XP_004300659.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    287   3e-90    
ref|XP_003575210.1|  PREDICTED: F-box/kelch-repeat protein At1g22040    286   3e-90    
ref|XP_004952865.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    285   7e-90    
gb|ABR16276.1|  unknown                                                 285   1e-89    Picea sitchensis
dbj|BAK00470.1|  predicted protein                                      284   2e-89    
ref|XP_009380839.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    283   8e-89    
ref|XP_007141132.1|  hypothetical protein PHAVU_008G170100g             282   3e-88    
ref|XP_001770485.1|  predicted protein                                  280   4e-88    
ref|XP_002452328.1|  hypothetical protein SORBIDRAFT_04g023750          280   1e-87    Sorghum bicolor [broomcorn]
gb|EMT28646.1|  hypothetical protein F775_12734                         281   2e-87    
ref|NP_001147929.1|  LOC100281539                                       278   3e-87    Zea mays [maize]
ref|XP_010541375.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    276   5e-86    
dbj|BAJ94310.1|  predicted protein                                      275   7e-86    
ref|XP_001761819.1|  predicted protein                                  273   3e-85    
gb|EYU35402.1|  hypothetical protein MIMGU_mgv1a005531mg                270   1e-83    
ref|XP_009103266.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    258   4e-79    
ref|XP_002978198.1|  hypothetical protein SELMODRAFT_152334             255   9e-79    
gb|KHN24790.1|  F-box/kelch-repeat protein                              254   1e-78    
ref|XP_002966362.1|  hypothetical protein SELMODRAFT_85806              254   6e-78    
gb|ACG30137.1|  kelch motif family protein                              236   9e-71    Zea mays [maize]
ref|NP_001131732.1|  uncharacterized protein LOC100193097               236   2e-70    Zea mays [maize]
gb|ACL53215.1|  unknown                                                 235   2e-70    Zea mays [maize]
ref|XP_009390298.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    216   7e-63    
ref|XP_009390297.1|  PREDICTED: F-box/kelch-repeat protein At1g22...    216   8e-63    
emb|CDY01300.1|  BnaA07g10730D                                          200   1e-59    
emb|CDY00415.1|  BnaC07g14110D                                          198   4e-59    
gb|KHN42571.1|  F-box/kelch-repeat protein                              194   1e-57    
gb|ACU19665.1|  unknown                                                 125   4e-30    Glycine max [soybeans]
emb|CBI19111.3|  unnamed protein product                                110   7e-25    
ref|XP_002461470.1|  hypothetical protein SORBIDRAFT_02g003160        90.9    1e-17    Sorghum bicolor [broomcorn]
gb|EEC73460.1|  hypothetical protein OsI_07769                        88.6    4e-17    Oryza sativa Indica Group [Indian rice]
ref|XP_004955477.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  89.4    4e-17    
ref|NP_001058912.1|  Os07g0153400                                     88.2    1e-16    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02807.1|  hypothetical protein OsI_24933                        87.8    2e-16    Oryza sativa Indica Group [Indian rice]
ref|XP_006657454.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  87.0    3e-16    
emb|CDP15791.1|  unnamed protein product                              87.0    3e-16    
ref|XP_002976330.1|  hypothetical protein SELMODRAFT_55890            86.7    3e-16    
ref|XP_002987314.1|  hypothetical protein SELMODRAFT_183002           86.3    6e-16    
ref|XP_010110957.1|  F-box/kelch-repeat protein                       85.9    7e-16    
dbj|BAJ94540.1|  predicted protein                                    85.5    9e-16    
emb|CDY30645.1|  BnaAnng04200D                                        82.4    2e-15    
ref|XP_008365269.1|  PREDICTED: F-box/kelch-repeat protein At1g22...  83.2    2e-15    
ref|XP_004486017.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  84.7    2e-15    
ref|XP_009778334.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  84.0    3e-15    
ref|XP_009609743.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  83.6    4e-15    
gb|EMS50967.1|  hypothetical protein TRIUR3_10316                     80.1    5e-15    
gb|KHM98930.1|  F-box/kelch-repeat protein                            80.1    9e-15    
ref|XP_008812564.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  82.4    1e-14    
ref|XP_004163017.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  80.9    1e-14    
ref|XP_004149669.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  82.0    1e-14    
ref|XP_008444396.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  82.0    1e-14    
ref|XP_007025062.1|  Galactose oxidase/kelch repeat superfamily p...  81.6    2e-14    
ref|XP_003557654.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  81.6    2e-14    
ref|XP_003546081.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  81.3    2e-14    
ref|XP_002519667.1|  Protein AFR, putative                            81.3    3e-14    Ricinus communis
ref|XP_006359093.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  80.1    6e-14    
gb|KHN47330.1|  F-box/kelch-repeat protein                            80.1    7e-14    
ref|XP_002309296.2|  kelch repeat-containing F-box family protein     80.1    7e-14    Populus trichocarpa [western balsam poplar]
ref|XP_002277472.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  80.1    8e-14    Vitis vinifera
ref|XP_003593908.1|  F-box/kelch-repeat protein                       79.7    9e-14    
ref|XP_003542937.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  79.3    1e-13    
emb|CBI30913.3|  unnamed protein product                              79.3    1e-13    
ref|XP_011085241.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  79.0    2e-13    
ref|XP_008371760.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  79.0    2e-13    
ref|XP_011085238.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  79.0    2e-13    
ref|XP_008225493.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  78.6    2e-13    
ref|XP_010549492.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  78.6    2e-13    
ref|XP_008366003.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  78.2    3e-13    
ref|XP_009360894.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  78.2    3e-13    
gb|EPS62277.1|  hypothetical protein M569_12514                       78.2    3e-13    
ref|XP_007213953.1|  hypothetical protein PRUPE_ppa006572mg           78.2    3e-13    
gb|KDP37984.1|  hypothetical protein JCGZ_04627                       77.8    4e-13    
ref|XP_004231551.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  77.8    4e-13    
emb|CDY04697.1|  BnaC05g17350D                                        75.5    5e-13    
ref|XP_011096579.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  77.4    5e-13    
ref|XP_006307712.1|  hypothetical protein CARUB_v10009351mg           77.4    6e-13    
ref|XP_007147912.1|  hypothetical protein PHAVU_006G165500g           77.0    7e-13    
gb|ACN27709.1|  unknown                                               77.0    8e-13    Zea mays [maize]
ref|XP_011005285.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  77.0    8e-13    
ref|XP_009406705.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  77.0    9e-13    
ref|XP_010460786.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  76.6    1e-12    
ref|XP_010499524.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  76.6    1e-12    
ref|XP_010478381.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  76.3    1e-12    
ref|XP_010686268.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  76.3    1e-12    
ref|XP_004293578.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  75.9    2e-12    
ref|XP_004292876.1|  PREDICTED: F-box protein AFR-like                75.5    2e-12    
ref|XP_006467457.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  75.5    3e-12    
ref|XP_006449707.1|  hypothetical protein CICLE_v10015483mg           75.5    3e-12    
gb|KHG22975.1|  hypothetical protein F383_01278                       75.1    4e-12    
ref|XP_006836439.1|  hypothetical protein AMTR_s00092p00167170        75.1    4e-12    
ref|XP_007014726.1|  Galactose oxidase/kelch repeat superfamily p...  75.1    4e-12    
gb|EYU43259.1|  hypothetical protein MIMGU_mgv1a026903mg              74.7    5e-12    
ref|XP_002283484.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  74.7    6e-12    Vitis vinifera
emb|CDX76807.1|  BnaC08g33930D                                        74.3    6e-12    
ref|XP_008775369.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  73.6    1e-11    
gb|ACU18853.1|  unknown                                               71.6    1e-11    Glycine max [soybeans]
ref|XP_002893599.1|  kelch repeat-containing F-box family protein     73.6    1e-11    
gb|KDP26940.1|  hypothetical protein JCGZ_21033                       73.6    1e-11    
ref|XP_010941194.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  73.6    1e-11    
ref|XP_006415514.1|  hypothetical protein EUTSA_v10007818mg           73.2    2e-11    
emb|CDY34765.1|  BnaA09g41320D                                        72.8    2e-11    
emb|CDX99882.1|  BnaC05g23040D                                        72.8    2e-11    
ref|XP_009115192.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  72.8    2e-11    
ref|XP_006578204.1|  PREDICTED: F-box protein AFR-like                72.4    3e-11    
ref|NP_564347.1|  F-box/kelch-repeat protein                          72.0    4e-11    Arabidopsis thaliana [mouse-ear cress]
emb|CDY26295.1|  BnaA09g26460D                                        72.0    4e-11    
ref|XP_010417210.1|  PREDICTED: F-box protein AFR-like                71.6    5e-11    
ref|XP_002527061.1|  Protein AFR, putative                            72.0    5e-11    Ricinus communis
gb|EPS58278.1|  hypothetical protein M569_16536                       71.2    7e-11    
ref|XP_010908284.1|  PREDICTED: F-box/kelch-repeat protein At1g30...  71.2    7e-11    
gb|KHG22974.1|  hypothetical protein F383_01277                       71.2    7e-11    
ref|XP_009117120.1|  PREDICTED: F-box protein AFR                     70.9    8e-11    
ref|XP_009375482.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  71.2    9e-11    
ref|XP_006842862.1|  hypothetical protein AMTR_s00081p00156000        70.1    1e-10    
ref|XP_010534884.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  70.9    1e-10    
ref|XP_010247992.1|  PREDICTED: F-box/kelch-repeat protein At1g30090  70.5    1e-10    
ref|XP_010429433.1|  PREDICTED: F-box protein AFR-like                70.5    1e-10    
ref|XP_004228650.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  70.5    1e-10    
ref|XP_007222191.1|  hypothetical protein PRUPE_ppa010058mg           69.3    1e-10    
gb|AFW61308.1|  hypothetical protein ZEAMMB73_460431                  65.9    2e-10    
ref|XP_003524946.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  70.1    2e-10    
ref|XP_011025173.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  69.3    3e-10    
ref|XP_004294988.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  69.3    3e-10    
ref|XP_009785252.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.9    4e-10    
ref|XP_006354154.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.9    4e-10    
ref|XP_009785251.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.9    5e-10    
ref|XP_003527811.2|  PREDICTED: F-box protein AFR-like                68.6    5e-10    
ref|XP_009603914.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.9    5e-10    
ref|XP_009603913.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.6    5e-10    
ref|XP_008219946.1|  PREDICTED: F-box protein AFR                     68.2    6e-10    
ref|XP_006404987.1|  hypothetical protein EUTSA_v10000205mg           68.2    7e-10    
ref|XP_011089119.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  68.2    8e-10    
ref|XP_008351710.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.2    9e-10    
ref|XP_008344671.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  68.2    9e-10    
ref|XP_002304010.2|  kelch repeat-containing F-box family protein     68.2    9e-10    Populus trichocarpa [western balsam poplar]
ref|XP_010914885.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  67.4    1e-09    
ref|XP_004501240.1|  PREDICTED: F-box protein AFR-like isoform X1     67.0    1e-09    
ref|XP_008347651.1|  PREDICTED: F-box protein AFR-like                67.4    1e-09    
ref|XP_008378156.1|  PREDICTED: F-box protein AFR-like                67.4    1e-09    
ref|XP_004501241.1|  PREDICTED: F-box protein AFR-like isoform X2     67.0    2e-09    
emb|CCH50979.1|  T4.18                                                67.4    2e-09    
ref|XP_009353344.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  67.0    2e-09    
ref|XP_009348468.1|  PREDICTED: F-box protein AFR-like                67.0    2e-09    
ref|XP_006294444.1|  hypothetical protein CARUB_v10023458mg           67.0    2e-09    
ref|XP_008393946.1|  PREDICTED: F-box protein AFR                     66.6    2e-09    
ref|XP_003531234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  66.6    2e-09    
ref|XP_010047816.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  66.6    3e-09    
ref|XP_006341889.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  66.6    3e-09    
ref|XP_009368827.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  66.6    3e-09    
ref|XP_010472463.1|  PREDICTED: F-box protein AFR                     66.2    3e-09    
ref|XP_010656414.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  66.6    3e-09    
gb|EYU24437.1|  hypothetical protein MIMGU_mgv1a024107mg              65.1    5e-09    
ref|XP_004142161.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.9    5e-09    
ref|XP_010688025.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.9    5e-09    
ref|XP_010688026.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.9    5e-09    
gb|KDP33188.1|  hypothetical protein JCGZ_12710                       65.5    5e-09    
ref|XP_009364116.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.9    5e-09    
ref|XP_008449801.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  65.9    5e-09    
ref|XP_008337311.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.5    6e-09    
ref|XP_011089699.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.5    6e-09    
ref|XP_003629702.1|  F-box/kelch-repeat protein                       65.5    7e-09    
ref|XP_004504335.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  65.5    7e-09    
ref|XP_006845596.1|  hypothetical protein AMTR_s00019p00203560        65.1    7e-09    
gb|EYU39246.1|  hypothetical protein MIMGU_mgv1a006629mg              64.7    9e-09    
gb|EYU24438.1|  hypothetical protein MIMGU_mgv1a026698mg              64.3    9e-09    
ref|XP_010032898.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  64.7    1e-08    
ref|XP_007159399.1|  hypothetical protein PHAVU_002G235000g           64.7    1e-08    
ref|XP_007013402.1|  Galactose oxidase/kelch repeat superfamily p...  64.7    1e-08    
ref|XP_002878767.1|  hypothetical protein ARALYDRAFT_481310           64.3    1e-08    
ref|XP_007159398.1|  hypothetical protein PHAVU_002G235000g           64.7    1e-08    
ref|XP_007013397.1|  Galactose oxidase/kelch repeat superfamily p...  64.7    1e-08    
ref|XP_007202129.1|  hypothetical protein PRUPE_ppa006078mg           64.7    1e-08    
emb|CAN63498.1|  hypothetical protein VITISV_011673                   64.3    1e-08    Vitis vinifera
gb|EYU39245.1|  hypothetical protein MIMGU_mgv1a006629mg              64.3    2e-08    
gb|KDP32382.1|  hypothetical protein JCGZ_13307                       64.3    2e-08    
ref|XP_008242752.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  64.3    2e-08    
ref|XP_003524553.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  64.3    2e-08    
ref|XP_007011603.1|  Galactose oxidase/kelch repeat superfamily p...  63.9    2e-08    
ref|XP_010250048.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  63.9    2e-08    
gb|KHN10269.1|  F-box protein AFR                                     60.8    2e-08    
gb|KHG13775.1|  hypothetical protein F383_18309                       63.5    3e-08    
emb|CDP17358.1|  unnamed protein product                              63.5    3e-08    
ref|XP_006450966.1|  hypothetical protein CICLE_v10008382mg           63.5    3e-08    
ref|XP_010250049.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  63.5    3e-08    
ref|XP_008803430.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  63.5    3e-08    
gb|KFK32651.1|  hypothetical protein AALP_AA6G270800                  63.5    3e-08    
gb|AAM65112.1|  unknown                                               63.5    3e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925232.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  63.5    3e-08    
ref|XP_004287344.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  63.2    3e-08    
gb|KHN23508.1|  F-box/kelch-repeat protein                            63.2    4e-08    
ref|XP_003554163.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.8    5e-08    
ref|XP_006445823.1|  hypothetical protein CICLE_v10015292mg           62.8    5e-08    
ref|XP_010101133.1|  F-box/kelch-repeat protein                       62.8    5e-08    
gb|ABA26994.1|  TO42-3rc                                              59.3    5e-08    Taraxacum officinale [dandelion]
ref|XP_009763739.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.8    5e-08    
ref|XP_010925234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.8    6e-08    
ref|XP_009103742.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.4    7e-08    
emb|CDY08233.1|  BnaA05g13860D                                        62.4    7e-08    
emb|CDY26117.1|  BnaC06g10790D                                        62.4    8e-08    
ref|XP_010259784.1|  PREDICTED: F-box protein AFR-like                62.0    8e-08    
ref|XP_004508512.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.0    9e-08    
ref|XP_010257584.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  62.0    9e-08    
ref|XP_007154990.1|  hypothetical protein PHAVU_003G163600g           62.0    9e-08    
gb|EYU29783.1|  hypothetical protein MIMGU_mgv1a010673mg              61.6    1e-07    
ref|XP_002971565.1|  hypothetical protein SELMODRAFT_95487            61.6    1e-07    
ref|NP_565572.1|  F-box protein AFR                                   61.6    1e-07    
gb|EMT18179.1|  hypothetical protein F775_31347                       61.6    1e-07    
ref|XP_006392663.1|  hypothetical protein EUTSA_v10011496mg           61.6    1e-07    
ref|XP_011048245.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  61.6    1e-07    
ref|XP_011010684.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  61.6    1e-07    
ref|XP_008778886.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  61.6    1e-07    
ref|XP_010932959.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  61.6    1e-07    
ref|XP_011048244.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  61.6    1e-07    
ref|XP_011010683.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  61.2    2e-07    
ref|XP_010265499.1|  PREDICTED: F-box protein AFR-like                61.2    2e-07    
ref|XP_002297645.2|  hypothetical protein POPTR_0001s04530g           61.2    2e-07    
gb|KHG17908.1|  hypothetical protein F383_22040                       61.6    2e-07    
ref|XP_001753278.1|  predicted protein                                61.2    2e-07    
emb|CDY10574.1|  BnaC03g70400D                                        61.2    2e-07    
gb|KDO67306.1|  hypothetical protein CISIN_1g017349mg                 60.8    2e-07    
ref|XP_004228331.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  60.8    2e-07    
ref|NP_001168450.1|  uncharacterized protein LOC100382223             60.8    2e-07    
ref|XP_010093732.1|  F-box/kelch-repeat protein                       60.8    2e-07    
emb|CDY02451.1|  BnaA08g00580D                                        60.8    2e-07    
ref|XP_009106890.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  60.8    3e-07    
ref|XP_010049825.1|  PREDICTED: F-box protein AFR                     60.5    3e-07    
ref|XP_006483556.1|  PREDICTED: F-box protein AFR-like                60.5    3e-07    
ref|XP_002524541.1|  Protein AFR, putative                            60.1    3e-07    
gb|AFK40250.1|  unknown                                               60.5    3e-07    
ref|XP_002963430.1|  hypothetical protein SELMODRAFT_79476            60.5    3e-07    
ref|XP_010243433.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  60.5    3e-07    
ref|XP_002524469.1|  Protein AFR, putative                            60.5    3e-07    
ref|XP_009626412.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  60.5    4e-07    
gb|KHN14372.1|  F-box/kelch-repeat protein                            60.1    4e-07    
ref|XP_006848402.1|  hypothetical protein AMTR_s00013p00223980        57.4    4e-07    
ref|NP_001142379.1|  hypothetical protein                             60.1    5e-07    
ref|XP_006450184.1|  hypothetical protein CICLE_v10008681mg           59.7    5e-07    
emb|CDX96551.1|  BnaA07g31620D                                        59.7    5e-07    
ref|XP_006307563.1|  hypothetical protein CARUB_v10009185mg           59.7    6e-07    
ref|XP_002894497.1|  kelch repeat-containing F-box family protein     59.7    6e-07    
emb|CDY33062.1|  BnaC06g07170D                                        59.3    7e-07    
ref|NP_564684.1|  Galactose oxidase/kelch repeat superfamily protein  59.3    7e-07    
ref|XP_006450183.1|  hypothetical protein CICLE_v10008681mg           59.3    7e-07    
ref|XP_010480054.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  59.3    8e-07    
gb|KHG30540.1|  hypothetical protein F383_04954                       59.3    8e-07    
ref|XP_010462371.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  59.3    8e-07    
ref|XP_002438780.1|  hypothetical protein SORBIDRAFT_10g026080        59.3    8e-07    
ref|XP_004965687.1|  PREDICTED: F-box protein AFR-like                58.9    9e-07    
ref|XP_007137123.1|  hypothetical protein PHAVU_009G101500g           58.9    9e-07    
ref|XP_006598348.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  59.3    9e-07    
ref|XP_010092046.1|  F-box/kelch-repeat protein SKIP11                59.3    1e-06    
ref|XP_009387460.1|  PREDICTED: F-box protein AFR                     58.5    1e-06    
ref|XP_004150018.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  58.5    1e-06    
ref|XP_008385738.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  58.2    2e-06    
ref|XP_008444019.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  58.2    2e-06    
emb|CBI20760.3|  unnamed protein product                              57.8    2e-06    
ref|XP_002282492.1|  PREDICTED: F-box protein AFR                     57.8    3e-06    
ref|XP_008784962.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  57.8    3e-06    
ref|XP_010251859.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  57.8    3e-06    
ref|XP_010501139.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  57.8    3e-06    
ref|XP_010251857.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  57.4    3e-06    
ref|XP_011044991.1|  PREDICTED: F-box protein AFR                     57.4    3e-06    
ref|XP_010913637.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  57.4    4e-06    
ref|XP_009411265.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  57.0    4e-06    
ref|XP_009411264.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  57.0    4e-06    
ref|XP_010258666.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  57.0    5e-06    
ref|XP_002978427.1|  hypothetical protein SELMODRAFT_443893           57.0    5e-06    
ref|XP_003563353.1|  PREDICTED: F-box protein AFR                     57.0    5e-06    
ref|XP_009147515.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  57.0    5e-06    
ref|XP_002970270.1|  hypothetical protein SELMODRAFT_411144           57.0    5e-06    
ref|XP_008789681.1|  PREDICTED: F-box protein AFR-like                56.6    5e-06    
ref|XP_010258664.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  56.6    6e-06    
ref|XP_001763146.1|  predicted protein                                56.6    7e-06    
ref|XP_004983160.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  56.2    9e-06    
ref|XP_010261109.1|  PREDICTED: F-box/kelch-repeat protein SKIP6-...  55.8    1e-05    
ref|XP_002324389.2|  kelch repeat-containing F-box family protein     55.8    1e-05    
ref|XP_002511553.1|  conserved hypothetical protein                   55.8    1e-05    
ref|XP_011084133.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  55.5    1e-05    
ref|XP_010928644.1|  PREDICTED: F-box protein AFR-like                55.5    1e-05    
ref|XP_009775831.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  55.5    1e-05    
ref|XP_010029411.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  55.5    2e-05    
ref|XP_010029402.1|  PREDICTED: F-box/kelch-repeat protein At1g74...  55.5    2e-05    
ref|XP_009616656.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  55.5    2e-05    
ref|XP_006848406.1|  hypothetical protein AMTR_s00013p00224730        54.3    2e-05    
gb|EYU22433.1|  hypothetical protein MIMGU_mgv1a006867mg              55.1    2e-05    
ref|XP_010243345.1|  PREDICTED: F-box/kelch-repeat protein SKIP6-...  54.7    2e-05    
gb|ADE76822.1|  unknown                                               54.7    3e-05    
ref|XP_007205219.1|  hypothetical protein PRUPE_ppa005930mg           54.7    3e-05    
ref|XP_002453508.1|  hypothetical protein SORBIDRAFT_04g007050        53.9    3e-05    
dbj|BAJ93429.1|  predicted protein                                    54.3    3e-05    
gb|ACN29000.1|  unknown                                               53.5    3e-05    
ref|XP_003609293.1|  F-box/kelch-repeat protein                       54.3    4e-05    
ref|XP_007037286.1|  Galactose oxidase/kelch repeat superfamily p...  54.3    4e-05    
ref|XP_008243705.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  54.3    4e-05    
ref|XP_010673508.1|  PREDICTED: F-box/kelch-repeat protein At1g55270  54.3    4e-05    
ref|XP_008643766.1|  PREDICTED: ring canal kelch isoform X1           54.3    4e-05    
ref|XP_008643767.1|  PREDICTED: ring canal kelch isoform X2           54.3    4e-05    
ref|XP_002986659.1|  hypothetical protein SELMODRAFT_14013            53.9    5e-05    
emb|CDY24045.1|  BnaA06g00430D                                        53.9    5e-05    
ref|XP_011047165.1|  PREDICTED: F-box/kelch-repeat protein At1g74...  53.9    5e-05    
ref|XP_006374475.1|  hypothetical protein POPTR_0015s07450g           53.9    5e-05    
gb|KHG02741.1|  hypothetical protein F383_24943                       53.9    5e-05    
gb|KDR14136.1|  Kelch-like protein 10                                 53.5    7e-05    
ref|WP_036222499.1|  hypothetical protein                             52.8    8e-05    
ref|NP_001058250.1|  Os06g0655500                                     52.8    1e-04    
gb|EPS65830.1|  hypothetical protein M569_08947                       52.8    1e-04    
ref|XP_001757985.1|  predicted protein                                53.1    1e-04    
ref|XP_010242420.1|  PREDICTED: F-box/kelch-repeat protein At1g74...  52.8    1e-04    
ref|XP_003603538.1|  F-box protein AFR                                52.8    1e-04    
emb|CAN81325.1|  hypothetical protein VITISV_041844                   52.8    1e-04    
gb|EEE66144.1|  hypothetical protein OsJ_22209                        52.8    1e-04    
ref|XP_009626852.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  52.8    1e-04    
ref|XP_007029697.1|  Galactose oxidase/kelch repeat superfamily p...  52.8    1e-04    
gb|ACN32130.1|  unknown                                               52.8    1e-04    
ref|NP_001131994.1|  uncharacterized protein LOC100193397             52.8    1e-04    
gb|KDP31229.1|  hypothetical protein JCGZ_11605                       52.8    1e-04    
ref|XP_004976835.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  52.4    2e-04    
ref|XP_006591916.1|  PREDICTED: uncharacterized protein LOC100820...  52.4    2e-04    
ref|XP_009388524.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  52.4    2e-04    
gb|KDP39547.1|  hypothetical protein JCGZ_02567                       52.4    2e-04    
emb|CDP12901.1|  unnamed protein product                              52.0    2e-04    
ref|XP_004976834.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  52.4    2e-04    
gb|ADE76420.1|  unknown                                               52.0    2e-04    
ref|XP_008384436.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-...  52.0    2e-04    
ref|XP_002270236.1|  PREDICTED: F-box/kelch-repeat protein At5g60570  52.0    2e-04    
ref|XP_006854495.1|  hypothetical protein AMTR_s00175p00042660        52.0    2e-04    
ref|XP_007031854.1|  Galactose oxidase/kelch repeat superfamily p...  51.6    3e-04    
gb|KHN11207.1|  F-box/kelch-repeat protein                            51.2    3e-04    
gb|AAG51566.1|AC027034_12  unknown protein; 58496-60308               51.6    3e-04    
ref|XP_011014116.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  51.6    3e-04    
ref|XP_002325447.1|  hypothetical protein POPTR_0019s05890g           51.6    3e-04    
ref|XP_011044439.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  51.6    3e-04    
gb|KHN19693.1|  F-box/kelch-repeat protein                            51.6    3e-04    
ref|NP_001148154.1|  kelch motif family protein                       51.6    3e-04    
ref|XP_008661907.1|  PREDICTED: kelch motif family protein isofor...  51.6    3e-04    
ref|XP_009778034.1|  PREDICTED: F-box/kelch-repeat protein SKIP11...  51.2    3e-04    
ref|XP_006652834.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  51.2    4e-04    
ref|XP_006362783.1|  PREDICTED: F-box/kelch-repeat protein SKIP6-...  51.2    4e-04    
gb|EMT13185.1|  hypothetical protein F775_10092                       51.2    4e-04    
ref|XP_011044437.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  51.2    4e-04    
ref|XP_002319782.2|  hypothetical protein POPTR_0013s07540g           51.2    4e-04    
ref|XP_010258665.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  50.8    5e-04    
ref|XP_008781021.1|  PREDICTED: F-box/kelch-repeat protein SKIP6-...  50.8    5e-04    
ref|XP_006848409.1|  hypothetical protein AMTR_s00013p00225830        50.8    5e-04    
ref|XP_003580564.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  50.8    5e-04    
ref|XP_003580566.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  50.8    5e-04    
gb|KFE65313.1|  High-affinity leucine-specific transport system, ...  51.2    5e-04    
ref|XP_002464634.1|  hypothetical protein SORBIDRAFT_01g022240        50.8    5e-04    
ref|XP_009383687.1|  PREDICTED: F-box/kelch-repeat protein At5g60...  50.8    6e-04    
dbj|BAJ98018.1|  predicted protein                                    50.8    6e-04    
gb|EYU31090.1|  hypothetical protein MIMGU_mgv1a021636mg              50.4    6e-04    
ref|XP_010250755.1|  PREDICTED: F-box/kelch-repeat protein At3g27...  50.4    6e-04    
ref|NP_001053897.2|  Os04g0619300                                     50.4    6e-04    
ref|XP_009106118.1|  PREDICTED: F-box/kelch-repeat protein At1g74...  50.4    7e-04    
ref|XP_008667595.1|  PREDICTED: hypothetical protein isoform X1       50.4    7e-04    
ref|NP_001142058.1|  hypothetical protein                             50.4    7e-04    
ref|XP_004951526.1|  PREDICTED: F-box/kelch-repeat protein At1g55...  50.4    7e-04    
ref|XP_008801992.1|  PREDICTED: F-box protein AFR-like                50.4    7e-04    
ref|WP_037968713.1|  hypothetical protein                             50.1    8e-04    
ref|NP_001064574.1|  Os10g0409900                                     50.4    8e-04    
gb|EAZ16045.1|  hypothetical protein OsJ_31487                        50.4    8e-04    
ref|XP_007207467.1|  hypothetical protein PRUPE_ppa006004mg           50.1    8e-04    
ref|XP_007132245.1|  hypothetical protein PHAVU_011G078400g           50.1    8e-04    
gb|EEC66927.1|  hypothetical protein OsI_33535                        50.1    9e-04    
emb|CBI15248.3|  unnamed protein product                              50.1    9e-04    
ref|NP_001242021.1|  uncharacterized protein LOC100820005             50.1    9e-04    
emb|CAJ86133.1|  H0313F03.20                                          50.1    0.001    



>ref|XP_009798576.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
 ref|XP_009798577.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
 ref|XP_009798578.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
 ref|XP_009798579.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
 ref|XP_009798580.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
 ref|XP_009798581.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana sylvestris]
Length=472

 Score =   353 bits (906),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 192/230 (83%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W EVPSMPF+KA MLPTAFLAD LKPIATG++SY+GKLYVPQSLY
Sbjct  245  TPLQSAEVFDPHTGVWSEVPSMPFSKAQMLPTAFLADLLKPIATGMTSYQGKLYVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETNAWVEMP+GMG+GWPARQAGTKLSV V+GELYALDPS++ DSA
Sbjct  305  CWPFFVDVGGEVYDPETNAWVEMPIGMGDGWPARQAGTKLSVTVEGELYALDPSTTLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            +IKVYD +DDSWK IEGDIPI D  DSESPYLLAG LGKL+VI KDAN NI+V+QADRQ 
Sbjct  365  RIKVYDHQDDSWKVIEGDIPIND--DSESPYLLAGFLGKLHVITKDANHNIMVMQADRQN  422

Query  539  --------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          H   E    S+AN+WRVIASR+ GSAEL+SCQILD+
Sbjct  423  HLVPSPSTSSNKIVHEVPELVLGSEANMWRVIASRSGGSAELVSCQILDV  472



>emb|CDO97475.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   353 bits (905),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/235 (74%), Positives = 198/235 (84%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEVFDP TGIW EVPSMPF+KA M+PTAFLAD LKP+ATG++SYRGKLYVPQSL+
Sbjct  245  SPLQSAEVFDPRTGIWSEVPSMPFSKAQMMPTAFLADILKPVATGMTSYRGKLYVPQSLF  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETN+WVEMPMGMGEGWPARQAGTKLSVIVDG+LYALDPSSS DSA
Sbjct  305  CWPFFVDVGGEVYDPETNSWVEMPMGMGEGWPARQAGTKLSVIVDGDLYALDPSSSLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLT--DSESPYLLAGLLGKLNVIAKDANQNILVLQADR  535
            +IK YD RDD+WKA+ GD+PIRDLT  DSESPYLLAG LGKL+VI KDANQNILVLQAD 
Sbjct  365  RIKFYDHRDDTWKAVRGDVPIRDLTDSDSESPYLLAGFLGKLHVITKDANQNILVLQADW  424

Query  536  QH----------NQNENEKE--------SDANIWRVIASRNSGSAELISCQILDM  646
            ++          + +E+ KE        S+A +W VIA+R++GSAEL+SCQILD 
Sbjct  425  RNQLASQSASSVSLDESSKEELSVPVAGSEAILWNVIANRSAGSAELVSCQILDF  479



>ref|XP_009612013.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana tomentosiformis]
 ref|XP_009612014.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana tomentosiformis]
 ref|XP_009612015.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Nicotiana tomentosiformis]
Length=472

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 191/230 (83%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TGIW EVPSMPF+KA MLPTAFLAD LKPIATG++SY+GKLYVPQSLY
Sbjct  245  TPLQSAEVFDPHTGIWSEVPSMPFSKAQMLPTAFLADLLKPIATGMTSYQGKLYVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETNAWVEMP+GMG+GWPARQAGTKLSV V+GELYALDPS++ DSA
Sbjct  305  CWPFFVDVGGEVYDPETNAWVEMPIGMGDGWPARQAGTKLSVTVEGELYALDPSTTLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            +IKVYD +DD+WK IEGDIPI D  DSESPYLLAG LGKL+VI KDAN NI+V+QADRQ 
Sbjct  365  RIKVYDHQDDTWKVIEGDIPIND--DSESPYLLAGFLGKLHVITKDANHNIMVMQADRQN  422

Query  539  --------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          H   E    S+AN+WRVIASR+ GS EL+SCQILD+
Sbjct  423  HSVPSPSTSSNKIVHEVPELVLGSEANMWRVIASRSGGSVELVSCQILDV  472



>ref|XP_011087845.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Sesamum indicum]
Length=474

 Score =   350 bits (898),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 165/233 (71%), Positives = 192/233 (82%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP +GIW E+PSMPF+KA +LPTAFLAD LKPIATG++SYRGKLYVPQSLY
Sbjct  242  TPLQSAEVFDPRSGIWTEIPSMPFSKAQVLPTAFLADLLKPIATGMTSYRGKLYVPQSLY  301

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPET++W EMP+GMGEGWPA+QAGTKLSV V+G+LYALDPSSS DSA
Sbjct  302  CWPFFVDVGGEVYDPETDSWAEMPVGMGEGWPAKQAGTKLSVTVEGDLYALDPSSSLDSA  361

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD +DD+WK IEGD+PI DLTDSESPYLL+  LGKLNV+ KD N NILV+QADRQH
Sbjct  362  RIKVYDHQDDAWKTIEGDVPIPDLTDSESPYLLSSFLGKLNVVTKDVNHNILVMQADRQH  421

Query  542  NQN------------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
              +                  +N  ES  +IW+VIASR +GSAEL+SCQIL++
Sbjct  422  QLDSAPSTSSATFGESLEELSQNVLESSGSIWKVIASRIAGSAELVSCQILNI  474



>ref|XP_006351803.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006351804.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006351805.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006351806.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X4 [Solanum tuberosum]
Length=475

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 195/233 (84%), Gaps = 20/233 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVF+P TGIW E+PSMPF+KA MLPTAFLAD LKPIATG++SYRGKLYVPQSLY
Sbjct  245  TPLQSAEVFNPHTGIWSEIPSMPFSKAQMLPTAFLADLLKPIATGMTSYRGKLYVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETNAW++MP+GMG+GWPARQAGTKLSV V+GELYALDPSS+ DSA
Sbjct  305  CWPFFVDVGGEVYDPETNAWIDMPLGMGDGWPARQAGTKLSVTVEGELYALDPSSTLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD +DD+WK IEGDIPI D  +SESPYLLAG LGKL+VI KDAN NI+V+QADRQ+
Sbjct  365  RIKVYDHQDDTWKVIEGDIPIND--NSESPYLLAGFLGKLHVITKDANHNIMVMQADRQN  422

Query  542  NQ--------NENEKE----------SDANIWRVIASRNSGSAELISCQILDM  646
            +         N ++K           S+AN+WRV+A R+ G+AEL+SCQILD+
Sbjct  423  HSAPSPSTSANSSQKNLHEVPEPVLGSEANMWRVVALRSGGTAELVSCQILDV  475



>ref|XP_004230575.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Solanum lycopersicum]
 ref|XP_004230576.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Solanum lycopersicum]
 ref|XP_004230577.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Solanum lycopersicum]
 ref|XP_004230578.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Solanum lycopersicum]
 ref|XP_010315083.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Solanum lycopersicum]
Length=475

 Score =   346 bits (887),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 194/233 (83%), Gaps = 20/233 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVF+P TGIW EVPSMPF+KA MLPTAFLAD LKPIATG++SYRGKLYVPQSLY
Sbjct  245  TPLQSAEVFNPHTGIWSEVPSMPFSKAQMLPTAFLADLLKPIATGMTSYRGKLYVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETNAW+EMP+GMG+GWPARQAGTKLSV V+GELYALDPSS+ DSA
Sbjct  305  CWPFFVDVGGEVYDPETNAWIEMPLGMGDGWPARQAGTKLSVTVEGELYALDPSSTLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD ++D+WK IEGDIPI D  +SESPYLLAG LGKL+VI KDAN NI+V+QAD+Q+
Sbjct  365  RIKVYDHQNDTWKVIEGDIPIND--NSESPYLLAGFLGKLHVITKDANHNIMVMQADKQN  422

Query  542  NQ-----------NENEKE-------SDANIWRVIASRNSGSAELISCQILDM  646
            +             +N  E       S+AN+WRV+A R+ GSAEL+SCQILD+
Sbjct  423  HSAPSPSTSANSLQKNLHEVPEPVLGSEANMWRVVALRSGGSAELVSCQILDV  475



>gb|EYU18504.1| hypothetical protein MIMGU_mgv1a005796mg [Erythranthe guttata]
Length=470

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 186/234 (79%), Gaps = 20/234 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP +G+W E+PSMPF KA +LPTAFL D LKPIATG++SYRGKLYVPQSLYC
Sbjct  237  PLQSAEVFDPRSGVWTELPSMPFLKAQVLPTAFLTDLLKPIATGMTSYRGKLYVPQSLYC  296

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN+W +MP GMGEGWPA+QAGTKLS +VD ELYALDPSSS DSA+
Sbjct  297  WPFFVDVGGEVYDPETNSWADMPAGMGEGWPAKQAGTKLSAVVDEELYALDPSSSLDSAR  356

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  DDSWK IEGD+P+ DL DSESPYLLA  LGKL+VI KD N+NILV+QADR++ 
Sbjct  357  IKVYDQEDDSWKTIEGDVPVSDLADSESPYLLASFLGKLHVITKDVNRNILVMQADRRNE  416

Query  545  QNENE--------------------KESDANIWRVIASRNSGSAELISCQILDM  646
             N +                      ES  NIW+VIA+R++GSAEL+SCQILD+
Sbjct  417  VNLDPSTSSDSLGESLVDLSGKVSVSESSGNIWKVIATRSAGSAELVSCQILDI  470



>ref|XP_009379649.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
 ref|XP_009379654.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
Length=476

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 186/232 (80%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W ++PSMPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPKTGVWSQIPSMPFMKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+WVEMP+GMGEGWPARQAGTK+SV VDGELYALDPSSS DSA
Sbjct  305  CWPFFVDVGGEVYDPEANSWVEMPIGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD + D+WK +  D+PIRD T+SESPYLLAGLLGKL+VI KDAN  I VLQA  Q 
Sbjct  365  KIKVYDYQADAWKVVAEDVPIRDFTESESPYLLAGLLGKLHVITKDANHKIAVLQASVQD  424

Query  539  ----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            H   E   ES+ ++W+VIA+R++ +AEL+SC +LD+
Sbjct  425  HFVSSSVASSSSHNDPHEDVERPAESEQDLWKVIATRSARAAELVSCLVLDV  476



>ref|XP_008391485.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
Length=476

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/232 (68%), Positives = 186/232 (80%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W +VPSMPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPKTGVWSQVPSMPFMKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+WVEMP+GMGEGWPARQAGTK+SV VDGELYALDPSSS DSA
Sbjct  305  CWPFFVDVGGEVYDPEANSWVEMPIGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD + D+WK +  D+PIRD T+SESPYLLAGLLGKL+VI KDAN  I VLQA  Q 
Sbjct  365  KIKVYDYQADAWKVVAEDVPIRDFTESESPYLLAGLLGKLHVITKDANHKIAVLQASVQD  424

Query  539  ----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            H   E   ES+ ++W+VIA+R++ +A+L+SC +LD+
Sbjct  425  HFASSSVASSSSHNDPHEDVERPAESERDLWKVIATRSARAADLVSCLVLDV  476



>ref|XP_009362492.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Pyrus x bretschneideri]
Length=448

 Score =   328 bits (842),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 185/231 (80%), Gaps = 17/231 (7%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP+TG+W ++PSMPFTKA  LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  218  PLQSAEVFDPKTGVWSQLPSMPFTKAQALPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  277

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPE N+WVEMP GMGEGWPARQAGTK+SV VDGELYALDPSSS DSAK
Sbjct  278  WPFFVDVGGEVYDPEANSWVEMPTGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSAK  337

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA-----  529
            IKVYD + D+WK +  D+PIRD T+SESPYLLAGLLGKL+VI +DAN NI VLQA     
Sbjct  338  IKVYDYQADAWKVVAEDVPIRDFTESESPYLLAGLLGKLHVITRDANNNIAVLQASVPDH  397

Query  530  ------------DRQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                        +  H   E   ES+ ++W+VIA+R++ +AEL+SC +LD+
Sbjct  398  FASISVASSSSLNDPHEDVERPAESERDLWKVIATRSARAAELVSCLVLDV  448



>ref|XP_009362487.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362488.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362489.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009362490.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Pyrus x bretschneideri]
Length=476

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 185/231 (80%), Gaps = 17/231 (7%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP+TG+W ++PSMPFTKA  LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  246  PLQSAEVFDPKTGVWSQLPSMPFTKAQALPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPE N+WVEMP GMGEGWPARQAGTK+SV VDGELYALDPSSS DSAK
Sbjct  306  WPFFVDVGGEVYDPEANSWVEMPTGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSAK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA-----  529
            IKVYD + D+WK +  D+PIRD T+SESPYLLAGLLGKL+VI +DAN NI VLQA     
Sbjct  366  IKVYDYQADAWKVVAEDVPIRDFTESESPYLLAGLLGKLHVITRDANNNIAVLQASVPDH  425

Query  530  ------------DRQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                        +  H   E   ES+ ++W+VIA+R++ +AEL+SC +LD+
Sbjct  426  FASISVASSSSLNDPHEDVERPAESERDLWKVIATRSARAAELVSCLVLDV  476



>ref|XP_010261182.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Nelumbo 
nucifera]
Length=471

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 185/227 (81%), Gaps = 12/227 (5%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TGIW +VP+MPF++A +LPTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLQSAEVFDPRTGIWTQVPNMPFSRAQVLPTAFLADMLKPIATGMTSYRGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPETN+W EMP+GMGEGWPA+QAGTKL V+VDGELYALDPSSS DS 
Sbjct  305  SWPFFVDVGGEVYDPETNSWDEMPVGMGEGWPAKQAGTKLGVVVDGELYALDPSSSLDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIK+YD ++D+WK I   +PIRD TDSESPYLLAG LGKL+VI KDAN +I VLQAD  +
Sbjct  365  KIKIYDPQEDTWKVIVDKVPIRDYTDSESPYLLAGFLGKLHVITKDANHDISVLQADLHN  424

Query  542  NQNENEKESDAN------------IWRVIASRNSGSAELISCQILDM  646
            + N ++  S +N            IW++I +++ GSAEL+SCQ+LD+
Sbjct  425  HLNPSQPASSSNEQQSSMAEAERDIWKIIVTKDFGSAELVSCQVLDI  471



>ref|XP_008218897.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Prunus 
mume]
 ref|XP_008218898.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Prunus 
mume]
 ref|XP_008218900.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Prunus 
mume]
Length=476

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 186/232 (80%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W ++PSMPFTKA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPKTGVWSQIPSMPFTKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPETN+WVEMP+G+GEGWPARQAGTK+S  VDGELYALDPSSS D+A
Sbjct  305  CWPFFVDVGGEVYDPETNSWVEMPIGLGEGWPARQAGTKMSATVDGELYALDPSSSPDNA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD   D WK +  DIP+RD T+SESPYLLAG LGKL+VI KDAN+NI VLQ   Q+
Sbjct  365  KIKVYDYLADDWKVVAEDIPVRDFTESESPYLLAGFLGKLHVITKDANRNIAVLQVYVQN  424

Query  542  N-----------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                   E   ES+ ++W+VIA+R++ +AEL+SC +LD+
Sbjct  425  HVASISAASSSSLVDPIEHAERPTESELDLWKVIATRSAPAAELVSCLVLDI  476



>ref|XP_007222837.1| hypothetical protein PRUPE_ppa005123mg [Prunus persica]
 gb|EMJ24036.1| hypothetical protein PRUPE_ppa005123mg [Prunus persica]
Length=476

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 185/232 (80%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W ++PSMPFTKA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPKTGVWSQIPSMPFTKAQVLPTAFLADLLKPIATGLTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+WVEMP+G+GEGWPARQAGTK+S  VDGELYALDPSSS D+A
Sbjct  305  CWPFFVDVGGEVYDPEANSWVEMPIGLGEGWPARQAGTKMSATVDGELYALDPSSSPDNA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD   D WK +  D+P+RD T+SESPYLLAG LGKL+VI KDAN+NI VLQ   Q+
Sbjct  365  KIKVYDYLADDWKVVAEDVPVRDFTESESPYLLAGFLGKLHVITKDANRNIAVLQVYVQN  424

Query  542  N-----------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            N                   E   ES+ ++W+VIA+R++ +AEL+SC +LD+
Sbjct  425  NVASISAASSSSLVDRIEHAERPTESELDLWKVIATRSAPAAELVSCLVLDI  476



>ref|XP_008339217.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
 ref|XP_008339218.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
Length=476

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/232 (67%), Positives = 184/232 (79%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W ++PSMPFTKA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPKTGVWSQLPSMPFTKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+WVEMP GMGEGWPARQAGTK+SV VDGELYALDPSSS DSA
Sbjct  305  CWPFFVDVGGEVYDPEANSWVEMPTGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA----  529
            KIKVYD + D+WK +  D+PIRD T+SESPYLLAGLLGKL+VI +DAN NI VLQA    
Sbjct  365  KIKVYDYQADAWKVVAEDVPIRDFTESESPYLLAGLLGKLHVITRDANNNIAVLQASVPD  424

Query  530  -------------DRQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                         +  H   E   E + +  +VIA+R++ +AEL+SC +LD+
Sbjct  425  HFASISVASSSSRNDPHEDVERPAEXERDPXKVIATRSARAAELVSCLVLDV  476



>ref|XP_004300699.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP+TG+W ++PSMPFTKA +LPTAFL D LKPIATG++SY+G+L+VPQSLYC
Sbjct  246  PLQSAEVFDPKTGLWSQIPSMPFTKAQVLPTAFLTDLLKPIATGMTSYKGRLFVPQSLYC  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDP+ N+W EMP GMGEGWPARQAGTK+SV VDGELYALDPSSS DSAK
Sbjct  306  WPFFVDVGGEVYDPKVNSWGEMPTGMGEGWPARQAGTKMSVTVDGELYALDPSSSLDSAK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA-----  529
            IK+YD +DD+WK +  D+PIRD T+SESPYLLAG LGKL+VI KDA+ N+ VLQA     
Sbjct  366  IKLYDYQDDAWKIVADDVPIRDFTESESPYLLAGFLGKLHVITKDASNNVAVLQAYVPNR  425

Query  530  --------------DRQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          D     +E + ES+ ++W+VIA+R++ + EL+SC +LD+
Sbjct  426  LASISTDSSSSSSQDNASEISEQKAESEVDLWKVIATRSARTTELVSCLVLDL  478



>gb|KDO56540.1| hypothetical protein CISIN_1g011952mg [Citrus sinensis]
 gb|KDO56541.1| hypothetical protein CISIN_1g011952mg [Citrus sinensis]
Length=474

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 183/230 (80%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W E+ SMPF+KA +LPTAFLAD LKPIATG+SSYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDP+ N+WVEMP+GMGEGWP RQAGTKLS+ V+GELYALDPS + DSA
Sbjct  305  FWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD  DD+WK + GD+P+ + TDSESPYLLAGLLGKL+VI  DAN NI VLQAD ++
Sbjct  365  KIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKN  424

Query  542  N---------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                NE    S+ + W++IA RN+GSAEL+SCQ +++
Sbjct  425  HFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL  474



>ref|XP_006432474.1| hypothetical protein CICLE_v10001026mg [Citrus clementina]
 ref|XP_006432475.1| hypothetical protein CICLE_v10001026mg [Citrus clementina]
 gb|ESR45714.1| hypothetical protein CICLE_v10001026mg [Citrus clementina]
 gb|ESR45715.1| hypothetical protein CICLE_v10001026mg [Citrus clementina]
Length=474

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 183/230 (80%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W E+ SMPF+KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPRTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDP+ N+WVEMP+GMGEGWP RQAGTKLS+ V+GELYALDPS + DSA
Sbjct  305  FWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD  DD+WK + GD+P+ + TDSESPYLLAGLLGKL+VI  DAN NI VLQAD ++
Sbjct  365  KIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKN  424

Query  542  N---------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                NE    S+ + W++IA RN+GSAEL+SCQ +++
Sbjct  425  HFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL  474



>ref|XP_006493294.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Citrus sinensis]
 ref|XP_006493295.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X3 [Citrus sinensis]
 ref|XP_006493296.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X4 [Citrus sinensis]
Length=474

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 183/230 (80%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W E+ SMPF+KA +LPTAFLAD LKPIATG+SSYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPCTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDP+ N+WVEMP+GMGEGWP RQAGTKLS+ V+GELYALDPS + DSA
Sbjct  305  FWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD  DD+WK + GD+P+ + TDSESPYLLAGLLGKL+VI  DAN NI VLQAD ++
Sbjct  365  KIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKN  424

Query  542  N---------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                NE    S+ + W++IA RN+GSAEL+SCQ +++
Sbjct  425  HFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL  474



>ref|XP_006493293.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Citrus sinensis]
Length=478

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 183/230 (80%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W E+ SMPF+KA +LPTAFLAD LKPIATG+SSYRG+L+VPQSLY
Sbjct  249  TPLQSAEVFDPCTGLWSEILSMPFSKAQVLPTAFLADLLKPIATGMSSYRGRLFVPQSLY  308

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDP+ N+WVEMP+GMGEGWP RQAGTKLS+ V+GELYALDPS + DSA
Sbjct  309  FWPFFVDVGGEVYDPDVNSWVEMPVGMGEGWPVRQAGTKLSITVEGELYALDPSGALDSA  368

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD  DD+WK + GD+P+ + TDSESPYLLAGLLGKL+VI  DAN NI VLQAD ++
Sbjct  369  KIKVYDYHDDTWKVVVGDVPLPNFTDSESPYLLAGLLGKLHVITNDANHNIAVLQADVKN  428

Query  542  N---------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                NE    S+ + W++IA RN+GSAEL+SCQ +++
Sbjct  429  HFASMPSASSSSFHDCINEPASGSETDTWKMIAIRNAGSAELVSCQTINL  478



>emb|CBI20047.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 180/232 (78%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TG+W ++PSMPF KA +LPTAFLAD LKPIATG++SY+GKL+VPQSLY 
Sbjct  173  PLQSAEVFDPRTGVWSQIPSMPFAKAQVLPTAFLADLLKPIATGMTSYKGKLFVPQSLYY  232

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN+W EMP+GMGEGWPARQAGTKL  IVD ELYALDPSSS D A 
Sbjct  233  WPFFVDVGGEVYDPETNSWFEMPVGMGEGWPARQAGTKLGAIVDDELYALDPSSSADIAT  292

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD + DSWK +  D+PI D  ++ESPYLLA LLGKL+VI KDAN N  VLQA+ Q++
Sbjct  293  IKVYDYQCDSWKVVSTDVPIHDFAEAESPYLLASLLGKLHVITKDANNNFTVLQANMQNH  352

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                              Q E+  ES+ ++W+VIA+R++G+ EL+SCQIL +
Sbjct  353  LHSFPLTPLSPLGNNSSEQTESAAESETDVWKVIAARSAGACELVSCQILGI  404



>ref|XP_010916926.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Elaeis guineensis]
 ref|XP_010916927.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Elaeis guineensis]
Length=476

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 184/232 (79%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DP+TGIW +VPSMPF+KA +LPTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLQSAEVYDPDTGIWTQVPSMPFSKAQILPTAFLADLLKPIATGMTSYRGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+WV+MP GMGEGWPA+QAGTKLSV+V+GELYALDPSSS D  
Sbjct  305  SWPFFVDVGGEIYDPETNSWVDMPAGMGEGWPAKQAGTKLSVVVNGELYALDPSSSLDDG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
             IK+Y+ ++D+WK + G +P+ D  DSESPYLLAG LGKL+VI KD N +  VLQAD Q+
Sbjct  365  MIKIYNHQEDAWKVVIGKVPLHDFADSESPYLLAGFLGKLHVITKDVNNDTAVLQADLQN  424

Query  542  N-----------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                 + +   E++ +IW+VIAS+N G+AEL+SCQ+LD+
Sbjct  425  HMSPSSLTSSSAANSASQKVDTSVEAETDIWKVIASKNFGAAELVSCQVLDI  476



>ref|XP_004485556.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Cicer arietinum]
Length=479

 Score =   317 bits (811),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 179/231 (77%), Gaps = 17/231 (7%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP TG W ++P+MPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  249  PLQSAEVYDPHTGTWSQLPNMPFAKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  308

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDP+ N+W+EMP+GMGEGWPARQAGTKLSVIV+ +LYALDPSSS DSAK
Sbjct  309  WPFFVDVGGEVYDPDINSWLEMPVGMGEGWPARQAGTKLSVIVNNDLYALDPSSSLDSAK  368

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD   D+WK + GD+P++D  DSESPYLLA LLGKL+VI KDA+ NI VLQAD   +
Sbjct  369  IKVYDEEGDTWKVVAGDVPLQDFADSESPYLLASLLGKLHVITKDADHNIAVLQADMHSD  428

Query  545  QN-----------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               E+  ES+  IWRV ASR+  SAEL+SCQ L +
Sbjct  429  LASSQSSSSSPDSSFSELAESSAESETEIWRVFASRSGRSAELVSCQSLQV  479



>ref|XP_004485555.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Cicer arietinum]
Length=493

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 179/231 (77%), Gaps = 17/231 (7%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP TG W ++P+MPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  263  PLQSAEVYDPHTGTWSQLPNMPFAKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  322

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDP+ N+W+EMP+GMGEGWPARQAGTKLSVIV+ +LYALDPSSS DSAK
Sbjct  323  WPFFVDVGGEVYDPDINSWLEMPVGMGEGWPARQAGTKLSVIVNNDLYALDPSSSLDSAK  382

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD   D+WK + GD+P++D  DSESPYLLA LLGKL+VI KDA+ NI VLQAD   +
Sbjct  383  IKVYDEEGDTWKVVAGDVPLQDFADSESPYLLASLLGKLHVITKDADHNIAVLQADMHSD  442

Query  545  QN-----------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               E+  ES+  IWRV ASR+  SAEL+SCQ L +
Sbjct  443  LASSQSSSSSPDSSFSELAESSAESETEIWRVFASRSGRSAELVSCQSLQV  493



>ref|XP_010269155.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Nelumbo 
nucifera]
 ref|XP_010269156.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Nelumbo 
nucifera]
Length=471

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 185/227 (81%), Gaps = 12/227 (5%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP+TG+W +VP+MPF++A +LPTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLQSAEVFDPQTGVWSQVPNMPFSRAQVLPTAFLADMLKPIATGMTSYRGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFF+D GGEVYDPETN+W EMP+GMGEGWPA+QAGTKL V+VD ELYALDPS+S DS 
Sbjct  305  SWPFFIDVGGEVYDPETNSWDEMPVGMGEGWPAKQAGTKLGVVVDEELYALDPSNSLDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIK+YDS++D+WK +   +PIRD TDSESPYLLAG L KL+VI KDAN +I VLQAD   
Sbjct  365  KIKLYDSQEDTWKVVIEKVPIRDYTDSESPYLLAGFLRKLHVITKDANHDITVLQADPHS  424

Query  542  N------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +            +  +  E++ ++W+VIA+++ GSAEL+SCQ+LD+
Sbjct  425  HLSLSPIAVSPCERQSSFAEAERDVWKVIATKSFGSAELVSCQVLDI  471



>gb|AFK39946.1| unknown [Medicago truncatula]
Length=259

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 174/228 (76%), Gaps = 14/228 (6%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP TG W ++P+MPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  32   PLQSAEVYDPHTGTWSQLPNMPFAKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  91

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDP+ N+W+EMP GMG+GWPARQAGTKLSV V+ +LYALDPSSS + AK
Sbjct  92   WPFFVDVGGEVYDPDINSWLEMPGGMGDGWPARQAGTKLSVTVNNDLYALDPSSSLNYAK  151

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH-  541
            IKVYD   D+WK + GD+PI D  DSESPYLLA LLGKL+VI KDAN NI VLQA+ Q+ 
Sbjct  152  IKVYDEEGDTWKVVAGDVPIHDFADSESPYLLASLLGKLHVITKDANHNIAVLQANMQNE  211

Query  542  -------------NQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          + E+  ES+  IW+V A R+    EL+SCQ L +
Sbjct  212  LASSQSMLSSPDSERAESSAESETEIWKVFAFRSGRFFELVSCQFLKV  259



>ref|XP_008798422.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Phoenix dactylifera]
Length=476

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 186/232 (80%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DP+TG+W +VPSMPF+KA +LPTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLQSAEVYDPDTGVWTQVPSMPFSKAQILPTAFLADLLKPIATGMTSYRGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDP++NAWV+MP GMGEGWPA+QAGTKLSV+V+GELYALDPSSS D+ 
Sbjct  305  SWPFFVDVGGEIYDPDSNAWVDMPAGMGEGWPAKQAGTKLSVVVNGELYALDPSSSLDNG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIK+Y+ ++D+WK + G +P+ D  DSESPYLLAG LGKL+VI KD N +  VLQAD Q+
Sbjct  365  KIKIYNHQEDAWKVVVGKVPLHDFADSESPYLLAGFLGKLHVITKDVNNDTAVLQADLQN  424

Query  542  N----------------QNENEK-ESDANIWRVIASRNSGSAELISCQILDM  646
            +                QN +    ++ +IW+VIAS+N G+AEL+SCQ+LD+
Sbjct  425  HMSPSSLTSSSAANSASQNADTSLVAETDIWKVIASKNFGAAELVSCQVLDI  476



>ref|XP_002271882.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Vitis vinifera]
 ref|XP_010657600.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Vitis vinifera]
Length=479

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 180/232 (78%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TG+W ++PSMPF KA +LPTAFLAD LKPIATG++SY+GKL+VPQSLY 
Sbjct  248  PLQSAEVFDPRTGVWSQIPSMPFAKAQVLPTAFLADLLKPIATGMTSYKGKLFVPQSLYY  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN+W EMP+GMGEGWPARQAGTKL  IVD ELYALDPSSS D A 
Sbjct  308  WPFFVDVGGEVYDPETNSWFEMPVGMGEGWPARQAGTKLGAIVDDELYALDPSSSADIAT  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD + DSWK +  D+PI D  ++ESPYLLA LLGKL+VI KDAN N  VLQA+ Q++
Sbjct  368  IKVYDYQCDSWKVVSTDVPIHDFAEAESPYLLASLLGKLHVITKDANNNFTVLQANMQNH  427

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                              Q E+  ES+ ++W+VIA+R++G+ EL+SCQIL +
Sbjct  428  LHSFPLTPLSPLGNNSSEQTESAAESETDVWKVIAARSAGACELVSCQILGI  479



>ref|XP_010047937.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Eucalyptus grandis]
 gb|KCW87748.1| hypothetical protein EUGRSUZ_A00117 [Eucalyptus grandis]
Length=472

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 187/228 (82%), Gaps = 13/228 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DP TG+W ++PSMPF KA MLPTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLQSAEVYDPLTGLWSQIPSMPFAKAQMLPTAFLADLLKPIATGMTSYRGRLLVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE ++WVEMP GMGEGWPARQAGTKLSV V+GELY+LDPSSS DSA
Sbjct  305  CWPFFVDVGGEVYDPEIDSWVEMPPGMGEGWPARQAGTKLSVTVEGELYSLDPSSSLDSA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD +DD+WK I  ++PIRD  DSESPYLLA LLGKL+VI +DAN NI V+QAD Q+
Sbjct  365  KIKVYDHQDDAWKVIAEEVPIRDFADSESPYLLASLLGKLHVITRDANNNISVMQADVQN  424

Query  542  NQNEN-------------EKESDANIWRVIASRNSGSAELISCQILDM  646
            N N               + ES+ N+W+VIA++N+GSAEL+SCQ LD+
Sbjct  425  NVNPFPMVSSSLAEDSVLKLESERNLWKVIATKNAGSAELVSCQALDI  472



>ref|XP_007159083.1| hypothetical protein PHAVU_002G207100g [Phaseolus vulgaris]
 gb|ESW31077.1| hypothetical protein PHAVU_002G207100g [Phaseolus vulgaris]
Length=481

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 178/235 (76%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W ++PSMPF +A +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  247  SPLQSAEVYDPHTGMWSQLPSMPFARAQVLPTAFLADLLKPIATGMASYRGRLFVPQSLY  306

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP  N+W+EMP+GMGEGWPARQAGTKLSV V+ +LYALDPS+S DSA
Sbjct  307  CWPFFVDVGGEVYDPNINSWLEMPIGMGEGWPARQAGTKLSVTVNDDLYALDPSNSLDSA  366

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIK+YD   D+WK    D+PI D TDSESPYLLAGLLGKL+VI KDAN NI VLQAD QH
Sbjct  367  KIKIYDYEGDTWKVAAVDVPIHDFTDSESPYLLAGLLGKLHVITKDANHNITVLQADMQH  426

Query  542  NQ--------------------NENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                   E+  +S    W+V+A+R+  SAEL++CQ L +
Sbjct  427  EHARSVFSQSILSSPDNSITEDAESSAQSQGEFWKVLATRSGRSAELVNCQSLKI  481



>ref|XP_007043021.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOX98852.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=476

 Score =   314 bits (805),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 183/233 (79%), Gaps = 19/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TGIW ++PSMPF+KA +LPT FLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  245  TPLQSAEVFDPHTGIWSQIPSMPFSKAQVLPTVFLADLLKPIATGMTSYRGRLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+WVEMP+GMGEGWPARQAGTKLSV VDGELYALDPSSS +SA
Sbjct  305  CWPFFVDVGGEVYDPEVNSWVEMPVGMGEGWPARQAGTKLSVTVDGELYALDPSSSPESA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD +DD+WK   G++PI  +T+SESP LLAGLLGKL+VI +DAN NI +LQ D Q+
Sbjct  365  RIKVYDHQDDAWKVAVGEVPIPHVTESESPCLLAGLLGKLHVITRDAN-NISILQTDVQN  423

Query  542  NQN------------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                    E+      N+WRVIA+R + S+EL+SCQ L++
Sbjct  424  HLTSLPSTTSGDSSCVHAMSAESAPAIGTNLWRVIATRMAESSELVSCQTLNI  476



>ref|XP_004136863.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis 
sativus]
 ref|XP_004155450.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis 
sativus]
 gb|KGN43697.1| hypothetical protein Csa_7G060170 [Cucumis sativus]
Length=479

 Score =   314 bits (805),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W E+PSMPF KA +LPTAFLAD LKPIATG++SY+GKL+VPQSLY
Sbjct  245  SPLQSAEVYDPNTGMWSEMPSMPFAKAQVLPTAFLADLLKPIATGLTSYQGKLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP+ N WVEMPMGMGEGWPARQAGTKLSV V+GELYALDPSSS D+A
Sbjct  305  CWPFFVDVGGEVYDPDVNTWVEMPMGMGEGWPARQAGTKLSVTVNGELYALDPSSSLDNA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD-RQ  538
            K+KVYDS  D+WK +  DIPI D +DSESPYLLAGL  KL+VI KDAN NI V+QA  R 
Sbjct  365  KVKVYDSHSDAWKVVAEDIPIHDFSDSESPYLLAGLTQKLHVITKDANNNITVMQAGVRN  424

Query  539  HN-------------------QNENEKESDANIWRVIASRNSGSAELISCQIL  640
            H+                   + +   E   N  +VIA+R  GSAEL+SCQ L
Sbjct  425  HHLASFQSASSSSSSQDICFRELQELDEESENFTKVIATRTVGSAELVSCQTL  477



>ref|XP_002285816.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Vitis vinifera]
Length=477

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 181/233 (78%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP T  W ++PSMPF++A +LPTAFLAD LKPIATG++SY G+L VPQSLY
Sbjct  245  TPLQSAEVFDPCTDTWSQIPSMPFSRAQVLPTAFLADMLKPIATGMTSYMGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+WVEMP+GMG+GWPARQAGTKLSV+VDGELYA DPSSS DS 
Sbjct  305  SWPFFVDVGGEIYDPETNSWVEMPIGMGDGWPARQAGTKLSVVVDGELYAFDPSSSLDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
             IKVYD ++D+WK + G +PI D TDSESPYLLAG  GKL++I KDAN +I VLQAD + 
Sbjct  365  NIKVYDQKEDAWKVVIGKVPICDFTDSESPYLLAGFHGKLHIITKDANHDIAVLQADLRD  424

Query  539  -----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                             H  ++   E++  +W+VIA+R+ G+AEL+SCQ+LD+
Sbjct  425  NLGFPPSTSPSCSAASSHEHSDLLAETETVVWKVIATRDFGTAELVSCQVLDI  477



>ref|XP_002534256.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28126.1| conserved hypothetical protein [Ricinus communis]
Length=469

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 179/231 (77%), Gaps = 18/231 (8%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            LQSAEVFDP TG+W E+PSMPF+KA +LPTAFLAD LKPIATG++SYRGKL+V QSLYCW
Sbjct  239  LQSAEVFDPHTGVWSEIPSMPFSKAQVLPTAFLADLLKPIATGMTSYRGKLFVAQSLYCW  298

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFVD GGEVYDPE N W EMP GMG+GWP +QAGTKLSV V+ ELYAL+PSSS DSA+I
Sbjct  299  PFFVDVGGEVYDPEMNLWCEMPAGMGDGWPVKQAGTKLSVTVEDELYALEPSSSLDSARI  358

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ---  538
            KVYD R D+WK + GD+PI D ++SES YLLAGLLG+L+VIAKD N NI V+Q D Q   
Sbjct  359  KVYDYRTDTWKFLVGDVPICDFSNSESSYLLAGLLGELHVIAKDGNNNIRVMQVDVQNHL  418

Query  539  ---------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                           H + E+  ES+  +WRVIA+R++ SA+L+SCQ +D+
Sbjct  419  DSSSSSQSFSFNDSFHQKAESGAESETPLWRVIATRSARSADLVSCQTIDL  469



>gb|EPS71394.1| hypothetical protein M569_03361 [Genlisea aurea]
Length=631

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 183/227 (81%), Gaps = 8/227 (4%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TG W EV SMPF++A MLPTAFLAD LKPIATG++SYRGKL VPQSLYC
Sbjct  243  PLQSAEVFDPSTGTWSEVASMPFSRARMLPTAFLADLLKPIATGMTSYRGKLCVPQSLYC  302

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEV+DPETN+WVEM  GMGEGWPA+QAGTKLSVIVD ELYALDPSS+ DSA+
Sbjct  303  WPFFVDVGGEVFDPETNSWVEMSTGMGEGWPAKQAGTKLSVIVDEELYALDPSSTVDSAR  362

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD +DD+WK IEGD+PIRDL+DSE+PYLLAGLLGKL+VI KDA+ +I V+Q D+   
Sbjct  363  IKVYDQQDDAWKTIEGDVPIRDLSDSEAPYLLAGLLGKLHVITKDADHSISVMQFDKV--  420

Query  545  QNENEKESDANIWRVIASRNSGSAELI-SCQILDM*LYMPVLEVSSN  682
                   S  NIW VIA R +GSAEL+ S +++   +  P + V  N
Sbjct  421  -----PASGNNIWNVIARRIAGSAELLTSVKMISSAVTFPFIPVVRN  462



>ref|XP_006434051.1| hypothetical protein CICLE_v10001023mg [Citrus clementina]
 gb|ESR47291.1| hypothetical protein CICLE_v10001023mg [Citrus clementina]
Length=475

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 180/233 (77%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP T  W EVPSMPF++A  LP AF AD LKPIATG++SY G+L VPQSLY
Sbjct  243  TPLQSAEVFDPTTDTWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLY  302

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDP+TN+WVEMP+GMGEGWPARQAGTKLSV++DGELYA DPSSS +SA
Sbjct  303  SWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSA  362

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD ++D+WK + G +PIRD  DSESPYLL+   GKL+V+ KDA++NI +L+AD + 
Sbjct  363  KIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRD  422

Query  539  -----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                             H  +++  ESD  +W+ IA+RN GSAEL+SCQ+LD+
Sbjct  423  HLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV  475



>ref|XP_003593163.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AES63414.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=476

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 177/228 (78%), Gaps = 14/228 (6%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP TG W ++P+MPF KA +LPTAFLAD LKPIATG++SYRG+L+VPQSLYC
Sbjct  249  PLQSAEVYDPHTGTWSQLPNMPFAKAQVLPTAFLADLLKPIATGMTSYRGRLFVPQSLYC  308

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDP+ N+W+EMP GMG+GWPARQAGTKLSV V+ +LYALDPSSS + AK
Sbjct  309  WPFFVDVGGEVYDPDINSWLEMPGGMGDGWPARQAGTKLSVTVNNDLYALDPSSSLNYAK  368

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH-  541
            IKVYD   D+WK + GD+PI D  DSESPYLLA LLGKL+VI KDAN NI VLQA+ Q+ 
Sbjct  369  IKVYDEEGDTWKVVAGDVPIHDFADSESPYLLASLLGKLHVITKDANHNIAVLQANMQNE  428

Query  542  -------------NQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          + E+  ES+  IW+V ASR+  S+EL+SCQ L +
Sbjct  429  LASSQSMLSSPDSERAESSAESETEIWKVFASRSGRSSELVSCQSLKV  476



>ref|XP_006472657.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Citrus 
sinensis]
 gb|KDO80875.1| hypothetical protein CISIN_1g011881mg [Citrus sinensis]
Length=475

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 180/233 (77%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP T  W EVPSMPF++A  LP AF AD LKPIATG++SY G+L VPQSLY
Sbjct  243  TPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLY  302

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDP+TN+WVEMP+GMGEGWPARQAGTKLSV++DGELYA DPSSS +SA
Sbjct  303  SWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSA  362

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD ++D+WK + G +PIRD  DSESPYLL+   GKL+V+ KDA++NI +L+AD + 
Sbjct  363  KIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRD  422

Query  539  -----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                             H  +++  ESD  +W+ IA+RN GSAEL+SCQ+LD+
Sbjct  423  HLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV  475



>ref|XP_003531046.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Glycine max]
 ref|XP_006584988.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Glycine max]
 ref|XP_006584989.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X3 [Glycine max]
 gb|KHN39207.1| F-box/kelch-repeat protein [Glycine soja]
Length=481

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/235 (63%), Positives = 178/235 (76%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W  +PSMPF +A +LPTAFLAD LKPIATG++SY+G+L+VPQSLY
Sbjct  247  SPLQSAEVYDPHTGMWSLLPSMPFARAQVLPTAFLADLLKPIATGMASYKGRLFVPQSLY  306

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP  N+W+EMP+GMGEGWPARQAGTKLSV VD +LYALDPS+S DSA
Sbjct  307  CWPFFVDVGGEVYDPNLNSWLEMPIGMGEGWPARQAGTKLSVTVDDDLYALDPSNSLDSA  366

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD   D+WK   GD+PI D T+SESPYLLAGLLGKL+VI KDAN NI VLQAD Q+
Sbjct  367  KIKVYDYEGDTWKVAAGDVPIHDFTESESPYLLAGLLGKLHVITKDANHNITVLQADMQN  426

Query  542  NQ--------------------NENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                   E+  E+    W+V+A+R+  SAEL++CQ L +
Sbjct  427  EHAESAFSQSILSSPDNSISEDAESSAETQGEFWKVLATRSGRSAELVNCQSLKI  481



>gb|AFY26883.1| F-box family protein [Morella rubra]
Length=473

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 178/229 (78%), Gaps = 14/229 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG W +VP+MPF+KA  LPTAFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  245  TPLQSAEVFDPSTGSWSQVPNMPFSKAQALPTAFLADMLKPIATGLTPYMGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+W+EMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS DS 
Sbjct  305  SWPFFVDVGGEIYDPETNSWIEMPNGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD ++D+WK + G +P+ D  D+ESPYLLAG  GKL+VI KD++ +I VLQAD   
Sbjct  365  KIKVYDRKEDAWKVVIGKVPMHDFADTESPYLLAGFHGKLHVITKDSSHHIAVLQADSCS  424

Query  542  -----------NQNENE---KESDANIWRVIASRNSGSAELISCQILDM  646
                       + NEN     ESDA +WRVI +R+ G AE++SCQ+L++
Sbjct  425  SPSSSSSLFAGSLNENSGSMAESDAVVWRVIGTRDFGPAEMVSCQVLEI  473



>ref|XP_008455232.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Cucumis melo]
Length=479

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 179/233 (77%), Gaps = 20/233 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W E+PSMPF KA +LPTAFLAD LKPIATG++SY+GKL+VPQSLY
Sbjct  245  SPLQSAEVYDPNTGMWSEMPSMPFAKAQVLPTAFLADLLKPIATGLTSYQGKLFVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP+ N WVEMPMGMGEGWPARQAGTKLSV V+GELYALDPSSS D+A
Sbjct  305  CWPFFVDVGGEVYDPDVNTWVEMPMGMGEGWPARQAGTKLSVTVNGELYALDPSSSLDNA  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD-RQ  538
            K+KVYDS+ D+WK +  DIPI D +DSESPYLLAGL  KL+VI KDAN NI V+QA  R 
Sbjct  365  KVKVYDSQSDAWKVVAEDIPIHDFSDSESPYLLAGLTQKLHVITKDANNNITVMQAGVRN  424

Query  539  HN-------------------QNENEKESDANIWRVIASRNSGSAELISCQIL  640
            HN                   + +  +E   +  +VIA+R  GSAEL+SCQ L
Sbjct  425  HNLASFQSASSSSSSQDICFRELQELEEESESFTKVIATRTVGSAELVSCQTL  477



>ref|XP_011027666.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Populus 
euphratica]
Length=474

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 179/228 (79%), Gaps = 14/228 (6%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP  G W +VPSMPF++A ++PTA+L+D LKPIATG++SY G+L+VPQSLY 
Sbjct  247  PLQSAEVFDPCKGTWSDVPSMPFSRAQLVPTAYLSDMLKPIATGMTSYMGRLFVPQSLYS  306

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPF VD GGE+YDPETN+W EMP GMGEGWPARQAGTKLSV+VDGELYA DPS+S DS K
Sbjct  307  WPFIVDVGGEIYDPETNSWAEMPTGMGEGWPARQAGTKLSVVVDGELYAFDPSTSADSGK  366

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ--  538
            IKVYD ++D+WK + G +P+ D T+SESPYLL G  GK++V+ KDANQNI V+QAD Q  
Sbjct  367  IKVYDHKEDTWKVVIGKVPVADFTESESPYLLTGFHGKIHVLTKDANQNIAVMQADVQDV  426

Query  539  ------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                         + +E+   S+  +W+VIAS++ GSAEL+SCQ+LD+
Sbjct  427  LGSPLNSTSVSSQSLHEHSDSSETVVWKVIASKDFGSAELVSCQVLDI  474



>ref|XP_002302274.2| hypothetical protein POPTR_0002s09250g [Populus trichocarpa]
 gb|EEE81547.2| hypothetical protein POPTR_0002s09250g [Populus trichocarpa]
Length=474

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 179/229 (78%), Gaps = 14/229 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP  G W +VPSMPF++A ++PTA+L+D LKPIATG++SY G+L+VPQSLY
Sbjct  246  TPLQSAEVFDPCKGTWSDVPSMPFSRAQLVPTAYLSDMLKPIATGMTSYMGRLFVPQSLY  305

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPF VD GGE+YDPETN+W EMP GMGEGWPARQAGTKLSV+VDGELYA DPS+S DS 
Sbjct  306  SWPFIVDVGGEIYDPETNSWAEMPTGMGEGWPARQAGTKLSVVVDGELYAFDPSTSADSG  365

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD ++D+WK + G +P+ D T+SESPYLL G  GK++V+ KDANQNI V+QAD Q 
Sbjct  366  KIKVYDHKEDTWKVVIGKVPVADFTESESPYLLTGFHGKIHVLTKDANQNIAVMQADVQD  425

Query  539  -------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          + + +   S+  +W+VIAS++ GSAEL+SCQ+LD+
Sbjct  426  VLGSPLNSTSVSAQSLHGHSDSSETVVWKVIASKDFGSAELVSCQVLDV  474



>ref|XP_004515647.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cicer arietinum]
Length=478

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 179/235 (76%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP TGIW +VPSMPF++A +LP AFLAD LKPIATG++SY G+L VPQSLY
Sbjct  244  VPLQSAEVFDPSTGIWSDVPSMPFSRAQVLPNAFLADMLKPIATGLTSYNGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+W+EMP+GMGEGWPARQAGTKLSV+VDGELYA DPS++ D+ 
Sbjct  304  SWPFFVDVGGEIYDPETNSWIEMPIGMGEGWPARQAGTKLSVVVDGELYAFDPSNTMDNG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD  +D+WK + G +PI    DSESPYLLAG  GKL+VI KDAN+NI VLQA+ ++
Sbjct  364  RIKVYDQGEDAWKVVIGKVPIYGSDDSESPYLLAGFHGKLHVITKDANRNIAVLQAELRN  423

Query  542  NQNENEK--------------------ESDANIWRVIASRNSGSAELISCQILDM  646
            N + +                      ESDA +W+++ASR  G  EL+SCQ++DM
Sbjct  424  NLDSSVPSPSNPSQSSLHELVEPAAAAESDAVVWKIVASRCLGHVELVSCQVIDM  478



>ref|XP_010105865.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXC06684.1| F-box/kelch-repeat protein [Morus notabilis]
Length=473

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 176/227 (78%), Gaps = 14/227 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP +GIW +VPSMPF+KA +LPTAFLAD LKPIATG++SY G+L VPQSLY
Sbjct  245  TPLQSAEVFDPSSGIWSQVPSMPFSKAQVLPTAFLADMLKPIATGLTSYMGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+W EMP+GMGEGWPARQAGTKLSV+VDGELYA DPSSS DS 
Sbjct  305  SWPFFVDVGGEIYDPETNSWNEMPIGMGEGWPARQAGTKLSVVVDGELYAFDPSSSLDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD ++D+WK + G +PI D   SESPYLLAG  GKL+VI KDAN+ I +++AD   
Sbjct  365  KIKVYDQKEDAWKVVIGKVPIYDFAGSESPYLLAGFHGKLHVITKDANREIAIMRADLHD  424

Query  542  NQNENEK--------------ESDANIWRVIASRNSGSAELISCQIL  640
            N +                  +SDA IW VIA+R+  +A+L+SCQ+L
Sbjct  425  NTDSIPSSSTSVVADSSDLLADSDAVIWNVIATRDFEAADLVSCQVL  471



>gb|KHN06826.1| F-box/kelch-repeat protein [Glycine soja]
Length=481

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 177/235 (75%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W ++PSMPF +A +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  247  SPLQSAEVYDPHTGMWSQLPSMPFARAQVLPTAFLADLLKPIATGMASYRGRLFVPQSLY  306

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP  N+W+EMP+GMGEGWPARQAGTKLS+ V+ +LYALDPS+S DSA
Sbjct  307  CWPFFVDVGGEVYDPNLNSWLEMPIGMGEGWPARQAGTKLSITVNDDLYALDPSNSLDSA  366

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD   D+WK   GD+P  D TDSESPYLLAGL GKL+VI KDAN NI VLQAD Q+
Sbjct  367  KIKVYDYEGDTWKVAAGDVPNHDFTDSESPYLLAGLHGKLHVITKDANDNITVLQADMQN  426

Query  542  NQ--------------------NENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                   E+  E+    W+V+A+R+  SAEL++CQ L +
Sbjct  427  EHAESAFSQSIFSSPDNSFSEDAESSAEARREFWKVLATRSGRSAELVNCQSLKI  481



>ref|XP_003524750.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Glycine max]
 ref|XP_006579998.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Glycine max]
 ref|XP_006579999.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X3 [Glycine max]
 ref|XP_006580000.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X4 [Glycine max]
 ref|XP_006580001.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X5 [Glycine max]
 ref|XP_006580002.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X6 [Glycine max]
 ref|XP_006580003.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X7 [Glycine max]
Length=481

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 177/235 (75%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W ++PSMPF +A +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  247  SPLQSAEVYDPHTGMWSQLPSMPFARAQVLPTAFLADLLKPIATGMASYRGRLFVPQSLY  306

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDP  N+W+EMP+GMGEGWPARQAGTKLS+ V+ +LYALDPS+S DSA
Sbjct  307  CWPFFVDVGGEVYDPNLNSWLEMPIGMGEGWPARQAGTKLSITVNDDLYALDPSNSLDSA  366

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD   D+WK   GD+P  D TDSESPYLLAGL GKL+VI KDAN NI VLQAD Q+
Sbjct  367  KIKVYDYEGDTWKVAAGDVPNHDFTDSESPYLLAGLHGKLHVITKDANDNITVLQADMQN  426

Query  542  NQ--------------------NENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                   E+  E+    W+V+A+R+  SAEL++CQ L +
Sbjct  427  EHAESAFSQSIFSSPDNSFSEDAESSAEARREFWKVLATRSGRSAELVNCQSLKI  481



>ref|XP_006416237.1| hypothetical protein EUTSA_v10007536mg [Eutrema salsugineum]
 gb|ESQ34590.1| hypothetical protein EUTSA_v10007536mg [Eutrema salsugineum]
Length=472

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 175/230 (76%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  243  SPLQSAEVYDPNTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCVPQSLY  302

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  303  SWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENG  362

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD ++D+WK + G++P+ DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD   
Sbjct  363  KIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLRADVPD  422

Query  539  --------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            +     +SD  IW+VIAS++ G+AEL+SCQ++D+
Sbjct  423  ISSSSSSSSSNSVLSEKGNAANKSDTVIWKVIASKDFGAAELVSCQVIDI  472



>gb|KEH34863.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=478

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 176/233 (76%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TG W +VPSMPF++A +LP AFLAD LKPIATG+++Y G+L VPQSLY 
Sbjct  246  PLQSAEVFDPSTGTWSDVPSMPFSRAQVLPNAFLADMLKPIATGLTAYMGRLCVPQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W+EMP+GMGEGWPARQAGTKLSV+VDGELYA DPS++ DS +
Sbjct  306  WPFFVDVGGEIYDPETNSWIEMPLGMGEGWPARQAGTKLSVVVDGELYAFDPSNTMDSGR  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ--  538
            IKVYD  +D+WK + G +PI    DSESPYLLAG  GKL+VI KDA+ NI VLQA+ +  
Sbjct  366  IKVYDQGEDAWKVVIGKVPIYGSDDSESPYLLAGFHGKLHVITKDADHNIAVLQAELRSN  425

Query  539  -----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                             H   +   E+DA +W+++ASR  G AEL+SCQ++DM
Sbjct  426  LDSSPSSPSSTLSQSSLHENADPPAETDAVVWKIVASRCLGQAELVSCQVIDM  478



>gb|KDP37916.1| hypothetical protein JCGZ_05355 [Jatropha curcas]
Length=473

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 181/233 (78%), Gaps = 19/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            T LQSAEVFDP+TG+W E+PSMPF+KA +LPTAFLAD LKPIATG++SYRG+L+V QSLY
Sbjct  242  TSLQSAEVFDPQTGVWSEIPSMPFSKAQVLPTAFLADLLKPIATGMTSYRGRLFVAQSLY  301

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVD GGEVYDPE N+W +MP GMGEGWP +QAGTKLSV V+GELYAL+PS+S DSA
Sbjct  302  CWPFFVDVGGEVYDPEINSWDQMPTGMGEGWPVKQAGTKLSVTVEGELYALEPSTSLDSA  361

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD ++D+WK + GDIPI D ++SES YLLA LLG+L++I KDAN +I ++Q D ++
Sbjct  362  RIKVYDYQNDTWKVLFGDIPISDCSNSESSYLLASLLGQLHIITKDAN-SITIMQTDTRN  420

Query  542  NQN------------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
            +                    E+   S+ +IWR+IA+RN  S +L+SCQ LD+
Sbjct  421  HLTSSVPSSSFSCNGSFCEPAESSAVSETHIWRIIATRNGRSTDLVSCQTLDL  473



>ref|NP_173623.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 sp|Q9LM55.1|FBK8_ARATH RecName: Full=F-box/kelch-repeat protein At1g22040 [Arabidopsis 
thaliana]
 gb|AAF86548.1|AC069252_7 F2E2.11 [Arabidopsis thaliana]
 gb|AAY56413.1| At1g22040 [Arabidopsis thaliana]
 gb|ABF57275.1| At1g22040 [Arabidopsis thaliana]
 gb|AEE30188.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
Length=475

 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 175/232 (75%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  244  SPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  304  SWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR--  535
            KIKVYD ++D+WK + G++P+ DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD   
Sbjct  364  KIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLRADVPN  423

Query  536  ---------------QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            H +     +SD   W++IA+++ G+AEL+SCQ++D+
Sbjct  424  IPVSSSSSSSSSVSIPHLKTNAPNKSDTVTWKLIATKDFGAAELVSCQVIDI  475



>gb|KDP32711.1| hypothetical protein JCGZ_12003 [Jatropha curcas]
Length=472

 Score =   303 bits (777),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 175/229 (76%), Gaps = 15/229 (7%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP T  W EVPSMPF+K+   PTAF AD LKPIATG++SY G+L VPQSLY 
Sbjct  244  PLQSAEVFDPCTDTWSEVPSMPFSKSQQFPTAFWADMLKPIATGMTSYMGRLCVPQSLYS  303

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVDAGGE+YDPETN+W EMP GMGEGWPARQAGTKLSV+VDGELY+ DPSSS DS K
Sbjct  304  WPFFVDAGGEIYDPETNSWAEMPTGMGEGWPARQAGTKLSVVVDGELYSFDPSSSRDSGK  363

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD-RQH  541
            IKVYD ++D+WK I G +PI D +DS++P+LLAG  GK++VI KDAN  I+V+QA  R H
Sbjct  364  IKVYDQKEDAWKVIIGKVPIYDSSDSDTPHLLAGFHGKIHVITKDANHKIVVMQAGLRDH  423

Query  542  NQNENEK--------------ESDANIWRVIASRNSGSAELISCQILDM  646
              + N                ES+  +W+V+ SR+ GSAELISCQ+LD+
Sbjct  424  FGSSNSHFIGSSQEEHFAPSTESETVVWKVVTSRDVGSAELISCQVLDI  472



>ref|XP_011010352.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Populus 
euphratica]
 ref|XP_011010353.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Populus 
euphratica]
Length=474

 Score =   303 bits (777),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 178/229 (78%), Gaps = 14/229 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG W +VPSMPF++A ++PTA+L+D LKPIATG++SY G+L+VPQSLY
Sbjct  246  TPLQSAEVFDPCTGTWSDVPSMPFSRAQLVPTAYLSDLLKPIATGMTSYMGRLFVPQSLY  305

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPF VD GGE+YDPETN+W EMP GMG+GWPARQAGTKLS++VDGELYA DPS+S +S 
Sbjct  306  SWPFIVDVGGEIYDPETNSWAEMPTGMGDGWPARQAGTKLSIVVDGELYAFDPSTSPNSG  365

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD ++D+WK   G +P+ D T+SESPYLL G  GK++V+ KDAN+NI V+QAD Q 
Sbjct  366  KIKVYDQKEDTWKVAIGKVPVADYTESESPYLLTGFHGKIHVLTKDANRNIAVMQADVQD  425

Query  542  N--------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            N               +E+   SD   W+VI S++ GSAEL+SCQ+LD+
Sbjct  426  NLGSPLSSTSVSAKSLHEHPDSSDTVFWKVIDSKDFGSAELVSCQVLDV  474



>ref|XP_003526599.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Glycine max]
 ref|XP_006581560.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Glycine max]
 gb|KHN09148.1| F-box/kelch-repeat protein [Glycine soja]
Length=476

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 176/233 (76%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP T  W  VPSMPF++A +LP+AFLAD LKPIATG++SY G+L VPQSLY
Sbjct  244  VPLQSAEVFDPSTDTWSHVPSMPFSRAQVLPSAFLADMLKPIATGLTSYMGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDPETN+W+EMP GMG+GWPARQAGTKLSV+VDGELYA DPS+S DS 
Sbjct  304  SWPFFVDVGGEIYDPETNSWIEMPAGMGDGWPARQAGTKLSVVVDGELYAFDPSNSMDSG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD  +D+WK + G +PI D  DSESPYLLAG  GKL+VI KDAN +I VLQA  + 
Sbjct  364  RIKVYDQGEDAWKVVIGKVPIYDSADSESPYLLAGFHGKLHVITKDANHDIAVLQAGLRD  423

Query  542  NQN-----------------ENEKESDAN-IWRVIASRNSGSAELISCQILDM  646
            N +                 E   ESDA  +WRV+ASR+ G AEL+SCQ++D+
Sbjct  424  NLDSSPSLSTLSQSTLQESPELAAESDAAVVWRVVASRDFGQAELVSCQVIDI  476



>ref|XP_009347210.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
 ref|XP_009347211.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
Length=477

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 170/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W EVPSMPF++A  LPTAFL D L+PIATG++SY G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSEVPSMPFSRAQALPTAFLTDMLRPIATGLTSYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W EMP+GMGEGWPARQA TKLS++VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDEMPLGMGEGWPARQAATKLSIVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD----  532
            IKVYD  +D+WK I G +PI D   S+SPYLLAG  GKL+VI KDAN  I VL+AD    
Sbjct  366  IKVYDQGEDAWKVIIGKVPIHDFAGSDSPYLLAGFHGKLHVITKDANHEIAVLRADLCSN  425

Query  533  --------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            H  ++   ESDA +W+VI +R+ GS EL+ CQILD+
Sbjct  426  LGSLSPRSTSLMPSSSHEHSDTLAESDAVMWKVIGTRDFGSGELVGCQILDV  477



>ref|XP_010905931.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Elaeis 
guineensis]
Length=477

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 179/233 (77%), Gaps = 22/233 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPL+SAEVFDP+TG+W ++PSMPF+KA M+PTAFLAD LKPIATG++SYRG+L VPQSLY
Sbjct  245  TPLRSAEVFDPQTGMWTQLPSMPFSKAQMIPTAFLADILKPIATGMASYRGRLCVPQSLY  304

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFF D GGE+YDPE ++WVEMP GMG+GWPARQAGTKLSV+V+GELYALDPSSS DS 
Sbjct  305  SWPFFFDVGGEIYDPENDSWVEMPTGMGDGWPARQAGTKLSVVVNGELYALDPSSSLDSG  364

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
             IK YD ++D WK +   +PI D TDSESPYLLAG LGKL+V+ KD    + +LQAD Q 
Sbjct  365  DIKRYDHQEDVWKVVIQRVPIHDFTDSESPYLLAGFLGKLHVVTKDDENRVAILQADLQK  424

Query  542  NQN---------------EN-----EKESDANIWRVIASRNSGSAELISCQIL  640
            ++                EN     ++E+D  IW+VIAS+N G+AEL+SCQ+L
Sbjct  425  HKQSSPSTSSAPPANFRPENPVSIVDRETD--IWKVIASKNFGTAELVSCQVL  475



>emb|CAN63480.1| hypothetical protein VITISV_011508 [Vitis vinifera]
Length=499

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 18/226 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TG+W ++PSMPF KA +LPTAFLAD LKPIATG++SY+GKL+VPQSLY 
Sbjct  248  PLQSAEVFDPRTGVWSQIPSMPFAKAQVLPTAFLADLLKPIATGMTSYKGKLFVPQSLYY  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN+W EMP+GMGEGWPARQAGTKL  IVD ELYALDPSSS D A 
Sbjct  308  WPFFVDVGGEVYDPETNSWFEMPVGMGEGWPARQAGTKLGAIVDDELYALDPSSSADIAT  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD + DSWK +  D+PI D  ++ESPYLLA  LGKL+VI KDAN N  VLQA+ Q++
Sbjct  368  IKVYDYQCDSWKVVSTDVPIHDFAEAESPYLLASFLGKLHVITKDANNNFTVLQANMQNH  427

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELIS  628
                              Q E+  ES+ ++W+VIA+R++G+ EL S
Sbjct  428  LHSFPLTPLSPLGNNSSEQTESXAESETDVWKVIAARSAGACELHS  473



>ref|XP_006307263.1| hypothetical protein CARUB_v10008879mg [Capsella rubella]
 gb|EOA40161.1| hypothetical protein CARUB_v10008879mg [Capsella rubella]
Length=513

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 177/236 (75%), Gaps = 22/236 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  279  SPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCVPQSLY  338

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  339  SWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENG  398

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD---  532
            KIKVYD ++D+WK + G++PI DLTDSESPYLLAG  GKL+ I +D N+N+ VL+AD   
Sbjct  399  KIKVYDQKEDTWKVVIGEVPIYDLTDSESPYLLAGFHGKLHFITRDPNRNVTVLRADVPN  458

Query  533  ------------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                   N  +K SD  IW++IA+++ G+AEL+SCQ++D+
Sbjct  459  IPVSSPSSSSSSVSGSRSLSEKANAPDK-SDTVIWKLIATKDFGAAELVSCQVIDI  513



>ref|XP_010459928.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Camelina sativa]
Length=484

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 173/234 (74%), Gaps = 20/234 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G L VPQSLY 
Sbjct  251  PLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGMLCVPQSLYS  310

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ K
Sbjct  311  WPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENGK  370

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD----  532
            IKVYD ++D+WK + G++PI DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD    
Sbjct  371  IKVYDQKEDTWKVVIGEVPIYDLTDSESPYLLAGFHGKLHFITRDTNHNVTVLRADVPNI  430

Query  533  ----------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                +     +SD  IW++IA+++ G+AEL+SCQ++D+
Sbjct  431  PVSSPSSSSSSVSGSRSLSEKGNAPNKSDTVIWKLIATKDFGAAELVSCQVIDI  484



>ref|XP_008352663.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
 ref|XP_008352664.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
 ref|XP_008352665.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
Length=477

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 170/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W EVPSMPF++A  LPTAFL D L+PIATG++SY G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSEVPSMPFSRAQALPTAFLTDMLRPIATGLTSYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W EMP+GMGEGWPARQAGTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDEMPLGMGEGWPARQAGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   S+SPYLLAG  GKL+VI KDAN  I VL+AD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSDSPYLLAGFHGKLHVITKDANHEIAVLRADLCSN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               ++   ESD  +W+VI +R+ GS EL+ CQILD+
Sbjct  426  LGSLSPRSTSLMPSSXLEXSDTVAESDXVVWKVIGTRDFGSGELVGCQILDL  477



>ref|XP_010477456.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Camelina 
sativa]
Length=480

 Score =   301 bits (771),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 173/234 (74%), Gaps = 20/234 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G L VPQSLY 
Sbjct  247  PLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGMLCVPQSLYS  306

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ K
Sbjct  307  WPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENGK  366

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD----  532
            IKVYD ++D+WK + G++PI DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD    
Sbjct  367  IKVYDQKEDTWKVVIGEVPIYDLTDSESPYLLAGFHGKLHFITRDTNHNVTVLRADVPNI  426

Query  533  ----------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                +     +SD  IW++IA+++ G+AEL+SCQ++D+
Sbjct  427  PVSLPSSSSSSVSGSRSLSEKGNAPNKSDTVIWKLIATKDFGAAELVSCQVIDI  480



>ref|XP_010498664.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Camelina 
sativa]
Length=483

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 172/234 (74%), Gaps = 20/234 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP T  W EVPSMPF+KA +LP AFL D LKPIATG++ Y G L VPQSLY 
Sbjct  250  PLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLTDLLKPIATGMTCYNGMLCVPQSLYS  309

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ K
Sbjct  310  WPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENGK  369

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD----  532
            IKVYD ++D+WK + G++PI DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD    
Sbjct  370  IKVYDQKEDTWKVVIGEVPIYDLTDSESPYLLAGFHGKLHFITRDTNHNVTVLRADVPNI  429

Query  533  ----------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                +     +SD  IW++IA+++ G+AEL+SCQ++D+
Sbjct  430  PVSLPSSSSSSVSGSRSLSEKGNAHNKSDTVIWKLIATKDFGAAELVSCQVIDI  483



>ref|XP_009145380.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Brassica rapa]
 ref|XP_009145381.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Brassica rapa]
Length=471

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 176/235 (75%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQ+AEV+DP T +W EVPSMPFTKA +LP AFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  237  SPLQTAEVYDPTTDVWSEVPSMPFTKAQVLPNAFLADLLKPIATGMTCYNGRLCVPQSLY  296

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPET  W EMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  297  SWPFFVDVGGEVYDPETELWGEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENG  356

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD---  532
            KIKVYD ++D+WK + G++P+ D+TDSESPYLLAG  GKL+ I +D N+N+ VL+AD   
Sbjct  357  KIKVYDQKEDAWKVVIGEVPVYDMTDSESPYLLAGFHGKLHFITRDHNRNVTVLRADVPD  416

Query  533  -----------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                 + +   +SD  IW+VIAS++ G+AEL+SCQ++D+
Sbjct  417  VSGSSSSSSFKCVVGSGSLKEKGDAVNKSDTVIWKVIASKDLGAAELVSCQVIDI  471



>ref|XP_007136207.1| hypothetical protein PHAVU_009G027300g [Phaseolus vulgaris]
 gb|ESW08201.1| hypothetical protein PHAVU_009G027300g [Phaseolus vulgaris]
Length=476

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 174/233 (75%), Gaps = 18/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP T  W  VPSMPF++A +LP+AFLAD LKPIATG++SY G+L VPQSLY
Sbjct  244  VPLQSAEVFDPSTDTWSHVPSMPFSRAQVLPSAFLADMLKPIATGLTSYMGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDP+T++W+EMP GMGEGWPARQAGTKLSV+VDGELYA DPS+S DS 
Sbjct  304  SWPFFVDVGGEIYDPDTDSWIEMPAGMGEGWPARQAGTKLSVVVDGELYAFDPSNSMDSG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            +IKVYD  +D+WK + G +PI D  DSESPYLLAG  GKL+VI KDAN +I VLQA  + 
Sbjct  364  RIKVYDQGEDAWKVVIGKVPIYDSADSESPYLLAGFHGKLHVITKDANHDIAVLQAGLRN  423

Query  539  ----------------HNQNENEKESDAN-IWRVIASRNSGSAELISCQILDM  646
                            H   E   ESDA  +WRV+A R+ G AEL+SCQ++D+
Sbjct  424  NLGSSPSLSTLSQSTLHESPELASESDAAVVWRVVACRDFGRAELVSCQVIDI  476



>ref|XP_002890487.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66746.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=478

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 174/235 (74%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP T  W EVPSMPF+KA +LP AFLAD LKPIATG++ Y G+L VPQSLY
Sbjct  244  SPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEVYDPETN WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  304  SWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSSMENG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD---  532
            KIKVYD ++D+WK + G++P+ DLTDSESPYLLAG  GKL+ I +D N N+ VL+AD   
Sbjct  364  KIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLRADVPN  423

Query  533  -----------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                 +     +SD   W++IA+++ G+AEL+SCQ++D+
Sbjct  424  IPVSSSSASSSSVSGSRSSSEKTNAPNKSDTVTWKLIATKDFGAAELVSCQVIDI  478



>ref|XP_002306596.1| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEE93592.1| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=474

 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 176/229 (77%), Gaps = 14/229 (6%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG W +VPSMPF++A ++PTA+L+D LKPIATG++SY G+L+VPQSLY
Sbjct  246  TPLQSAEVFDPCTGTWSDVPSMPFSRAQLVPTAYLSDLLKPIATGMTSYMGRLFVPQSLY  305

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPF VD GGE+Y+PETN+W EMP GMGEGWPARQAGTKLSV+VDGELYA DPS+S +S 
Sbjct  306  SWPFIVDVGGEIYNPETNSWAEMPTGMGEGWPARQAGTKLSVVVDGELYAFDPSTSPNSG  365

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD ++D+WK   G +P+ D T+S+SPYLL G  GK++V+ KDAN NI V+QAD Q 
Sbjct  366  KIKVYDQKEDTWKVAIGKVPVADYTESDSPYLLTGFHGKIHVLTKDANHNIAVMQADVQD  425

Query  542  N--------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            N               +++   S+   W+VI S++ GSAE +SCQ+LD+
Sbjct  426  NLGSPLSSTYVSAKSLHDHPDSSETVFWKVIDSKDFGSAEFVSCQVLDV  474



>ref|XP_008347767.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
 ref|XP_008347768.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
Length=477

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 170/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W EVPSMPF++A  LPTAFL D L+PIATG++ Y G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSEVPSMPFSRARALPTAFLTDMLRPIATGLTPYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W EMP+GMG+GWPARQAGTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDEMPLGMGDGWPARQAGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   S+SPYLLAG  GKL+VI KDAN  I VL+AD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSDSPYLLAGFHGKLHVITKDANHEIAVLRADXCXN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               ++   ESDA +W++I +R+ GS EL+ CQ+LD+
Sbjct  426  LGSLSPTLAPLLASSSDEHSDAPAESDAVVWKIIGTRDFGSGELVGCQVLDL  477



>ref|XP_008378506.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
 ref|XP_008378507.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Malus domestica]
Length=477

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 170/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W EVPSMPF++A  LPTAFL D L+PIATG++ Y G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSEVPSMPFSRARALPTAFLTDMLRPIATGLTPYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W EMP+GMG+GWPARQAGTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDEMPLGMGDGWPARQAGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   S+SPYLLAG  GKL+VI KDAN  I VL+AD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSDSPYLLAGFHGKLHVITKDANHEIAVLRADLCCN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               ++   ESDA +W++I +R+ GS EL+ CQ+LD+
Sbjct  426  LGSLSPTLAPLLASSSDEHSDAPAESDAVVWKIIGTRDFGSGELVGCQVLDL  477



>ref|XP_008233978.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Prunus mume]
 ref|XP_008233979.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Prunus mume]
Length=477

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 169/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W +VPSMPF++A  LPTAFL D L+PIATG++SY G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSQVPSMPFSRAQALPTAFLTDMLRPIATGLTSYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W +MP+GMGEGWPARQ GTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDDMPIGMGEGWPARQVGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   SESPYLLAG  GKL+VI KD N  I VLQAD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSESPYLLAGFHGKLHVITKDVNHEITVLQADLCSN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               +++  ESDA +W+ I +R+ GS EL+ CQ++D+
Sbjct  426  LGPLSPSSPSLLPGFSLDHSDSVAESDAVVWKAIGTRDFGSVELVGCQVIDV  477



>ref|NP_001064441.1| Os10g0363600 [Oryza sativa Japonica Group]
 gb|AAM18732.1|AC092548_10 putative kelch-containing protein [Oryza sativa Japonica Group]
 gb|AAP53323.1| Kelch motif family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26355.1| Os10g0363600 [Oryza sativa Japonica Group]
 gb|EAZ15819.1| hypothetical protein OsJ_31238 [Oryza sativa Japonica Group]
 dbj|BAG99291.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 176/230 (77%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP TGIWVEVP +PF+KA  LPTAFLA+ LKPIATG++S+ GKLYVPQSLY
Sbjct  248  APLQSAEVFDPRTGIWVEVPDIPFSKAQALPTAFLAELLKPIATGMTSFGGKLYVPQSLY  307

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE++DPETN+W EMP+GMGEGWPARQAGTKLS ++DG+LYAL+PS+S D  
Sbjct  308  SWPFFVDVGGEIFDPETNSWAEMPVGMGEGWPARQAGTKLSAVIDGDLYALEPSTSSDRG  367

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR--  535
            KIK+YD ++D+WK   G +P+ D  +SE PYLLAG LGKLN+I KD +  I ++Q D   
Sbjct  368  KIKIYDPQEDAWKVAIGQVPVGDFAESECPYLLAGFLGKLNLIIKDVDSKINIMQTDVLK  427

Query  536  -------------QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                         Q+ Q  +E+E+  N+W+VI S+N  +AEL+SCQ+L++
Sbjct  428  PVELSAPGNGPTCQNQQLSSEQET--NLWKVIVSKNLAAAELVSCQVLNI  475



>gb|EAY78181.1| hypothetical protein OsI_33229 [Oryza sativa Indica Group]
Length=475

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 176/230 (77%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP TGIWVEVP +PF+KA  LPTAFLA+ LKPIATG++S+ GKLYVPQSLY
Sbjct  248  APLQSAEVFDPRTGIWVEVPDIPFSKAQALPTAFLAELLKPIATGMTSFGGKLYVPQSLY  307

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE++DPETN+W EMP+GMGEGWPARQAGTKLS ++DG+LYAL+PS+S D  
Sbjct  308  SWPFFVDVGGEIFDPETNSWAEMPVGMGEGWPARQAGTKLSAVIDGDLYALEPSTSSDRG  367

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR--  535
            KIK+YD ++D+WK   G +P+ D  +SE PYLLAG LGKLN+I KD +  I ++Q D   
Sbjct  368  KIKIYDPQEDAWKVAIGQVPVGDFAESECPYLLAGFLGKLNLIIKDVDSKINIMQTDVLK  427

Query  536  -------------QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                         Q+ Q  +E+E+  N+W+VI S+N  +AEL+SCQ+L++
Sbjct  428  PVELSAPGNGPTCQNQQLSSEQET--NLWKVIVSKNLAAAELVSCQVLNI  475



>ref|XP_009345524.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
 ref|XP_009345525.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Pyrus x 
bretschneideri]
Length=477

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 169/232 (73%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W EVPSMPF++A  LPT FL D L+PIATG++ Y G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSEVPSMPFSRAQALPTPFLTDMLRPIATGLTPYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W EMP+GMG+GWPARQAGTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPETNSWDEMPLGMGDGWPARQAGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   S+SPYLLAG  GKL+VI KDAN  I VL+AD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSDSPYLLAGFHGKLHVITKDANHEIAVLRADLCSN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                               ++   ESDA +W++I +R+ GS EL+ CQ+LD+
Sbjct  426  LGSLSPTLAPLLASSSDEHSDALAESDAVVWKIIGTRDFGSGELVGCQVLDL  477



>ref|XP_006827020.1| hypothetical protein AMTR_s00010p00220140 [Amborella trichopoda]
 gb|ERM94257.1| hypothetical protein AMTR_s00010p00220140 [Amborella trichopoda]
Length=469

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 179/232 (77%), Gaps = 17/232 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAE +DPE G+W +VPSMPF++A  LPTAFL D LKPIATG++SYRGKLYVPQSLY
Sbjct  238  TPLQSAEAYDPELGLWTQVPSMPFSRAQDLPTAFLIDMLKPIATGMTSYRGKLYVPQSLY  297

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE+YDP TN W EMP GMGEGWPARQAGTKLSV+VDGELY+LDPSSS DS 
Sbjct  298  SWPFFVDVGGEIYDPVTNTWFEMPAGMGEGWPARQAGTKLSVVVDGELYSLDPSSSLDSG  357

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIKVYD +DD WK + G +PI D TDSESPYLLAG LGKL+VI KD   NI++LQA+ + 
Sbjct  358  KIKVYDHQDDIWKVVLGKVPILDFTDSESPYLLAGFLGKLHVITKDIENNIVILQAELRK  417

Query  542  NQ-----------------NENEKESDANIWRVIASRNSGSAELISCQILDM  646
            ++                  +  K +++N W+ IASR+ G+AEL+SCQIL++
Sbjct  418  DKAVIASTSSSTSSSSSCDGDQVKGTESNDWKTIASRSFGNAELVSCQILNI  469



>ref|XP_003544176.2| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine 
max]
 gb|KHN04691.1| F-box/kelch-repeat protein [Glycine soja]
Length=477

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 173/233 (74%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP    W +VPSMPF++A +LPTAFLAD LKPIATG+SSY+G+LYVPQSLY 
Sbjct  245  PLQSAEVFDPFKDTWSDVPSMPFSRAGVLPTAFLADMLKPIATGLSSYKGRLYVPQSLYS  304

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W+EMP GMGEGWP +QAGTKLSV+V+GELYA DPS+S DS +
Sbjct  305  WPFFVDVGGEIYDPETNSWMEMPNGMGEGWPIKQAGTKLSVVVNGELYAFDPSNSVDSGR  364

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +P+ D T+ E PYLLAG  GKL+ I KDAN +I VLQAD   N
Sbjct  365  IKVYDQGEDAWKVVIGKVPVYDFTELEYPYLLAGFHGKLHFITKDANHDISVLQADLCSN  424

Query  545  QN-------------------ENEKESDANIWRVIASRNSGSAELISCQILDM  646
             +                   +   E+D  IW+++AS+  G AELI+CQ++D+
Sbjct  425  LDSSQSTSTPQSPKSMEDELLQESTETDEVIWKLVASKGFGQAELINCQVIDI  477



>gb|KHN26062.1| F-box/kelch-repeat protein [Glycine soja]
Length=475

 Score =   293 bits (750),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 174/233 (75%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP +  W +VPSMPF++A +LPTAFLAD LKPIATG++SY+G+LYVPQSLY 
Sbjct  243  PLQSAEVYDPFSDTWSDVPSMPFSRAGVLPTAFLADMLKPIATGLTSYKGRLYVPQSLYS  302

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W+EMP GMGEGWP +QAGTKLSV+V+GELYA DPS+S DS +
Sbjct  303  WPFFVDVGGEIYDPETNSWMEMPNGMGEGWPVKQAGTKLSVVVNGELYAFDPSNSVDSGR  362

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D WK + G +P+ D T+SESPYLLAG  GKL+ I KDAN +I VLQAD   N
Sbjct  363  IKVYDQGEDEWKVVIGKVPVYDFTESESPYLLAGFHGKLHFITKDANHDISVLQADHCSN  422

Query  545  QNEN-------------------EKESDANIWRVIASRNSGSAELISCQILDM  646
             + +                     E+D  +W+++AS+    AELI+CQ++D+
Sbjct  423  VDSSPSTSAPQSPKYMEDELLRESAETDEAVWKLVASKGFEQAELINCQVIDI  475



>ref|XP_010691533.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 175/233 (75%), Gaps = 19/233 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQ AEVFDP+T  W EVPSMPF+KA ++PTAFLAD LKPIATG+++Y+GKLYVPQSLY
Sbjct  242  TPLQCAEVFDPKTDQWSEVPSMPFSKAQVMPTAFLADLLKPIATGLTTYKGKLYVPQSLY  301

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
            CWPFFVDAGGE+YDPETN+W EMP+GMGEGWPA+QAGTKLSV+VD ELYALD S S DSA
Sbjct  302  CWPFFVDAGGEIYDPETNSWSEMPVGMGEGWPAKQAGTKLSVVVDDELYALDLSGSLDSA  361

Query  362  KIKVYDSRDDSWKAIEGDIPI-RDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
            KIKVYD RDDSWK + G++PI  D  D+ESPYLL    G L+VI K+AN +I VLQA  +
Sbjct  362  KIKVYDHRDDSWKVVFGEVPITHDQADAESPYLLTCFRGNLHVIIKNANSDIAVLQAVTE  421

Query  539  HNQNENEKE-----------------SDANIWRVIASRNSGSAELISCQILDM  646
                 +  +                 S+ N W+ IASR +G AEL+SCQIL +
Sbjct  422  SLPQPSHLKPLTSGSSSAGSSVASSPSEVN-WKFIASRKAGPAELVSCQILRI  473



>ref|XP_010539614.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Tarenaya hassleriana]
Length=477

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +P+QSAEV+DP +  W+E+PSMPF+KA MLP AF   FLKPIATG++SY G+L V QSLY
Sbjct  244  SPIQSAEVYDPSSDTWLEIPSMPFSKAEMLPNAFFTGFLKPIATGMTSYNGRLCVSQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WP  VD GGE+YDPETN+WVEMP GMGEGWPARQAGTKLSV+VDGELYA DPSSS ++ 
Sbjct  304  SWPIVVDVGGEIYDPETNSWVEMPAGMGEGWPARQAGTKLSVVVDGELYAFDPSSSAENG  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ-  538
            KIKVYD  +D+WK + G++P+ DLT+SESPYLLAGL GKL+ I +D N+NI VL+AD   
Sbjct  364  KIKVYDQNEDAWKVVIGEVPVYDLTESESPYLLAGLHGKLHFITRDRNRNITVLRADVPD  423

Query  539  ------------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                              H + ++   SD  IW VIA+++ G+AELISCQ++D+
Sbjct  424  SSSSPSSSSSPVVGSCPFHGKADSVDTSDTVIWNVIATKDLGAAELISCQVIDL  477



>ref|XP_007222822.1| hypothetical protein PRUPE_ppa005093mg [Prunus persica]
 gb|EMJ24021.1| hypothetical protein PRUPE_ppa005093mg [Prunus persica]
Length=477

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 167/232 (72%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVF+P TG W +VPSMPF +A  LPTAFL D L+PIATG++SY G+L V QSLY 
Sbjct  246  PLQSAEVFEPSTGTWSQVPSMPFARAQALPTAFLTDMLRPIATGLTSYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE YDPETN+W +MP+GMGEGWPARQAGTKLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGETYDPETNSWDDMPIGMGEGWPARQAGTKLSVVVDGELYAFDPSSSLDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +PI D   SESPYLLAG  GKL+VI KD N  I VL+AD   N
Sbjct  366  IKVYDQGEDAWKVVIGKVPIHDFAGSESPYLLAGFHGKLHVITKDVNHEITVLRADLCSN  425

Query  545  ------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                ++  ESDA +W+ I +R+ GS EL+ CQ++D+
Sbjct  426  LGPLSPSSPSLLPGSSLDHFDSVAESDAVVWKSIGTRDFGSVELVGCQVIDV  477



>ref|NP_001047209.1| Os02g0574900 [Oryza sativa Japonica Group]
 dbj|BAD33349.1| kelch repeat-containing F-box-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF09123.1| Os02g0574900 [Oryza sativa Japonica Group]
 gb|EAZ23535.1| hypothetical protein OsJ_07234 [Oryza sativa Japonica Group]
Length=460

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 170/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+S EVFDP+TGIW E+P MPF KA +LPTAFLAD LKPIATG++SY+GKLYVPQSLY 
Sbjct  248  PLRSGEVFDPKTGIWSELPEMPFMKAQVLPTAFLADVLKPIATGMASYKGKLYVPQSLYS  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDPE N+W  M  G+G+GWPARQAGTKL ++V+ ELY L+PSSS DS +
Sbjct  308  WPFFFDIGGEIYDPELNSWETMADGLGDGWPARQAGTKLGIVVNEELYTLEPSSSLDSGQ  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YDS  D+WK I   +P+ D TD+E+P+LLAGL GK++VI K+AN N+ V+QA  Q+N
Sbjct  368  IKRYDSEQDTWKTIVPQVPVHDFTDAEAPFLLAGLHGKVHVITKEANNNLQVMQAVLQNN  427

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
              EN    +  IW ++AS+N GSAEL+SCQ+LD+
Sbjct  428  I-ENSPSEENIIWNILASKNFGSAELVSCQVLDV  460



>ref|XP_009403337.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 174/232 (75%), Gaps = 18/232 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL++AEVFDP T +W E+PSMPF K  +LPTAFLAD LKPIATG+ SYRG+L VPQSLY 
Sbjct  245  PLRTAEVFDPLTSLWTELPSMPFVKTQVLPTAFLADMLKPIATGLVSYRGRLCVPQSLYS  304

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDPET++WVEMP GMG+GWPARQAGTKL  +V+G+LYALDP+S  D+ K
Sbjct  305  WPFFFDIGGEIYDPETSSWVEMPHGMGDGWPARQAGTKLGTVVNGDLYALDPASCLDNGK  364

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YD+++D W+ +  ++P+R LTDSESP+LLAGLLGKL+VI KDAN +I++L+AD Q  
Sbjct  365  IKKYDNQEDVWRVVIENVPVRYLTDSESPFLLAGLLGKLHVIMKDANHHIVILEADLQRR  424

Query  545  QNENEK------------------ESDANIWRVIASRNSGSAELISCQILDM  646
               N                    E +   W+VI +++SG AEL+SCQ+LD+
Sbjct  425  TGSNVSTSSTAPADSMTDNPVSLVEEEPEFWKVIDAKDSGVAELVSCQVLDI  476



>ref|XP_006661717.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Oryza brachyantha]
Length=475

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 172/231 (74%), Gaps = 21/231 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TGIW E+P MPF+KA  LPTAFLA+ LKPIATG++S+ GKLYVPQSLY 
Sbjct  249  PLQSAEVFDPRTGIWAEMPDMPFSKAQALPTAFLAELLKPIATGVTSFGGKLYVPQSLYS  308

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE +DPETN+W EMP+GMGEGWPARQAGTKLS ++DG+LYAL+PS+S D  K
Sbjct  309  WPFFVDVGGETFDPETNSWAEMPVGMGEGWPARQAGTKLSAVIDGDLYALEPSTSSDRGK  368

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD----  532
            IK+YD ++D+WK   G +P+ D  +SE PYLLAG LGKL++I KD N  I ++Q D    
Sbjct  369  IKIYDPQEDTWKVAVGQVPVGDFAESECPYLLAGFLGKLHLIIKDVNSKINIMQTDVLKP  428

Query  533  -------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          QH  ++ E     N+W+VIAS++  +AEL+SCQ+L++
Sbjct  429  VELSAPGTVSTCQDQHLSSQQE----TNLWKVIASKDLAAAELVSCQVLNI  475



>ref|XP_002513866.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48449.1| conserved hypothetical protein [Ricinus communis]
Length=471

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 174/232 (75%), Gaps = 22/232 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP T  W EVPSMPF+K+H    AF  D LKPIATG++SYRG+L VPQSLY 
Sbjct  244  PLQSAEVFDPCTDKWSEVPSMPFSKSH----AFWPDMLKPIATGMTSYRGRLCVPQSLYS  299

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVDAGGE+YDPETN+W EMP GMGEGWPARQAGTKLSV+VDGELY+LDPSSS DS K
Sbjct  300  WPFFVDAGGEIYDPETNSWAEMPAGMGEGWPARQAGTKLSVVVDGELYSLDPSSSQDSGK  359

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ--  538
            IKVYD ++D+WK + G +PI D  DS+SP+LLAG  GK++V+ +DAN  ++V+QA  +  
Sbjct  360  IKVYDQKEDAWKVVIGKVPIYDSGDSDSPHLLAGFHGKIHVVTRDANHRLVVMQAGLRDN  419

Query  539  ----------------HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                            H  + +  ES+  +W+V+AS+N  SAEL+SCQ+LD+
Sbjct  420  LNSLALSSTSHFDGSLHEHSASLAESETVVWKVVASKNIESAELVSCQVLDI  471



>ref|XP_004983240.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Setaria italica]
 ref|XP_004983241.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Setaria italica]
Length=475

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 172/230 (75%), Gaps = 18/230 (8%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEVFDP TG+W EVP M F+KA  LPTAFLA+ LKPIATG++SYRGKLYVPQSLY
Sbjct  249  TPLQSAEVFDPATGVWAEVPDMTFSKAQALPTAFLAELLKPIATGMTSYRGKLYVPQSLY  308

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE +DPETN+W EMP+GMGEGWPARQAGTKLS +VDG+LYAL+PS+S DS 
Sbjct  309  SWPFFVDVGGETFDPETNSWAEMPVGMGEGWPARQAGTKLSAVVDGDLYALEPSTSSDSG  368

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR--  535
            KIK+YD + D+WK     +P+ D  +SESPYLLAG LGKL++I KD + N +++Q D   
Sbjct  369  KIKIYDPQGDTWKVAVSQVPVGDFAESESPYLLAGFLGKLHLIIKDVD-NTIIMQTDLLK  427

Query  536  -------------QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                         Q+     EKE+D  +W+ IAS+N   AELISCQ+L +
Sbjct  428  PTDSAAPSAGTTCQNPDVSFEKETD--VWKAIASKNIAVAELISCQVLSI  475



>ref|XP_003542593.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine 
max]
Length=475

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 173/233 (74%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEV+DP +  W +VPSMPF++A +LPTAFLAD LKPIATG++SY+G+LYVPQSLY 
Sbjct  243  PLQSAEVYDPFSDTWSDVPSMPFSRAGVLPTAFLADMLKPIATGLTSYKGRLYVPQSLYS  302

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W+EMP GMGEGWP +QAGTKLSV+V+GELYA DPS+S DS +
Sbjct  303  WPFFVDVGGEIYDPETNSWMEMPNGMGEGWPVKQAGTKLSVVVNGELYAFDPSNSVDSGR  362

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D WK + G +P+ D T+SESPYLLAG  GKL+ I KDAN +I VL+AD   N
Sbjct  363  IKVYDQGEDEWKVVIGKVPVYDFTESESPYLLAGFHGKLHFITKDANHDISVLKADHCSN  422

Query  545  QNEN-------------------EKESDANIWRVIASRNSGSAELISCQILDM  646
             + +                     E+   +W+++AS+    AELI+CQ++D+
Sbjct  423  VDSSPSTSAPQSPKYMEDELLRESAETHEAVWKLVASKGFEQAELINCQVIDI  475



>ref|XP_006647411.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Oryza brachyantha]
Length=460

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+S EVFDP+TGIW E+P MPF KA +LPTAFLAD LKPIATG++SY+GKLYVPQSLY 
Sbjct  248  PLRSGEVFDPKTGIWSELPEMPFMKAQVLPTAFLADVLKPIATGMASYKGKLYVPQSLYS  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDPE+N+W  MP G+G+GWPARQAGTKL ++V+ ELY L+PSSS DS +
Sbjct  308  WPFFFDIGGEIYDPESNSWETMPDGLGDGWPARQAGTKLGIVVNNELYTLEPSSSLDSGQ  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YDS  D+W      +P+ D TD+E+P+LLAGL GK++VI K+AN N+ V+QA  Q N
Sbjct  368  IKRYDSEQDTWITSVPQVPVHDFTDAEAPFLLAGLHGKVHVITKEANNNLQVMQAVLQDN  427

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
              EN    +  IW ++AS+N GSAE++SCQ+LD+
Sbjct  428  I-ENSPSEENIIWNILASKNFGSAEIVSCQVLDV  460



>ref|XP_004300659.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 170/233 (73%), Gaps = 19/233 (8%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP T  W EVPSMPF+KA  LPTAFL D LKPIATG++ Y G+L V QSLY 
Sbjct  246  PLQSAEVFDPSTSTWSEVPSMPFSKAQALPTAFLTDMLKPIATGLTPYMGRLCVSQSLYS  305

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDP+TN+W+EMP GMG+GWPARQAG+KLSV+VDGELYA DPSSS DS K
Sbjct  306  WPFFVDVGGEIYDPKTNSWIEMPNGMGDGWPARQAGSKLSVVVDGELYAFDPSSSMDSGK  365

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD ++D+WK +   +P+ DL  SESPYLLAG  GKL+VI KD N  I VL+AD +++
Sbjct  366  IKVYDQQEDAWKVVIRKLPMCDLAGSESPYLLAGFHGKLHVITKDINHEIAVLRADLRND  425

Query  545  -------------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                 E+  ESD  +W+ I +++ G +EL+SCQ++D+
Sbjct  426  LGSLSSSSCSVIARSLLDEHPESLAESDTVVWKAIGTKDFGPSELVSCQVIDI  478



>ref|XP_003575210.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Brachypodium 
distachyon]
Length=461

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 167/214 (78%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+S EVFDP+TG+W E+P MPF KA +LPTAFLAD LKPIATG++SY+GKLYVPQSLY 
Sbjct  249  PLRSGEVFDPKTGLWSELPEMPFVKAQVLPTAFLADVLKPIATGMASYKGKLYVPQSLYS  308

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YD E N+W  MP G+G+GWPARQAGTKL ++V+ ELY L+PSSS DS +
Sbjct  309  WPFFFDIGGEIYDSELNSWSSMPDGLGDGWPARQAGTKLGMVVNDELYTLEPSSSLDSGQ  368

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YDS +D W+ I   +P+ D TD+ESPYLLA L G+L+VI K AN N+ V+QA  Q N
Sbjct  369  IKKYDSEEDVWRTIVPQVPVHDFTDAESPYLLASLHGRLHVITKGANNNLQVMQAVLQ-N  427

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
              E+    +  +W ++AS+N G+AEL+SCQ+LD+
Sbjct  428  STESVPHEENVLWSIVASKNFGAAELVSCQVLDV  461



>ref|XP_004952865.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Setaria 
italica]
Length=460

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+SAEVFDP+TG+W E+P MPF KA +LPTAFLAD LKPIATG++ Y+GKLYVPQSLY 
Sbjct  248  PLRSAEVFDPKTGLWSELPEMPFAKAQVLPTAFLADVLKPIATGMAPYKGKLYVPQSLYS  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDPE N+W  MP G+G+GWPARQAGTKL +++D +LY L+PSSS DS +
Sbjct  308  WPFFFDIGGEIYDPELNSWSTMPDGLGDGWPARQAGTKLGIVIDDKLYTLEPSSSLDSGQ  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK Y+S +D+W AI   +P+ D TD+E+PYLLAGL G+L+VI K AN  + V+QA  Q N
Sbjct  368  IKRYNSEEDTWVAITPQVPVNDFTDAEAPYLLAGLRGRLHVITKVANNTLQVMQAVVQ-N  426

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
              +N    +  +W  +ASRN G+AEL+SCQ+LD+
Sbjct  427  SADNRASEENVLWTPVASRNFGTAELVSCQVLDV  460



>gb|ABR16276.1| unknown [Picea sitchensis]
Length=469

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 169/227 (74%), Gaps = 12/227 (5%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAE +DP T  W ++ +MPF +A +LPTAFLAD LKPIATG++++RGKL VPQSLY
Sbjct  243  TPLQSAEAYDPVTNTWTQISNMPFARAQVLPTAFLADMLKPIATGMTAFRGKLCVPQSLY  302

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE YDP T++W+EMP GMG+GWPARQAGTKLSV+VDG LYALDPSSS DS 
Sbjct  303  SWPFFVDVGGETYDPATDSWMEMPNGMGDGWPARQAGTKLSVVVDGNLYALDPSSSLDSG  362

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            KIK+YD ++D+WK I   +P+ D +DSESPYLLAG LGKL+VI KD   NI VLQAD   
Sbjct  363  KIKMYDPQEDTWKVILRKVPVIDFSDSESPYLLAGFLGKLHVITKDIGDNIAVLQADTSE  422

Query  542  N------------QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                          + +  +S+A+ W+ I SR+ G  EL+SCQ+L +
Sbjct  423  GAVLSSSSSSPSDPSTSISDSEADGWKSIGSRHFGFVELVSCQVLKI  469



>dbj|BAK00470.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+S EVFDP+TG+W E+P MPF KA +LPTAFLAD LKPIATG++SY GKLYVPQSLY 
Sbjct  248  PLRSGEVFDPKTGLWSELPEMPFVKAQVLPTAFLADVLKPIATGMASYNGKLYVPQSLYS  307

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YD E N+W  MP G+G+GWPARQAGTKL V+V+ ELY L+PSSS DS +
Sbjct  308  WPFFFDIGGEIYDSELNSWSTMPDGLGDGWPARQAGTKLGVVVNDELYTLEPSSSLDSGQ  367

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YD+ +D W+ +   IP+ D TD+ESPYLL GL G+L+VI K+AN N+ V+QA  ++N
Sbjct  368  IKRYDAEEDVWRTMVPHIPVHDFTDAESPYLLTGLHGRLHVITKEANNNLQVIQAVLENN  427

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
               +  E +  +W ++AS+N G+AELISCQ+L++
Sbjct  428  TGNDVPEGNV-LWNIVASKNFGAAELISCQVLNV  460



>ref|XP_009380839.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380840.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380841.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 170/230 (74%), Gaps = 15/230 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPL SAE FDP TG+W E+PSMPF K  + P AFLAD +KPIATG++SYRG+L VPQSLY
Sbjct  244  TPLHSAEAFDPATGLWTELPSMPFLKTRVFPLAFLADMVKPIATGMASYRGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFF D GGEVYDPET +WV+MP GMG+GWPARQAGTKL  +V+G+LYALDPS   DSA
Sbjct  304  SWPFFFDIGGEVYDPETGSWVDMPPGMGDGWPARQAGTKLGAVVNGDLYALDPSRYLDSA  363

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD  +D+W+ +   +P+   +DSESPYLLAG LGKL+VI KDA+ +I++++AD + 
Sbjct  364  QIKVYDEEEDAWRVVAERVPLHCFSDSESPYLLAGFLGKLHVITKDASDHIVIMEADSRR  423

Query  542  NQNEN---------------EKESDANIWRVIASRNSGSAELISCQILDM  646
             +  N                +E +  I +VIA+++ G+AEL+ CQ+LD+
Sbjct  424  CRGSNVSTSSTAPVDAIADSSEEEEPQILKVIAAKDFGAAELVGCQVLDL  473



>ref|XP_007141132.1| hypothetical protein PHAVU_008G170100g [Phaseolus vulgaris]
 ref|XP_007141133.1| hypothetical protein PHAVU_008G170100g [Phaseolus vulgaris]
 gb|ESW13126.1| hypothetical protein PHAVU_008G170100g [Phaseolus vulgaris]
 gb|ESW13127.1| hypothetical protein PHAVU_008G170100g [Phaseolus vulgaris]
Length=480

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 177/236 (75%), Gaps = 22/236 (9%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+SAEV+DP T  W +VPSMPF++A +LPT FLAD L+PIATG++SY+G+LYVPQSLY 
Sbjct  245  PLRSAEVYDPFTDTWSDVPSMPFSRAGVLPTVFLADMLRPIATGLTSYKGRLYVPQSLYS  304

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGE+YDPETN+W+EMP GMGEGWP +QAGTKLSV+V+ ELYA DPS+S D+ K
Sbjct  305  WPFFVDVGGEIYDPETNSWIEMPNGMGEGWPIKQAGTKLSVVVNDELYAFDPSNSMDNGK  364

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IKVYD  +D+WK + G +P+ D ++SESPYLLAGL GKL+ IAK++ Q+I VLQA   +N
Sbjct  365  IKVYDEGEDAWKVVIGKVPVYDFSNSESPYLLAGLHGKLHFIAKNSKQDIAVLQAVPCNN  424

Query  545  ----------------QNE------NEKESDANIWRVIASRNSGSAELISCQILDM  646
                            Q+E       E E+D  +W  +ASR+ G +ELI+CQ++D+
Sbjct  425  LDSSPSASTSLSPKSMQDEFLIDSAAETETDPVVWIEVASRSFGLSELINCQVVDI  480



>ref|XP_001770485.1| predicted protein [Physcomitrella patens]
 gb|EDQ64654.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DPET  W +V  MPF +A ++PTAFLAD LKPIATG++SY GKL VPQSLY
Sbjct  244  TPLQSAEVYDPETDSWSQVAPMPFRRAQVIPTAFLADMLKPIATGMASYNGKLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE++DP T+ W EMP GMGE WPARQAGTKLSV+V G+LYALDP+SS D +
Sbjct  304  SWPFFVDVGGEIFDPATDTWAEMPNGMGEDWPARQAGTKLSVVVGGKLYALDPTSSMDGS  363

Query  362  KIKVYDSRDDSWKAIEGDIPI-RDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
            KIKVYDS  D WK +   +PI  DL+DSESPYLLAG  GKL+VI KD N N+ VL+A+  
Sbjct  364  KIKVYDSEQDVWKVVLKKVPILLDLSDSESPYLLAGFDGKLHVITKDINDNVTVLRAELG  423

Query  539  HN-QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
             N Q++N KES    W+ I+S + G  EL++CQ+LD+
Sbjct  424  DNSQSQNAKESVCG-WKTISSASFGPVELVACQVLDL  459



>ref|XP_002452328.1| hypothetical protein SORBIDRAFT_04g023750 [Sorghum bicolor]
 gb|EES05304.1| hypothetical protein SORBIDRAFT_04g023750 [Sorghum bicolor]
Length=459

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+SAE FDP+TG+W E+P MPF KA +LPTAFL D LKPIATG++ Y GKLYVPQSLY 
Sbjct  247  PLRSAEAFDPKTGLWSELPEMPFAKAQVLPTAFLVDVLKPIATGMAPYNGKLYVPQSLYS  306

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDP+ NAW  MP G+G+GWPARQAGTKL +++D +LY L+PS S DS +
Sbjct  307  WPFFFDIGGEIYDPDLNAWSTMPDGLGDGWPARQAGTKLGIVIDDKLYTLEPSGSLDSGQ  366

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK Y+S +D+W  I   +P+ D TD+E+PYLLAGL G+L+VI K AN  + V+QA  Q+N
Sbjct  367  IKRYNSEEDTWVTILPQVPVNDFTDAEAPYLLAGLHGRLHVITKAANNTLQVMQAVVQNN  426

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
             ++N    +  +W  +ASRN G+AEL+SCQ+LD+
Sbjct  427  -SDNAVSGENVVWTTVASRNFGTAELVSCQVLDV  459



>gb|EMT28646.1| hypothetical protein F775_12734 [Aegilops tauschii]
Length=547

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 167/223 (75%), Gaps = 9/223 (4%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TGIW +VPSMPF+KA  LPTAFLAD LKP+ATGI S+ GKLYVPQSLY 
Sbjct  325  PLQSAEVFDPATGIWADVPSMPFSKAQTLPTAFLADLLKPVATGIVSFGGKLYVPQSLYS  384

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFFVD GGEV+DP T++W +MP+G+ EGWP RQAGTKLS +VDG+LYAL+P +  DS K
Sbjct  385  WPFFVDVGGEVFDPATDSWSDMPVGLSEGWPGRQAGTKLSAVVDGDLYALEPPTCSDSGK  444

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR---  535
            IK+YD  +D+WKA+   +P+ D  +S+ PYLLAGLLGKL+++ KDAN  I +LQ D    
Sbjct  445  IKMYDPNEDTWKAVVSQVPVGDFAESKCPYLLAGLLGKLHLVIKDANSMISILQTDALKP  504

Query  536  -----QHNQNENEK-ESDANIWRVIASRNSGSAELISCQILDM  646
                    QN +   E D +IWR++ S+   +AEL+SCQ L +
Sbjct  505  MDATGSTCQNPDVSWEQDIDIWRMVGSKKFAAAELVSCQALSI  547



>ref|NP_001147929.1| LOC100281539 [Zea mays]
 ref|XP_008677201.1| PREDICTED: LOC100281539 isoform X1 [Zea mays]
 ref|XP_008677202.1| PREDICTED: LOC100281539 isoform X1 [Zea mays]
 gb|ACG29158.1| kelch motif family protein [Zea mays]
 gb|AFW62711.1| hypothetical protein ZEAMMB73_171028 [Zea mays]
Length=456

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 4/214 (2%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PL+SAE FDP+TG+W ++P MPF +A +LPTAFL D LKPIATG++ Y+GKLYVPQSLY 
Sbjct  247  PLRSAEAFDPKTGLWSDLPEMPFARAQVLPTAFLVDVLKPIATGMAPYKGKLYVPQSLYS  306

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF D GGE+YDP+ NAW  MP G+G+GWPARQAGTKL V++D  LY L+PSSS DS K
Sbjct  307  WPFFFDIGGEIYDPDLNAWSTMPDGLGDGWPARQAGTKLGVVIDDRLYTLEPSSSLDSGK  366

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            IK YDS +D+W  I   +P+ D T +E+PYLLAGL G+L+VI K AN  + V+QA  Q+N
Sbjct  367  IKRYDSEEDAWVTITPQVPVNDFTGAEAPYLLAGLGGRLHVITKAANNTLQVMQAVVQNN  426

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                E      +W  +ASRN G+AEL+SCQ+LD+
Sbjct  427  SVSEENV----VWTTVASRNFGTAELVSCQVLDV  456



>ref|XP_010541375.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Tarenaya 
hassleriana]
 ref|XP_010541376.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Tarenaya 
hassleriana]
Length=478

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 173/235 (74%), Gaps = 20/235 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PL+SAEV+DP    W EVPSMPF+KA +LP AFLA  LKP+ATG+SSY G+L VPQSLY
Sbjct  244  SPLRSAEVYDPSANAWSEVPSMPFSKAQVLPNAFLAGLLKPVATGMSSYNGRLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALD-PSSSFDS  358
             WPF+VD GGEVY+PETN+W+EMP+GMGEGWPARQAGTKLSV+VDGELY  D P SS +S
Sbjct  304  SWPFYVDIGGEVYEPETNSWIEMPIGMGEGWPARQAGTKLSVVVDGELYGFDPPPSSMES  363

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
              IKVYD ++D+WK +  ++P+ DL  SESPY+LAG  GKL+ I +D N  I VL+AD +
Sbjct  364  GNIKVYDQKEDTWKVVIREVPVSDLPQSESPYILAGFHGKLHFITRDFNGKITVLRADLR  423

Query  539  H--------------NQNENEK-----ESDANIWRVIASRNSGSAELISCQILDM  646
                           +++  EK      +D  +W+VIA+++ G+AEL+SCQ++D+
Sbjct  424  ESSSSPSSGPYPFAGSRSFREKTDLPNTTDTVVWKVIAAKDFGAAELVSCQVIDL  478



>dbj|BAJ94310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=455

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 166/225 (74%), Gaps = 11/225 (5%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQSAEVFDP TGIW +VP+MPF+KA  LPTAFLAD LKP+ATG++++ GKLYVPQSLY 
Sbjct  231  PLQSAEVFDPATGIWADVPNMPFSKAQTLPTAFLADLLKPVATGMTTFGGKLYVPQSLYS  290

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
             PFFVD GGEV+DPET +W +MP+G+ EGWP RQAGTKLS +VDG+LYAL+P +  D  K
Sbjct  291  CPFFVDVGGEVFDPETCSWSDMPVGLSEGWPGRQAGTKLSAVVDGDLYALEPPTCSDGGK  350

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR---  535
            IK+YD ++D+WKA+  ++P+ D  +S+SPYLLAGLLGKL+++ KD N  I +LQ D    
Sbjct  351  IKIYDPKEDTWKAVVSEVPVGDFAESKSPYLLAGLLGKLHLVIKDMNNKISILQTDALRP  410

Query  536  --------QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                    Q+       E   ++WR++ S+   +AEL+SCQ L +
Sbjct  411  MDATGSTCQNPDVSGPWEQGTDVWRMVGSKKFAAAELVSCQALSI  455



>ref|XP_001761819.1| predicted protein [Physcomitrella patens]
 gb|EDQ73260.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 163/216 (75%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DPET  W +V  MPF +A +LPTAFL+D LKPIATG++SY GKL VPQSLY
Sbjct  244  TPLQSAEVYDPETDSWSQVAPMPFRRARVLPTAFLSDMLKPIATGMASYNGKLCVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGE++DP T+ WVEM  GMG  WPARQAGTKLS +V G+LYALDP+SS D +
Sbjct  304  SWPFFVDVGGEIFDPATDTWVEMATGMGNDWPARQAGTKLSAVVGGKLYALDPTSSMDGS  363

Query  362  KIKVYDSRDDSWKAIEGDIPI-RDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
            KIKVYDS  D WK +   +PI  DL+DSESPYLLAG  GKL+VI KD N N+ VL+A+  
Sbjct  364  KIKVYDSDKDVWKVVLKKVPILLDLSDSESPYLLAGFDGKLHVITKDFNNNVTVLRAELG  423

Query  539  HNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
             N   ++ +     W+ I+S + G+ EL++CQ+LD+
Sbjct  424  FNSQSHQAKEFEVGWKTISSASFGAVELVACQVLDL  459



>gb|EYU35402.1| hypothetical protein MIMGU_mgv1a005531mg [Erythranthe guttata]
Length=480

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 175/237 (74%), Gaps = 22/237 (9%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAE FDP TG W E+P+MPF+K  +LPTAFLA+ LKPIATG+ SYRGK+YVPQSLY
Sbjct  244  TPLQSAEAFDPLTGKWSELPNMPFSKGRVLPTAFLAEMLKPIATGMVSYRGKIYVPQSLY  303

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYAL-DPSSSFDS  358
            CWPF+VD GGEVYDPETN+W EMP GMGEGWPARQAG K+SV+VDG+LYAL   SSS DS
Sbjct  304  CWPFYVDVGGEVYDPETNSWAEMPAGMGEGWPARQAGNKMSVVVDGDLYALDPSSSSPDS  363

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDAN-QNILVLQADR  535
             +IK+YD  +DSWK ++ D+PI D+ D E  YLLAG LG L+V+AKD + + I V++A++
Sbjct  364  GRIKMYDCGNDSWKVVKEDVPIGDVADPECKYLLAGFLGNLHVVAKDVDSKKISVMRANK  423

Query  536  QHNQN------------ENEKE--------SDANIWRVIASRNSGSAELISCQILDM  646
            +   +            E+ KE        S  ++W+V+ SR+ GS EL+SCQ L++
Sbjct  424  ESGCDSSIPTQSLADLGESLKEYFGNIPVSSSESVWQVVGSRSGGSVELLSCQSLEI  480



>ref|XP_009103266.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Brassica 
rapa]
 ref|XP_009103267.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Brassica 
rapa]
Length=467

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 166/239 (69%), Gaps = 25/239 (10%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            P+Q+AEV+DP+T +W EVPS+PF+KA ML  AFLA+ LKPIATG++ Y G+L V QSL  
Sbjct  229  PVQTAEVYDPDTDVWSEVPSIPFSKAQMLHDAFLAEMLKPIATGMTCYNGRLCVTQSLCS  288

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDP--SSSFDS  358
            WP F DAGG+VYDPET+ W +MP  MGEGWPARQAGTKLSV+V GELY  DP  SSS ++
Sbjct  289  WPVFYDAGGKVYDPETSLWGDMPSDMGEGWPARQAGTKLSVVVGGELYGFDPSSSSSVEN  348

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD--  532
             KIKVYD R+D+WK + G++P+ D+TDS+S YLLA   GKL+ I +DA  N+ V  AD  
Sbjct  349  GKIKVYDQREDTWKVVIGEVPVYDVTDSKSSYLLAEFHGKLHFITRDAYCNVTVFSADVA  408

Query  533  ---------------------RQHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                                  +   N + K +D+ IW+VIAS++ G+AEL+SC ++D+
Sbjct  409  EIRSSSSSSLSSSKSVLGSCSLKEKGNGDNKSADSVIWKVIASKDLGAAELVSCLVMDI  467



>ref|XP_002978198.1| hypothetical protein SELMODRAFT_152334 [Selaginella moellendorffii]
 gb|EFJ20855.1| hypothetical protein SELMODRAFT_152334 [Selaginella moellendorffii]
Length=410

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DPE   W  +PSMPF  A +LPTAF+ D LKPIATG++++RGKL+VPQSLY
Sbjct  196  TPLQSAEVYDPEADAWSAIPSMPFVGAQVLPTAFVTDILKPIATGMAAFRGKLWVPQSLY  255

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEV+DP +  W EMP GMGEGWPARQAG KLSV+V+G L++LDP S+ + +
Sbjct  256  SWPFFVDVGGEVFDPVSGRWEEMPRGMGEGWPARQAGMKLSVVVNGSLFSLDPMSTAEGS  315

Query  362  KIKVYDSRDDSWKAIEGDIP-IRDL-TDSESPYLLAGLLGKLNVIAKDANQNILVLQADR  535
            KIKVYD   D W+ +   +P + DL T+SESPYLL  L   L+V+ KDA  N+ +L+A+ 
Sbjct  316  KIKVYDFEQDCWRVVVRKVPMVLDLSTESESPYLLGCLRSGLHVVTKDAGNNVTILRAEI  375

Query  536  QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
               +   + E+++  W VIAS++ G  EL++CQ+L++
Sbjct  376  DGGRGAGDSEAES--WTVIASKSFGRVELVACQVLEI  410



>gb|KHN24790.1| F-box/kelch-repeat protein [Glycine soja]
Length=386

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PLQSAEVFDP T  W  VPSMPF+ A +LP+AFLAD  KP+ATG+SSY G+L VPQSL+
Sbjct  204  VPLQSAEVFDPSTDTWSHVPSMPFSGAPVLPSAFLADMPKPVATGLSSYMGRLCVPQSLF  263

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             W  FV+ GG++YDPETN+W+EMP GMGEGWP RQAGTKLSV+VDGELYA DPS+S D  
Sbjct  264  SW-IFVNVGGQIYDPETNSWIEMPAGMGEGWPVRQAGTKLSVVVDGELYAFDPSNSVDGG  322

Query  362  KIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +IKVYD  +D+WK + G +PI D +DSESPYLLAG  GKL+VI KDAN +I +LQA  + 
Sbjct  323  RIKVYDQGEDAWKVVIGKVPIYDSSDSESPYLLAGFHGKLHVITKDANHDIAILQAGLRD  382

Query  542  N  544
            N
Sbjct  383  N  383



>ref|XP_002966362.1| hypothetical protein SELMODRAFT_85806 [Selaginella moellendorffii]
 gb|EFJ32389.1| hypothetical protein SELMODRAFT_85806 [Selaginella moellendorffii]
Length=468

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            TPLQSAEV+DPE   W  +PSMPF  A +LPTAF+ D LKPIATG++++RGKL+VPQSLY
Sbjct  254  TPLQSAEVYDPEADAWSAIPSMPFVGAQVLPTAFVTDILKPIATGMAAFRGKLWVPQSLY  313

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFVD GGEV+DP +  W EMP GMGEGWPARQAG KLSV+V+G L++LDP S+ + +
Sbjct  314  SWPFFVDVGGEVFDPVSGRWEEMPRGMGEGWPARQAGMKLSVVVNGSLFSLDPMSTAEGS  373

Query  362  KIKVYDSRDDSWKAIEGDIP-IRDL-TDSESPYLLAGLLGKLNVIAKDANQNILVLQADR  535
            KIKVYD   D W+ +   +P + DL T+SESPYLL  L   L+V+ KDA  N+ +L+A+ 
Sbjct  374  KIKVYDFEQDCWRVVVRKVPMVLDLSTESESPYLLGCLRSGLHVVTKDAGNNVTILRAEI  433

Query  536  QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
               +   + E+++  W VIAS++ G  EL++CQ+L++
Sbjct  434  DGGRGAGDSEAES--WTVIASKSFGRVELVACQVLEI  468



>gb|ACG30137.1| kelch motif family protein [Zea mays]
Length=476

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 157/229 (69%), Gaps = 15/229 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PL+SAEVFDP TG W E+P M F+K+  +PTA +AD LKP+A G++SY GKL+VPQS Y
Sbjct  249  APLRSAEVFDPATGAWAELPDMLFSKSQAMPTA-IADLLKPVAAGVTSYGGKLHVPQSFY  307

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDP-SSSFDS  358
             WPF VD GGEV+DPETN+W +MP GMGEGWPARQAGT+LS +V+G+LYAL+P +SS   
Sbjct  308  SWPFAVDVGGEVFDPETNSWEQMPAGMGEGWPARQAGTRLSAVVEGDLYALEPATSSSGG  367

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
             +IK+YD+++D+WK     +      +S+SP LLA  LGKL+++ KD    I V+Q D  
Sbjct  368  CEIKMYDAQEDAWKVAVSQVRAGAFDESDSPCLLAAFLGKLHLVVKDMGSRISVMQMDSL  427

Query  539  HNQNENEKESDA-------------NIWRVIASRNSGSAELISCQILDM  646
                ++   S A             ++W+ IAS+N  +AEL+SCQ+L +
Sbjct  428  MKPVDSPALSAATTCRTPDVSSEHTHVWKAIASKNIAAAELVSCQVLSI  476



>ref|NP_001131732.1| uncharacterized protein LOC100193097 [Zea mays]
 ref|XP_008676521.1| PREDICTED: uncharacterized protein LOC100193097 isoform X1 [Zea 
mays]
 gb|ACF80266.1| unknown [Zea mays]
 gb|ACN25674.1| unknown [Zea mays]
 gb|AFW61309.1| kelch motif family protein isoform 1 [Zea mays]
 gb|AFW61310.1| kelch motif family protein isoform 2 [Zea mays]
Length=479

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 157/229 (69%), Gaps = 15/229 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PL+SAEVFDP TG W E+P M F+K+  +PTA +AD LKP+A G++SY GKL+VPQS Y
Sbjct  252  APLRSAEVFDPATGAWAELPDMLFSKSQAMPTA-IADLLKPVAAGVTSYGGKLHVPQSFY  310

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDP-SSSFDS  358
             WPF VD GGEV+DPETN+W +MP GMGEGWPARQAGT+LS +V+G+LYAL+P +SS   
Sbjct  311  SWPFAVDVGGEVFDPETNSWEQMPAGMGEGWPARQAGTRLSAVVEGDLYALEPTTSSSGG  370

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
             +IK+YD+++D+WK     +      +S+SP LLA  LGKL+++ KD    I V+Q D  
Sbjct  371  CEIKMYDAQEDAWKVAVSQVRAGAFDESDSPCLLAAFLGKLHLVVKDMGSRISVVQMDSL  430

Query  539  HNQNENEKESDA-------------NIWRVIASRNSGSAELISCQILDM  646
                ++   S A             ++W+ IAS+N  +AEL+SCQ+L +
Sbjct  431  MKPVDSPALSAATTCRTPDVSSEQTHVWKAIASKNIAAAELVSCQVLSI  479



>gb|ACL53215.1| unknown [Zea mays]
Length=479

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 157/229 (69%), Gaps = 15/229 (7%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
             PL+SAEVFDP TG W E+P M F+K+  +PTA +AD LKP+A G++SY GKL+VPQS Y
Sbjct  252  APLRSAEVFDPATGAWAELPDMLFSKSQAMPTA-IADLLKPVAAGVTSYGGKLHVPQSFY  310

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPF VD GGEV+DPETN+W +MP GMGEGWPARQAGT+LS +V+G+LYAL+P++S    
Sbjct  311  SWPFAVDVGGEVFDPETNSWEQMPAGMGEGWPARQAGTRLSAVVEGDLYALEPTTSSSGG  370

Query  362  K-IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
            + IK+YD+++D+WK     +      +S+SP LLA  LGKL+++ KD    I V+Q D  
Sbjct  371  REIKMYDAQEDAWKVAVSQVRAGAFDESDSPCLLAAFLGKLHLVVKDMGSRISVVQMDSL  430

Query  539  HNQNENEKESDA-------------NIWRVIASRNSGSAELISCQILDM  646
                ++   S A             ++W+ IAS+N  +AEL+SCQ+L +
Sbjct  431  MKPVDSPALSAATTCRTPDVSSEQTHVWKAIASKNIAAAELVSCQVLSI  479



>ref|XP_009390298.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=507

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 154/240 (64%), Gaps = 38/240 (16%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            T L+SAEV+DP TG+W  VPSM F+K           F  P+A G ++Y+GKL VPQ+LY
Sbjct  277  TSLRSAEVYDPRTGLWAPVPSMLFSK-----------FTMPVAAGATTYKGKLCVPQNLY  325

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQA------GTKLSVIVDGELYALDPS  343
             +PF+ D GGE+YDP+TN WV+MP GMG+GWP +QA      G+ LS +++GELYALDP 
Sbjct  326  YYPFYADVGGEMYDPKTNTWVDMPAGMGKGWPGKQAETSLSIGSNLSTVLNGELYALDPC  385

Query  344  -SSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILV  520
             ++ + A+IKVYD  DD WKA+ G +P+ + ++  +PYLL  LLGKL+VIAK+ N    V
Sbjct  386  DAAAEGAQIKVYDQEDDVWKAVMGRVPVHNWSNFGAPYLLVTLLGKLHVIAKEFNNETRV  445

Query  521  LQADRQH--------------------NQNENEKESDANIWRVIASRNSGSAELISCQIL  640
            L+AD +H                       +   E++ N+W VIA++N G+A+ ++C++L
Sbjct  446  LRADPKHSCSSYSTWSSSSSAATIFSSRNPDKSPETERNLWEVIAAKNFGTAQFVACRVL  505



>ref|XP_009390297.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=507

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 154/240 (64%), Gaps = 38/240 (16%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            T L+SAEV+DP TG+W  VPSM F+K           F  P+A G ++Y+GKL VPQ+LY
Sbjct  277  TSLRSAEVYDPRTGLWAPVPSMLFSK-----------FTMPVAAGATTYKGKLCVPQNLY  325

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQA------GTKLSVIVDGELYALDPS  343
             +PF+ D GGE+YDP+TN WV+MP GMG+GWP +QA      G+ LS +++GELYALDP 
Sbjct  326  YYPFYADVGGEMYDPKTNTWVDMPAGMGKGWPGKQAETSLSIGSNLSTVLNGELYALDPC  385

Query  344  -SSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILV  520
             ++ + A+IKVYD  DD WKA+ G +P+ + ++  +PYLL  LLGKL+VIAK+ N    V
Sbjct  386  DAAAEGAQIKVYDQEDDVWKAVMGRVPVHNWSNFGAPYLLVTLLGKLHVIAKEFNNETRV  445

Query  521  LQADRQH--------------------NQNENEKESDANIWRVIASRNSGSAELISCQIL  640
            L+AD +H                       +   E++ N+W VIA++N G+A+ ++C++L
Sbjct  446  LRADPKHSCSSYSTWSSSSSAATIFSSRNPDKSPETERNLWEVIAAKNFGTAQFVACRVL  505



>emb|CDY01300.1| BnaA07g10730D [Brassica napus]
Length=224

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 143/221 (65%), Gaps = 35/221 (16%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQ+AEV+DP+T +W EVPS+PF+KA ML  AFLA+ LKPIATG++ Y G+L V QSL  
Sbjct  32   PLQTAEVYDPDTDVWSEVPSIPFSKAQMLHDAFLAEMLKPIATGMTCYNGRLCVTQSLCS  91

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WP F DAGG+VYDPETN W +MP GMGEGWPARQAGTKLSV+V                 
Sbjct  92   WPVFYDAGGKVYDPETNLWGDMPSGMGEGWPARQAGTKLSVVV-----------------  134

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR---  535
                         + G++P+ D+TDS+S YLLA    KL+ I +DA  N+ V  AD    
Sbjct  135  -----------GVVIGEVPVYDVTDSKSSYLLAEFHRKLHFITRDAYCNVTVFSADSVLG  183

Query  536  ----QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
                +   N + K +D+ IW+VIAS++ G+AEL+SC ++D+
Sbjct  184  SCSLKEKGNGDNKSADSVIWKVIASKDLGAAELVSCLVMDI  224



>emb|CDY00415.1| BnaC07g14110D [Brassica napus]
Length=214

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 137/214 (64%), Gaps = 31/214 (14%)
 Frame = +2

Query  5    PLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            PLQ+AEV+DP+TG+W EVPS+PF+KA +L  AFLA+ LKPIATG++ Y G+L V QSL  
Sbjct  32   PLQTAEVYDPDTGVWSEVPSIPFSKAQVLHDAFLAEMLKPIATGMTCYNGRLCVTQSLCS  91

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WP F DAGG+VYDPETN W +MP G+GEGWPARQAGTKLSV+V GE              
Sbjct  92   WPVFYDAGGKVYDPETNLWGDMPSGLGEGWPARQAGTKLSVVVGGE--------------  137

Query  365  IKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
                             +P+ D+TDS+S YLLA   GKL+ I +DA+ N+ VL+ +    
Sbjct  138  -----------------VPVYDVTDSKSSYLLAEFHGKLHFITRDADCNVSVLRDNVNEI  180

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM  646
               +   S  +  + +  ++ G+AEL+SC ++D+
Sbjct  181  PGSSSSSSSLSSSKSVLGKDLGAAELVSCLVMDI  214



>gb|KHN42571.1| F-box/kelch-repeat protein [Glycine soja]
Length=209

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = +2

Query  122  PIATGISSYR-GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTK  298
            P++ G +  + G+L+VPQSLYCWPFFVD GGEVYDP  N+W+EMP+ MGEGWPARQAGTK
Sbjct  60   PMSVGRAYCKTGRLFVPQSLYCWPFFVDVGGEVYDPNLNSWLEMPIDMGEGWPARQAGTK  119

Query  299  LSVIVDGELYALDPSSSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGK  478
             SV VD +LYALDPS+S DSAKIKV D   D+WK   GD+PI D T+ ES YL   LL K
Sbjct  120  SSVTVDDDLYALDPSNSVDSAKIKVCDYEGDTWKVAAGDVPIHDFTELESTYLFTRLLEK  179

Query  479  LNVIAKDANQNILVLQADRQHNQNEN  556
            L+VI KDAN NI+VLQ D Q+   E+
Sbjct  180  LHVITKDANHNIMVLQDDMQNEHVES  205



>gb|ACU19665.1| unknown [Glycine max]
Length=316

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLY  181
            +PLQSAEV+DP TG+W ++PSMPF +A +LPTAFLAD LKPIATG++SYRG+L+VPQSLY
Sbjct  247  SPLQSAEVYDPHTGMWSQLPSMPFARAQVLPTAFLADLLKPIATGMASYRGRLFVPQSLY  306

Query  182  CWPFFVDAGG  211
            CWPFFVD GG
Sbjct  307  CWPFFVDVGG  316



>emb|CBI19111.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 99/217 (46%), Gaps = 60/217 (28%)
 Frame = +2

Query  20   EVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYV------PQSLY  181
               DP +  W  +PSMP      +P              I +  G LYV        ++ 
Sbjct  110  HALDPLSRRWQRLPSMPNDTLDQMPFC---------GCAIGAVDGCLYVLGGFSSASTMR  160

Query  182  C-WPFFVDAGGEVYDPETNAWVEM-PMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
            C W F         DP  NAW E+ PM  G                              
Sbjct  161  CVWRF---------DPILNAWSEVTPMSTG------------------------------  181

Query  356  SAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADR  535
                + Y   +D+WK + G +PI D TDSESPYLLAG  GKL++I KDAN +I VLQAD 
Sbjct  182  ----RAYCKTEDAWKVVIGKVPICDFTDSESPYLLAGFHGKLHIITKDANHDIAVLQADL  237

Query  536  QHNQNENEKESDANIWRVIASRNSGSAELISCQILDM  646
            + N       S + +W+VIA+R+ G+AEL+SCQ+LD+
Sbjct  238  RDNLGFPPSTSPSFVWKVIATRDFGTAELVSCQVLDI  274



>ref|XP_002461470.1| hypothetical protein SORBIDRAFT_02g003160 [Sorghum bicolor]
 gb|EER97991.1| hypothetical protein SORBIDRAFT_02g003160 [Sorghum bicolor]
Length=414

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 30/176 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DPE G+W  + SM    A               ++  +   G+LYV +    W
Sbjct  230  LNSAEVLDPEKGVWQPIASMGMNMA---------------SSDSAVIGGRLYVTEGC-AW  273

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  MP+GM EGW      T LSV+++G L+ +   S ++  K+
Sbjct  274  PFFSSPRGQVYDPKIDRWEVMPVGMREGW------TGLSVVIEGRLFVI---SEYERMKV  324

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            KVYD+  DSW ++ G  +P R +     P+ ++ L  K+ V+ +  +  I  +Q +
Sbjct  325  KVYDAEADSWDSVSGPPMPERIM----KPFSVSCLDSKIVVVGRGLHVAIGHVQKE  376



>gb|EEC73460.1| hypothetical protein OsI_07769 [Oryza sativa Indica Group]
Length=326

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 22/144 (15%)
 Frame = +2

Query  218  YDPETNAWVEM-PMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKVYDSRDDS  394
            Y+P  N W E+ PM  G  +         + ++  +LY +   S   +  + +       
Sbjct  204  YNPCLNVWQEVSPMISGRAFSK-------AALLQSKLYVVGGVSRGRNGLLPL-------  249

Query  395  WKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQNENEKESDA  574
                   +P+ D TD+E+P+LLAGL GK++VI K+AN N+ V+QA  Q+N  EN    + 
Sbjct  250  ------TVPVHDFTDAEAPFLLAGLHGKVHVITKEANNNLQVMQAVLQNNI-ENSPSEEN  302

Query  575  NIWRVIASRNSGSAELISCQILDM  646
             IW ++AS+N GSAEL+SCQ+LD+
Sbjct  303  IIWNILASKNFGSAELVSCQVLDV  326



>ref|XP_004955477.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Setaria 
italica]
Length=408

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 92/192 (48%), Gaps = 30/192 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP+ G+W  + SM    A               ++  +   G+LYV +    W
Sbjct  222  LNSAEVLDPDKGVWQPIASMGINMA---------------SSDSAVISGRLYVTEGC-AW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G++YDP+ N W  MP+GM EGW      T  SV++DG L+ +   S ++  K+
Sbjct  266  PFFSSPRGQIYDPKINQWEAMPVGMREGW------TGQSVVIDGRLFVI---SEYERMKV  316

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            K+YD   DSW ++ G  +P R +     P+ ++ L  ++ V+ +  +  I  +       
Sbjct  317  KIYDPETDSWDSVSGPPMPERIM----KPFSVSCLDSRIVVVGRGLHVAIGYVDKQPAGG  372

Query  545  QNENEKESDANI  580
             N   + S  ++
Sbjct  373  GNSGNRSSSYSV  384



>ref|NP_001058912.1| Os07g0153400 [Oryza sativa Japonica Group]
 dbj|BAD31583.1| kelch repeat containing F-box protein family-like [Oryza sativa 
Japonica Group]
 dbj|BAF20826.1| Os07g0153400 [Oryza sativa Japonica Group]
Length=406

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 86/170 (51%), Gaps = 30/170 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G+W  V SM    A               ++  +   G+LYV +    W
Sbjct  222  LNSAEVLDPVKGVWQPVASMGMNMA---------------SSDSAVISGRLYVTEGC-AW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  MP+GM EGW      T LSV++D  L+ +   S ++  K+
Sbjct  266  PFFSSPRGQVYDPKIDRWEVMPVGMREGW------TGLSVVIDKHLFVI---SEYERMKV  316

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            KVYD   DSW +++G  +P R +     P+ ++ L  K+ V+ +  +  I
Sbjct  317  KVYDPETDSWDSVKGPPMPERIM----KPFSVSCLENKIVVVGRGLHVAI  362



>gb|EAZ02807.1| hypothetical protein OsI_24933 [Oryza sativa Indica Group]
 gb|EAZ38729.1| hypothetical protein OsJ_23130 [Oryza sativa Japonica Group]
Length=515

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 94/192 (49%), Gaps = 32/192 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G+W  V SM    A               ++  +   G+LYV +    W
Sbjct  331  LNSAEVLDPVKGVWQPVASMGMNMA---------------SSDSAVISGRLYVTEGC-AW  374

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  MP+GM EGW      T LSV++D  L+ +   S ++  K+
Sbjct  375  PFFSSPRGQVYDPKIDRWEVMPVGMREGW------TGLSVVIDKHLFVI---SEYERMKV  425

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            KVYD   DSW +++G  +P R +     P+ ++ L  K+ V+ +    ++ +    +Q  
Sbjct  426  KVYDPETDSWDSVKGPPMPERIM----KPFSVSCLENKIVVVGR--GLHVAIGHVKKQPG  479

Query  545  QNENEKESDANI  580
             + + + S   I
Sbjct  480  SHPDSRSSSYLI  491



>ref|XP_006657454.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Oryza brachyantha]
Length=406

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 93/188 (49%), Gaps = 32/188 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP+ G W  V SM    A               ++  +   G+LYV +    W
Sbjct  222  LNSAEVLDPDKGAWQPVASMGMNMA---------------SSDSAVINGRLYVTEGC-AW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  MP+GM EGW      T LSV++D  L+ +   S ++  K+
Sbjct  266  PFFSSPRGQVYDPKIDRWETMPVGMREGW------TGLSVVIDEHLFVI---SEYERMKV  316

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            KVYD   DSW +++G  +P R +     P+ ++ L  K+ V+ +    ++ +    +Q  
Sbjct  317  KVYDPDTDSWDSVKGPPMPERIM----KPFSVSCLDNKMVVVGR--GLHVAIGHVKKQPG  370

Query  545  QNENEKES  568
             + + + S
Sbjct  371  SHPDSRSS  378



>emb|CDP15791.1| unnamed protein product [Coffea canephora]
Length=405

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 97/201 (48%), Gaps = 41/201 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  V SM                     T ++SY      GKL+V +
Sbjct  221  LNSAEVLDPSIGSWHPVASM--------------------GTNMASYDAAVMNGKLFVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDP TN W  M  G+ EGW      T  SV++DG L+ +   S  
Sbjct  261  GWF-WPFYVVPRGQIYDPRTNVWDSMASGLREGW------TGSSVVIDGHLFVV---SEH  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD  +DSW+ +EG      +     P+ +     ++ V+ +  N ++ V    
Sbjct  311  ERTKLKVYDMENDSWETVEGPPLPEQIC---KPFSVNCYGFRIFVVGR--NLHVAVGHIF  365

Query  533  RQHNQNENEKESDANI-WRVI  592
            RQ+ +  +E++S  ++ W V+
Sbjct  366  RQYGRYSSEEKSSFSVQWGVV  386



>ref|XP_002976330.1| hypothetical protein SELMODRAFT_55890, partial [Selaginella moellendorffii]
 gb|EFJ22590.1| hypothetical protein SELMODRAFT_55890, partial [Selaginella moellendorffii]
Length=378

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 85/169 (50%), Gaps = 27/169 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV+DP   +W  V SM    A     A + D             GKLYV +  + W
Sbjct  187  LSSAEVYDPVMDLWRPVASMGTNMARY--DAAVLD-------------GKLYVTEG-WSW  230

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G++YDP+ + W  M +GM EGW      T LSV++DG L+ +  S   DS K+
Sbjct  231  PFLYSPRGQIYDPKADRWENMRLGMREGW------TGLSVVLDGHLFII--SDLEDSVKL  282

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            KVYD+  DSW+ + G     ++     P+ +  L GKL V+A+  +  I
Sbjct  283  KVYDTGTDSWRCVSGSAMPPNMVK---PFSVNTLNGKLLVVARSLHVAI  328



>ref|XP_002987314.1| hypothetical protein SELMODRAFT_183002 [Selaginella moellendorffii]
 gb|EFJ11629.1| hypothetical protein SELMODRAFT_183002 [Selaginella moellendorffii]
Length=406

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 85/169 (50%), Gaps = 27/169 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV+DP   +W  V SM    A     A + D             GKLYV +  + W
Sbjct  206  LSSAEVYDPVMDLWRPVASMGTNMARY--DAAVLD-------------GKLYVTEG-WSW  249

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G++YDP+ + W  M +GM EGW      T LSV++DG L+ +  S   DS K+
Sbjct  250  PFLYSPRGQIYDPKADRWENMRLGMREGW------TGLSVVLDGHLFII--SDLEDSVKL  301

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            KVYD+  DSW+ + G     ++     P+ +  L GKL V+A+  +  I
Sbjct  302  KVYDTGTDSWRCVSGSAMPPNMV---KPFSVNTLNGKLLVVARSLHVAI  347



>ref|XP_010110957.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXC29343.1| F-box/kelch-repeat protein [Morus notabilis]
Length=404

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 94/200 (47%), Gaps = 40/200 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPLKGNWRPIASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNNWESMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD+  DSW+ IEG      +     P+ +     ++ V+ +  N ++ V    
Sbjct  311  ERMKLKVYDAGTDSWEPIEGPPLPEQIC---KPFAVNACDCRIYVVGR--NLHVAVGHIS  365

Query  533  RQHNQNENEKESDANIWRVI  592
            R +N++ +EK S    W V+
Sbjct  366  RLNNKSNSEKWSFGVQWCVV  385



>dbj|BAJ94540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 91/194 (47%), Gaps = 32/194 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G+W  V SM    A               ++  +   G+LYV +    W
Sbjct  217  LNSAEVLDPVKGVWQPVASMGTNMA---------------SSDSAVIAGRLYVTEGC-AW  260

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  MP GM EGW      T LSV++DG L+ +   S ++  K+
Sbjct  261  PFFSSPRGQVYDPKIDRWEAMPAGMREGW------TGLSVVIDGRLFVI---SEYERMKV  311

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            KVYD   DSW  + G  +P R +     P  ++ L  K+ V+ +    ++++    +Q  
Sbjct  312  KVYDPEMDSWDPVNGPPMPERIM----KPLSVSCLDSKVVVVGR--GLHVVIGHIKKQSA  365

Query  545  QNENEKESDANIWR  586
             N     S   + R
Sbjct  366  GNAGGSSSSNYLIR  379



>emb|CDY30645.1| BnaAnng04200D [Brassica napus]
Length=223

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 84/142 (59%), Gaps = 20/142 (14%)
 Frame = +2

Query  254  MGMGEGWPARQAGTKLSVIVDGE-----LYALDPSSS----FDSAKIKVYD--SRDDSWK  400
            +G+ E W        L V+  G+      Y+LDP S+         + VY+  SR  SW 
Sbjct  91   LGITEEW--------LYVLTKGQDDKLLWYSLDPVSTRWQRLPPMPVIVYEEESRRSSWN  142

Query  401  AIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQNENEKESDANI  580
               G++P+ D+TDSESPYLLAG  GKL+ I +D N+N+ VL+AD   + + +   S ++ 
Sbjct  143  LKVGEVPVYDMTDSESPYLLAGFHGKLHFITRDHNRNVTVLRAD-VPDVSGSSSSSSSSS  201

Query  581  WRVIASRNSGSAELISCQILDM  646
              VIAS++ G+AEL+SCQ++D+
Sbjct  202  KCVIASKDLGAAELVSCQVIDI  223



>ref|XP_008365269.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like, partial 
[Malus domestica]
Length=290

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    TPLQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGI  139
            TPLQSAEVFDP+TG+W +VPSMPF KA +LPTAFLAD LKPIATG+
Sbjct  245  TPLQSAEVFDPKTGVWSQVPSMPFMKAQVLPTAFLADLLKPIATGM  290



>ref|XP_004486017.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Cicer arietinum]
Length=405

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP++G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPQSGNWRSIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP+TN+W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPKTNSWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   DSW+AIEG
Sbjct  311  ERMKLKVYDPETDSWEAIEG  330



>ref|XP_009778334.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Nicotiana sylvestris]
Length=405

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 99/202 (49%), Gaps = 29/202 (14%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  GIW  V +M  TK     +A L               GKL V +  + W
Sbjct  221  LNSAEVLDPNRGIWRSVSNMG-TKMAAYDSAVL--------------NGKLLVTEGWF-W  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF+V   G++YDP+T+ W  M  G+ EGW      T  SV++ G L+ +   S  +  K+
Sbjct  265  PFYVFPRGQIYDPQTDNWENMASGLREGW------TGSSVVLYGRLFVV---SEHERTKL  315

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            KVYDS  DSW  +EG      +     P+ +     ++ V+ ++ +  +  +++ +Q N 
Sbjct  316  KVYDSETDSWDTVEGHPLPEQIC---KPFSVDCCDNRIVVVGRNLHVAVGHIKSLQQKN-  371

Query  548  NENEKESDANIWRVIASRNSGS  613
              +++ S A  W+V+ +  S S
Sbjct  372  TSSKRCSFAVCWQVVEAPESLS  393



>ref|XP_009609743.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Nicotiana tomentosiformis]
Length=405

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 96/195 (49%), Gaps = 29/195 (15%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  GIW  V +M  TK     +A L               GKL V +  + W
Sbjct  221  LNSAEVLDPNRGIWRSVSNMG-TKMAAYDSAVL--------------NGKLLVTEGWF-W  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF+V   G++YDP+T+ W  M  G+ EGW      T  SV++ G L+ +   S  +  K+
Sbjct  265  PFYVFPRGQIYDPQTDNWENMASGLREGW------TGSSVVLYGRLFVV---SEHERTKL  315

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            KVYDS  DSW  +EG      +     P+ +     ++ V+ ++ +  +  +++ +Q N 
Sbjct  316  KVYDSETDSWDTVEGHPLPEQIC---KPFSVDCCDNRIVVVGRNLHVAVGHIKSLQQKN-  371

Query  548  NENEKESDANIWRVI  592
              +++ S A  W+V+
Sbjct  372  TSSKRCSFAVCWQVV  386



>gb|EMS50967.1| hypothetical protein TRIUR3_10316 [Triticum urartu]
Length=159

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 83/159 (52%), Gaps = 17/159 (11%)
 Frame = +2

Query  152  GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYA  331
            G+LYV +    WPFF    G+VYDP+ + W  MP GM EGW      T LSV++DG L+ 
Sbjct  15   GRLYVTEGC-AWPFFSSPRGQVYDPKADRWEAMPAGMREGW------TGLSVVIDGRLFV  67

Query  332  LDPSSSFDSAKIKVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQ  508
            +   S ++  K+KVYD   DSW  ++G  +P R +     P  ++ L  K+ V+ +    
Sbjct  68   I---SEYERMKVKVYDPETDSWDPVDGPPMPERIM----KPLSVSCLESKIVVVGR--GL  118

Query  509  NILVLQADRQHNQNENEKESDANIWRVIASRNSGSAELI  625
            ++++    +Q + +   +  D  + R  +     S++++
Sbjct  119  HVVIGHVKKQSSCDYLVRWQDVEVPRAFSDLTPSSSQIL  157



>gb|KHM98930.1| F-box/kelch-repeat protein [Glycine soja]
Length=209

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 65/123 (53%), Gaps = 27/123 (22%)
 Frame = +2

Query  311  VDGELYALDPSSSFDSAKI--------KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAG  466
            +DG LY L   S   + K         +VYD  +D WK + G +P+ D T+SESPYLLAG
Sbjct  55   IDGCLYVLGGFSKSSTMKCVKGGLLSRQVYDQGEDEWKVVIGKVPVYDFTESESPYLLAG  114

Query  467  LLGKLNVIAKDANQNILVLQADRQHNQN--------------ENE-----KESDANIWRV  589
              GKL+ I KDAN +I VLQAD   N +              E+E      E+D  +W++
Sbjct  115  FRGKLHFITKDANHDISVLQADHCSNVDSSPSTSAPQSPKYMEDELLRESAETDEAVWKL  174

Query  590  IAS  598
            +AS
Sbjct  175  VAS  177



>ref|XP_008812564.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Phoenix 
dactylifera]
Length=411

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 70/134 (52%), Gaps = 25/134 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  V SM   +A+M            +A   +   G+LY  +    W
Sbjct  225  LNSAEVLDPVKGNWRPVASM---RANM------------VAYDSAVLNGRLYATEGCV-W  268

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDP+T++W +M +GM EGW      T  SV+VDG L+ +   S ++  K+
Sbjct  269  PFLSSPTGQVYDPKTDSWGDMAVGMREGW------TGSSVVVDGHLFVI---SEYERMKV  319

Query  368  KVYDSRDDSWKAIE  409
            KVYD   DSW  +E
Sbjct  320  KVYDGESDSWDVVE  333



>ref|XP_004163017.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like, partial 
[Cucumis sativus]
Length=290

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 70/140 (50%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  106  LDSAEVLDPIQGNWNSIASM--------------------GTNMASYDAAVLNGKLLVTE  145

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  146  G-WLWPFYVAPRGQVYDPTTNNWETMAIGLREGW------TGSSVVVYGHLFVV---SEL  195

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD+  DSW+AIEG
Sbjct  196  ERMKLKVYDAASDSWEAIEG  215



>ref|XP_004149669.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Cucumis 
sativus]
 gb|KGN65533.1| hypothetical protein Csa_1G435780 [Cucumis sativus]
Length=405

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 70/140 (50%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  V SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPIQGNWNSVASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVAPRGQVYDPTTNNWETMAIGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD+  DSW+AIEG
Sbjct  311  ERMKLKVYDAASDSWEAIEG  330



>ref|XP_008444396.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Cucumis melo]
Length=405

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 70/140 (50%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPIQGSWNSIASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVAPRGQVYDPTTNNWETMAIGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD+  DSW+AIEG
Sbjct  311  ERMKLKVYDAASDSWEAIEG  330



>ref|XP_007025062.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOY27684.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=405

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 94/200 (47%), Gaps = 39/200 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L +AEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDAAEVLDPTKGSWHPIASM--------------------GTNMASYDSAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFFVSPRGQVYDPRTNNWESMAVGLREGW------TGSSVVVYGHLFVV---SEI  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD   DSW+ IEG      +     P+ +     ++ V+ ++ +  +  + + 
Sbjct  311  ERMKLKVYDPDSDSWETIEGPPLPEQICK---PFAVNACDNRIYVVGRNLHVAVGYISSL  367

Query  533  RQHNQNENEKESDANIWRVI  592
             + + +E +K+S +  W V+
Sbjct  368  NRTSSSE-KKQSFSVRWHVV  386



>ref|XP_003557654.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Brachypodium 
distachyon]
Length=409

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 103/227 (45%), Gaps = 45/227 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G+W  V SM    A               ++  +   G+LYV +    W
Sbjct  223  LNSAEVLDPVKGVWQPVASMGMNMA---------------SSDSAVISGRLYVTEGC-AW  266

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFF    G+VYDP+ + W  M + M EGW      T LSV++D  L+ +   S ++  K+
Sbjct  267  PFFSLPRGQVYDPKIDRWEAMSVVMREGW------TGLSVVIDERLFVI---SEYERMKV  317

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            KVYD   DSW ++ G  +P R +     P  ++ L  K+ V+ +        LQ    H 
Sbjct  318  KVYDQETDSWDSVNGPPMPERIM----KPLSVSCLDSKIVVVGRG-------LQVAIGHV  366

Query  545  QNENEKESDANIWRVIASRNSGSAELISCQILDM*LYMPVLEVSSNQ  685
            + +    S AN        N+ S+ LI  Q +D+      L  SS+Q
Sbjct  367  KRQPGSGSGAN--------NTSSSYLICWQDVDVPRTFSDLTPSSSQ  405



>ref|XP_003546081.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Glycine 
max]
 gb|KHN06971.1| F-box/kelch-repeat protein [Glycine soja]
Length=405

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 90/197 (46%), Gaps = 45/197 (23%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPLNGSWRPIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNNWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD   DSW+AIEG +P+ +      P+ +      + V+     QN++V    
Sbjct  311  ERMKLKVYDPETDSWEAIEG-LPLPE--QIRKPFAVNACDCHIYVVG----QNLVV---G  360

Query  533  RQHNQNENEKESDANIW  583
              H    N KES    W
Sbjct  361  VGHITRLNPKESCKEKW  377



>ref|XP_002519667.1| Protein AFR, putative [Ricinus communis]
 gb|EEF42640.1| Protein AFR, putative [Ricinus communis]
Length=465

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 95/200 (48%), Gaps = 39/200 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEVFDP  G W  + SM                     T ++SY      GKL V +
Sbjct  281  LDSAEVFDPVKGNWQSIASM--------------------GTNMASYDAAVLDGKLLVTE  320

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP T+ W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  321  G-WLWPFYVSPRGQVYDPRTDRWENMAVGLREGW------TGSSVVVYGRLFVV---SEL  370

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD  +DSW+ IEG  P+ +      P+ +     K+ V+ ++ +  +  +   
Sbjct  371  ERMKLKVYDMDNDSWETIEGP-PLPE--QICKPFAVNACDCKIYVVGRNLHVAVGHITKL  427

Query  533  RQHNQNENEKESDANIWRVI  592
            +Q N    ++ S +  W V+
Sbjct  428  KQ-NTTCGKRWSFSVTWHVV  446



>ref|XP_006359093.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Solanum 
tuberosum]
Length=402

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 94/200 (47%), Gaps = 42/200 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  GIW  V SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPNKGIWCPVASM--------------------GTNMASYDSAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDP+T  W  M  G+ EGW      T  SV++ G+L+ +   S  
Sbjct  261  GWF-WPFYVVPRGQIYDPQTGNWENMASGLREGW------TGSSVVLYGQLFVV---SEH  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD   DSW  +EG +P+ +      P+ +     ++ V+ +    N+ V    
Sbjct  311  ERTKLKVYDPETDSWDTVEG-LPLPE--QICKPFSVDCCDNRIVVVGR----NLHVAVGH  363

Query  533  RQHNQNENEKESDANIWRVI  592
             +  Q  +++ S A  W+V+
Sbjct  364  IKSLQPSSKRCSFAVYWQVV  383



>gb|KHN47330.1| F-box/kelch-repeat protein [Glycine soja]
Length=405

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPFNGSWHPIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNNWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVY+  +DSW+AIEG
Sbjct  311  ERMKLKVYEPENDSWEAIEG  330



>ref|XP_002309296.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEE92819.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=405

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 93/201 (46%), Gaps = 41/201 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVKGNWRRIANM--------------------GTNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFF    G++YDP T+ W  M  G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFFFSPRGQIYDPRTDKWENMAFGLREGW------TGSSVVVYGRLFVV---SDL  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD+  DSW+ IEG  P+ +      P+ +     K+ V+ +  N +++V    
Sbjct  311  ERMKLKVYDAESDSWETIEGS-PLPE--QISKPFAVNAWDCKIYVVGR--NLHVVVGHIS  365

Query  533  RQHNQNENEKESDANI-WRVI  592
            R   +   EK+   ++ W V+
Sbjct  366  RLQQKGICEKKWGFSVRWHVV  386



>ref|XP_002277472.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Vitis vinifera]
 emb|CAN75078.1| hypothetical protein VITISV_005005 [Vitis vinifera]
Length=405

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 89/201 (44%), Gaps = 41/201 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L  AEV DP  GIW  + SM                     T ++SY      GKL V +
Sbjct  221  LDLAEVLDPVKGIWSPIASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP TN W  M  G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFFVSPRGQVYDPRTNNWENMAAGLREGW------TGSSVVVYGHLFVV---SEH  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD   D+W+ +EG      +     P+ +     K+ V+ +  N ++ V    
Sbjct  311  ERMKLKVYDMESDNWETVEGPALPEQIC---KPFSVNACDCKIYVVGR--NLHVAVGHIW  365

Query  533  RQHNQNENEKESDANI-WRVI  592
            R + +   EK     + W V+
Sbjct  366  RLNQKGNCEKNWSFGVRWHVV  386



>ref|XP_003593908.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AES64159.1| kelch repeat F-box protein [Medicago truncatula]
Length=405

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP +G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPISGNWRAIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN+W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNSWETMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVY+   DSW+AI+G
Sbjct  311  ERMKLKVYNQEADSWEAIDG  330



>ref|XP_003542937.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Glycine 
max]
Length=405

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 71/140 (51%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W              P A++        T ++SY      GKL V +
Sbjct  221  LDSAEVLDPFNGSW-------------HPIAYMG-------TNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNNWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVY+  +DSW+AIEG
Sbjct  311  ERMKLKVYEPENDSWEAIEG  330



>emb|CBI30913.3| unnamed protein product [Vitis vinifera]
Length=429

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L  AEV DP  GIW  + SM                     T ++SY      GKL V +
Sbjct  231  LDLAEVLDPVKGIWSPIASM--------------------GTNMASYDAAVLNGKLLVTE  270

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP TN W  M  G+ EGW      T  SV+V G L+ +   S  
Sbjct  271  G-WLWPFFVSPRGQVYDPRTNNWENMAAGLREGW------TGSSVVVYGHLFVV---SEH  320

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   D+W+ +EG
Sbjct  321  ERMKLKVYDMESDNWETVEG  340



>ref|XP_011085241.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like isoform 
X2 [Sesamum indicum]
Length=405

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP+ G W  V SM                     T ++SY      GKL V +
Sbjct  221  LNSAEVLDPKKGTWQPVASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDP T+ W  M  G+ EGW      T  SV++ G L+ +   +  
Sbjct  261  GWF-WPFYVVPRGQIYDPLTDNWENMAAGLREGW------TGSSVVIHGHLFVV---TEH  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS +DSW  +EG
Sbjct  311  ERTKLKVYDSENDSWDVVEG  330



>ref|XP_008371760.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Malus domestica]
Length=405

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 69/135 (51%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  + SM          A +A +   +        GKL V +  + W
Sbjct  221  LDSAEVLDPVKGSWHPIASM---------GANMASYDAAV------LNGKLLVTEG-WLW  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP TN W  M +G+ EGW      T  SV++ G L+ +   S  +  K+
Sbjct  265  PFFVSPRGQVYDPRTNNWESMAVGLREGW------TGSSVVIYGHLFVV---SELERMKL  315

Query  368  KVYDSRDDSWKAIEG  412
            KVYD+  DSW+ IEG
Sbjct  316  KVYDADTDSWEPIEG  330



>ref|XP_011085238.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like isoform 
X1 [Sesamum indicum]
 ref|XP_011085239.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like isoform 
X1 [Sesamum indicum]
 ref|XP_011085240.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like isoform 
X1 [Sesamum indicum]
Length=420

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP+ G W  V SM                     T ++SY      GKL V +
Sbjct  221  LNSAEVLDPKKGTWQPVASM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDP T+ W  M  G+ EGW      T  SV++ G L+ +   +  
Sbjct  261  GWF-WPFYVVPRGQIYDPLTDNWENMAAGLREGW------TGSSVVIHGHLFVV---TEH  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS +DSW  +EG
Sbjct  311  ERTKLKVYDSENDSWDVVEG  330



>ref|XP_008225493.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Prunus mume]
Length=405

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVEGTWHPIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN+W  M +G+ EGW      T  SV++ G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNSWESMAVGLREGW------TGSSVVIYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD+  D W+ IEG
Sbjct  311  ERMKLKVYDADTDKWETIEG  330



>ref|XP_010549492.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Tarenaya hassleriana]
 ref|XP_010549493.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Tarenaya hassleriana]
Length=405

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  +  M                     T ++SY      GKL V +
Sbjct  222  LDSAEVMDPSDGNWHPISQM--------------------GTNMASYDAAVLNGKLLVTE  261

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP +++W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  262  G-WLWPFFVSPRGQVYDPRSDSWETMAVGLREGW------TGSSVVVYGRLFVV---SEL  311

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS  DSW+ IEG
Sbjct  312  ERMKLKVYDSDSDSWETIEG  331



>ref|XP_008366003.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Malus domestica]
Length=405

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 91/196 (46%), Gaps = 31/196 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  + SM          A +A +   +        GKL V +  + W
Sbjct  221  LDSAEVLDPVKGSWHPIASM---------GANMASYDAAV------LNGKLLVTEG-WLW  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP  N W  M +G+ EGW      T  SV++ G L+ +   S  +  K+
Sbjct  265  PFFVSPRGQVYDPRANNWESMAVGLREGW------TGSSVVIYGHLFVV---SELERMKL  315

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            KVYD+  DSW+ IEG      +     P+ +      + V+ +  N ++ V Q  R  ++
Sbjct  316  KVYDADXDSWEPIEGPPLPEQIC---KPFAVNACDCMIYVVGR--NLHVAVGQISRVSHK  370

Query  548  NENEKESDANI-WRVI  592
               EK+    + W V+
Sbjct  371  GTCEKKWSFGVRWNVV  386



>ref|XP_009360894.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Pyrus x bretschneideri]
Length=405

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 68/135 (50%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  + SM          A +A +   +  G      KL V +  + W
Sbjct  221  LDSAEVLDPVKGCWHPIASM---------GANMASYDAAVLNG------KLLVTEG-WLW  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP  N W  M +G+ EGW      T  SV++ G L+ +   S  +  K+
Sbjct  265  PFFVSPRGQVYDPRANNWESMAVGLREGW------TGSSVVIYGHLFVV---SELERMKL  315

Query  368  KVYDSRDDSWKAIEG  412
            KVYD+  DSW+ IEG
Sbjct  316  KVYDADTDSWEPIEG  330



>gb|EPS62277.1| hypothetical protein M569_12514 [Genlisea aurea]
Length=392

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAE  DP+TGIW  + SM                     T ++SY      GKL V +
Sbjct  215  LNSAEALDPKTGIWRPIASM--------------------GTNMASYDAAVLDGKLLVTE  254

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDPE + W  M  G+ EGW      T  SV++ G L+ +   +  
Sbjct  255  GWF-WPFYVVPRGQIYDPERDNWENMSAGLREGW------TGSSVVIGGHLFVV---TEH  304

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD  +DSW  +EG
Sbjct  305  ERTKLKVYDPANDSWDVVEG  324



>ref|XP_007213953.1| hypothetical protein PRUPE_ppa006572mg [Prunus persica]
 gb|EMJ15152.1| hypothetical protein PRUPE_ppa006572mg [Prunus persica]
Length=405

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 69/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVEGTWHPIANM--------------------GTNMASYDAAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV++ G L+ +   +  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNNWESMAVGLREGW------TGSSVVIYGHLFVV---AEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD+  D W+AIEG
Sbjct  311  ERMKLKVYDADTDKWEAIEG  330



>gb|KDP37984.1| hypothetical protein JCGZ_04627 [Jatropha curcas]
Length=405

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVKGNWRRISSM--------------------GTNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFF    G+VYDP T+ W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFFFSPRGQVYDPRTDRWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   DSW+ IEG
Sbjct  311  ERMKVKVYDVEADSWETIEG  330



>ref|XP_004231551.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Solanum lycopersicum]
Length=402

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 95/200 (48%), Gaps = 42/200 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L SAEV DP+ GIW  V +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPDEGIWCPVANM--------------------GTNMASYDSAVLNGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G++YDP+T  W  M  G+ EGW      T  SV++ G L+ +   S  
Sbjct  261  GWF-WPFYVVPRGQIYDPQTGNWENMASGLREGW------TGSSVVLYGRLFVV---SEH  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVY+  +DSW  +EG +P+ +      P+ +     ++ V+ +    N+ V    
Sbjct  311  ERTKLKVYEPENDSWDTVEG-LPLPE--QICKPFSVDCCDNRIVVVGR----NLHVAIGH  363

Query  533  RQHNQNENEKESDANIWRVI  592
             +  Q  +++ S A  W+V+
Sbjct  364  IKSLQPSSKRCSFAVYWQVV  383



>emb|CDY04697.1| BnaC05g17350D [Brassica napus]
Length=223

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 79/142 (56%), Gaps = 20/142 (14%)
 Frame = +2

Query  254  MGMGEGWPARQAGTKLSVIVDGE-----LYALDPSSS----FDSAKIKVYD--SRDDSWK  400
            +G+ E W        L V+  G+      YALDP S+         + V +  SR   W 
Sbjct  91   LGITEEW--------LYVLTKGQDDKLLWYALDPVSTRWQRLPPMPVIVCEEESRRSLWN  142

Query  401  AIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQNENEKESDANI  580
               G++P+ D+TDSESPYLLAG  GKL+ I +D N+N+ V++AD   + + +   S    
Sbjct  143  LKVGEVPVYDMTDSESPYLLAGFHGKLHFITRDHNRNVTVMRAD-VPDVSGSSSSSKGVS  201

Query  581  WRVIASRNSGSAELISCQILDM  646
              VIA ++ G+AEL+SCQ++D+
Sbjct  202  GSVIACKDLGAAELVSCQVIDI  223



>ref|XP_011096579.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Sesamum indicum]
 ref|XP_011096580.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Sesamum indicum]
Length=405

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 93/196 (47%), Gaps = 31/196 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP+ G+W  V +M    A    TA L               GKL V +  + W
Sbjct  221  LNSAEVLDPKKGMWKPVANMGMNMAS-YDTAVL--------------NGKLLVTEGWF-W  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF+V   G++YDP T+ W  M  G+ EGW      T  SV++ G L+ +   +  +  K+
Sbjct  265  PFYVAPRGQIYDPITDNWENMAAGLREGW------TGSSVVIYGHLFVV---TEHERTKL  315

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            KVYD   DSW  +EG +    +     P+ +     K+ V+ +  N ++ V    R +  
Sbjct  316  KVYDMETDSWDVVEGPVLPEQIC---KPFSVNCWESKVYVVGR--NLHVAVGHILRMYPS  370

Query  548  NENEKESDANI-WRVI  592
            N + K+   ++ W+++
Sbjct  371  NPSGKKCRFSVQWQMV  386



>ref|XP_006307712.1| hypothetical protein CARUB_v10009351mg [Capsella rubella]
 ref|XP_006307713.1| hypothetical protein CARUB_v10009351mg [Capsella rubella]
 gb|EOA40610.1| hypothetical protein CARUB_v10009351mg [Capsella rubella]
 gb|EOA40611.1| hypothetical protein CARUB_v10009351mg [Capsella rubella]
Length=398

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 67/135 (50%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV +P  G W  V +M    AHM             +   +   GKL V +  + W
Sbjct  222  LDSAEVLNPSDGSWRPVSNM---VAHM------------ASYDTAVLNGKLLVTEG-WLW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP T+ W  MPMG+ EGW      T  SV++   L+ +   S  +  K+
Sbjct  266  PFFVSPRGQVYDPRTDQWETMPMGLREGW------TGTSVVIYDRLFIV---SELERMKM  316

Query  368  KVYDSRDDSWKAIEG  412
            KVYD   DSW+ I G
Sbjct  317  KVYDPVTDSWETING  331



>ref|XP_007147912.1| hypothetical protein PHAVU_006G165500g [Phaseolus vulgaris]
 gb|ESW19906.1| hypothetical protein PHAVU_006G165500g [Phaseolus vulgaris]
Length=405

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (49%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRG-----KLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY       KL V +
Sbjct  221  LDSAEVLDPLNGSWRPIANM--------------------GTNMASYDAAVLNEKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTNKWENMAVGLREGW------TGSSVVVYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVY+   DSW+AIEG
Sbjct  311  ERMKLKVYEPETDSWEAIEG  330



>gb|ACN27709.1| unknown [Zea mays]
 tpg|DAA59567.1| TPA: hypothetical protein ZEAMMB73_116467 [Zea mays]
 tpg|DAA59568.1| TPA: hypothetical protein ZEAMMB73_116467 [Zea mays]
Length=410

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 65/136 (48%), Gaps = 26/136 (19%)
 Frame = +2

Query  8    LQSAEVFDPE-TGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC  184
            L SAEV DP   G W  V SM    A    +A L               G+LYV +    
Sbjct  223  LSSAEVLDPAGAGAWRPVASMGANMASA-DSAVLG--------------GRLYVTEGCA-  266

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
            WPFF    G+VYDP  + W  MP GM EGW      T LSV+V G L+ +   S ++  K
Sbjct  267  WPFFSAPRGQVYDPRADRWEAMPAGMREGW------TGLSVVVAGRLFVV---SEYERMK  317

Query  365  IKVYDSRDDSWKAIEG  412
            +KVYD   DSW  + G
Sbjct  318  VKVYDPETDSWDTVGG  333



>ref|XP_011005285.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Populus euphratica]
 ref|XP_011005286.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Populus euphratica]
Length=405

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 92/201 (46%), Gaps = 41/201 (20%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + +M                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVKGNWRRIANM--------------------GTNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFF    G++YDP T+ W  M  G+ EGW      T  SV++ G L+ +   S  
Sbjct  261  G-WLWPFFFSPRGQIYDPTTDKWENMAFGLREGW------TGSSVVIYGRLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD+  DSW+ IEG  P+ +      P+ +     K+ V+ +    +++V    
Sbjct  311  ERMKLKVYDAESDSWETIEGP-PLPE--QISKPFAVNAWDCKIYVVGRKL--HVVVGHIS  365

Query  533  RQHNQNENEKESDANI-WRVI  592
            R   +   EK+   ++ W V+
Sbjct  366  RLQQKGICEKKWSFSVRWHVV  386



>ref|XP_009406705.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Musa acuminata 
subsp. malaccensis]
Length=411

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 85/192 (44%), Gaps = 30/192 (16%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  V SM    A               A   +   G+LYV +    W
Sbjct  225  LDSAEVLDPVKGNWQPVASMGINMA---------------AYDSAVLNGRLYVTEGCV-W  268

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDPE N W  M +GM EGW      T   V++ G L+ +   S ++  ++
Sbjct  269  PFLSSPRGQVYDPEANNWEPMAVGMREGW------TGSGVVIYGHLFVI---SEYERMRL  319

Query  368  KVYDSRDDSWKAIEG-DIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            KV+D   DSW  +EG  +P R       P+ +  +  K+ V+ +  +  I  ++     N
Sbjct  320  KVHDVESDSWDTVEGSSMPER----IHKPFSVTSVGSKIVVVGRGLHVAIGQVENKGYCN  375

Query  545  QNENEKESDANI  580
             +   K+   +I
Sbjct  376  SDGKMKKQKFSI  387



>ref|XP_010460786.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Camelina sativa]
Length=398

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 68/137 (50%), Gaps = 29/137 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLP--TAFLADFLKPIATGISSYRGKLYVPQSLY  181
            L SAEV +P  G W  V +M    AHM    TA L               GKL V +  +
Sbjct  222  LDSAEVLNPLDGSWRPVSNM---VAHMASYDTAVL--------------NGKLLVTEG-W  263

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFV   G+VYDP T+ W  MPMG+ EGW      T  SV++   L+ +   S  +  
Sbjct  264  LWPFFVSPRGQVYDPRTDQWETMPMGLREGW------TGTSVVIYDRLFIV---SELERM  314

Query  362  KIKVYDSRDDSWKAIEG  412
            K+KVYD   DSW+ I G
Sbjct  315  KMKVYDPVTDSWETING  331



>ref|XP_010499524.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Camelina 
sativa]
Length=398

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 68/137 (50%), Gaps = 29/137 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLP--TAFLADFLKPIATGISSYRGKLYVPQSLY  181
            L SAEV +P  G W  V +M    AHM    TA L               GKL V +  +
Sbjct  222  LASAEVLNPLDGSWRPVSNM---VAHMASYDTAVL--------------NGKLLVTEG-W  263

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFV   G+VYDP T+ W  MPMG+ EGW      T  SV++   L+ +   S  +  
Sbjct  264  LWPFFVSPRGQVYDPRTDQWETMPMGLREGW------TGTSVVIYDRLFIV---SELERM  314

Query  362  KIKVYDSRDDSWKAIEG  412
            K+KVYD   DSW+ I G
Sbjct  315  KMKVYDPVTDSWETING  331



>ref|XP_010478381.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Camelina 
sativa]
Length=398

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 68/137 (50%), Gaps = 29/137 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLP--TAFLADFLKPIATGISSYRGKLYVPQSLY  181
            L SAEV +P  G W  V +M    AHM    TA L               GKL V +  +
Sbjct  222  LDSAEVLNPLDGKWRPVSNM---VAHMASYDTAVL--------------NGKLLVTEG-W  263

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFV   G+VYDP T+ W  MPMG+ EGW      T  SV++   L+ +   S  +  
Sbjct  264  LWPFFVSPRGQVYDPRTDQWETMPMGLREGW------TGTSVVIYDRLFIV---SELERM  314

Query  362  KIKVYDSRDDSWKAIEG  412
            K+KVYD   DSW+ I G
Sbjct  315  KMKVYDPVTDSWETING  331



>ref|XP_010686268.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 94/200 (47%), Gaps = 41/200 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L  AEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDVAEVLDPIKGYWRPIASM--------------------ETNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP TN W  M +G+ EGW      T  SV+V G L+ +   S  
Sbjct  261  G-WLWPFFVSPRGQVYDPRTNNWENMAVGLREGW------TGSSVVVFGCLFIV---SEH  310

Query  353  DSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
            +  K+KVYD   DSW ++EG  P+ +      P+ +     K+ V+ +D   ++ V Q  
Sbjct  311  ERMKLKVYDVDSDSWDSVEGP-PLPE--QICKPFSVNSFESKIYVVGRDL--HVAVGQIF  365

Query  533  RQHNQNENEKESDANI-WRV  589
            + + +  +EK+   ++ W V
Sbjct  366  KVNLKGHSEKKLRFSVQWHV  385



>ref|XP_004293578.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + +M                     T +SSY      GKL V +
Sbjct  221  LDSAEVLDPAEGSWHPIANM--------------------GTNMSSYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF+V   G+VYDP T+ W  M +G+ EGW      T  SV++ G L+ +   S  
Sbjct  261  G-WLWPFYVSPRGQVYDPRTDNWESMAVGLREGW------TGSSVVIYGHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   DSW  IEG
Sbjct  311  ERMKLKVYDVDTDSWDTIEG  330



>ref|XP_004292876.1| PREDICTED: F-box protein AFR-like [Fragaria vesca subsp. vesca]
Length=378

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 97/218 (44%), Gaps = 48/218 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRG-----KLYVPQ  172
            +++ E +DPE   W  + +MP                     G++ Y       K+YV +
Sbjct  200  IRTVECYDPEMDKWTTIATMP--------------------VGLTKYDSHVVGDKMYVTE  239

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPF       VYD +T+ W EM +GM EGW      T +SV+VD +L  +   S +
Sbjct  240  G-WTWPFMFSPRSLVYDSKTDVWREMSLGMREGW------TGISVLVDNKLLVI---SEY  289

Query  353  DSAKIKVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA  529
                IKVYD  +D+W+ + GD  P   L     P+ ++ + G + V+A   N  I  L  
Sbjct  290  GDCPIKVYDHDEDTWRYVGGDKFPCDAL---RRPFAVSAVEGSIYVVACGLNVGIGRL--  344

Query  530  DRQHNQNENEKESDANIWRVIASRNSGSA-ELISCQIL  640
                  +E EK      W+V+ + ++       SCQ+L
Sbjct  345  ------SEGEKGEVQVEWQVMPAPSAFRGFSPSSCQVL  376



>ref|XP_006467457.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Citrus 
sinensis]
Length=402

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVKGNWRTIASM--------------------GTNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP T+ W  M +G+ EGW      T  SV+V   L+ +   S  
Sbjct  261  G-WLWPFFVSPRGQVYDPSTDNWESMAVGLREGW------TGSSVVVYEHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   DSW+ IEG
Sbjct  311  ERMKLKVYDPSTDSWETIEG  330



>ref|XP_006449707.1| hypothetical protein CICLE_v10015483mg [Citrus clementina]
 gb|ESR62947.1| hypothetical protein CICLE_v10015483mg [Citrus clementina]
 gb|KDO78197.1| hypothetical protein CISIN_1g040145mg [Citrus sinensis]
Length=402

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYR-----GKLYVPQ  172
            L SAEV DP  G W  + SM                     T ++SY      GKL V +
Sbjct  221  LDSAEVLDPVKGNWRTIASM--------------------GTNMASYDAAVLDGKLLVTE  260

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP T+ W  M +G+ EGW      T  SV+V   L+ +   S  
Sbjct  261  G-WLWPFFVSPRGQVYDPSTDNWESMAVGLREGW------TGSSVVVYEHLFVV---SEL  310

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYD   DSW+ IEG
Sbjct  311  ERMKLKVYDPSTDSWETIEG  330



>gb|KHG22975.1| hypothetical protein F383_01278 [Gossypium arboreum]
Length=438

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  V  M      M+P   +    K    G+ S+R            
Sbjct  243  LRSAEVYDPNKNRWSFVQDMSTA---MVPFIGVVYDGKWFVKGLGSHR------------  287

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPE+N+W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  288  ----EVMSEAYDPESNSWSAVSGGMVSGW------RNPSISLNGKLYALDCR---DGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW K I+  +        E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  335  RVYDGATDSWNKFIDSKLHFGSSRALEAAGLVP-LNGKLCIIRNNMSVSLVDVSSPDKQV  393

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N    E+ A          NIW  IA R+S  + +I CQ+L
Sbjct  394  ESNPQLWENIASRGHFRTLFTNIWSSIAGRSSLRSHIIHCQVL  436



>ref|XP_006836439.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda]
 gb|ERM99292.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda]
Length=416

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 91/205 (44%), Gaps = 38/205 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEVFDP  G W  +  M    A     ++ A  L            KLYV +  + W
Sbjct  221  LNSAEVFDPMKGYWRSIAKMGANMA-----SYDAAVLD----------AKLYVTEG-WLW  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDPET+ W  M  GM EGW      T  S+++ G L+ +   S  +  ++
Sbjct  265  PFSFSPRGQVYDPETDKWETMAAGMTEGW------TGASLVLHGHLFVV---SEHERMRL  315

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQ-------  526
            KVYD   DSW A++G    + +     P+      G++ V+ ++ +  +  ++       
Sbjct  316  KVYDVESDSWDAVDGPPVPKQVCK---PFSANATNGRIYVVGRNLHVAVGYIRMRPTTMA  372

Query  527  ---ADRQHNQNENEKESDANIWRVI  592
               A+ +    + EK   +  W+ I
Sbjct  373  TTTAEVEKKNGKKEKVCFSVYWKAI  397



>ref|XP_007014726.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOY32345.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=438

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R            
Sbjct  243  LRSAEVYDPNRNRWSFIQDM---STAMVPFIGVVYDGKWFLKGLGSHR------------  287

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPETN+W  +  GM  GW         S+ ++G LYALD     D  K+
Sbjct  288  ----EVMSEAYDPETNSWTSVSDGMVSGW------RNPSISLNGRLYALD---CRDGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  335  RVYDGATDSWNKFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISLVDVSSPDKQV  393

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          NIW  IA R+   + ++ CQ+L
Sbjct  394  ESNPHLWENIAGKGHFRTLFTNIWSSIAGRSGLRSHIVHCQVL  436



>gb|EYU43259.1| hypothetical protein MIMGU_mgv1a026903mg [Erythranthe guttata]
Length=408

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L S E+ DP+ G W  V +M   + HM      A +   +  G      K  V +  + W
Sbjct  221  LDSCEMMDPKNGSWSPVSNM---RTHM------ASYDSAVLDG------KFLVTEGWF-W  264

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF+V   G++YDP T+ W  MP G+ EGW      T  SV++ G L+ +   +  +  K+
Sbjct  265  PFYVVPRGQIYDPMTDNWENMPAGLREGW------TGSSVVIHGNLFVV---TEHERTKL  315

Query  368  KVYDSRDDSWKAIEG  412
            KVYDS +D W+ +EG
Sbjct  316  KVYDSGNDCWEVVEG  330



>ref|XP_002283484.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Vitis vinifera]
 emb|CAN64353.1| hypothetical protein VITISV_013831 [Vitis vinifera]
Length=437

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R            
Sbjct  242  LRSAEVYDPNRNRWSFISDM---STAMVPFIGVIYNGKWFLKGLGSHR------------  286

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E Y PETN W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  287  ----EVMSEAYIPETNTWTPISDGMVAGW------RNPSISLNGQLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYDS  DSW K I+  + +      E+  L+  L GKL +I  + + +I+ V   D+  
Sbjct  334  RVYDSDTDSWNKFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIVDVSSPDKHV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA RNS  + ++ CQ+L
Sbjct  393  ESNPHLWENIAGKGHFRTLVTNLWSSIAGRNSLRSHIVHCQVL  435



>emb|CDX76807.1| BnaC08g33930D [Brassica napus]
Length=369

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 97/214 (45%), Gaps = 40/214 (19%)
 Frame = +2

Query  11   QSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWP  190
            +  E +DPE+  W E   +P                  +A   S+  GK  +    + WP
Sbjct  190  KDVESYDPESDTWKESARLPMV----------------LAKYDSAVIGKEMLVTEGWAWP  233

Query  191  FFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIK  370
            F     G VYD + + W EM  GM EGW      T +SV+V G L+ +     F    +K
Sbjct  234  FMFPPMGHVYDSDKDTWREMSGGMKEGW------TGVSVVVRGRLFVISEHGDF---PMK  284

Query  371  VYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            VY S DD+W+ + G+ +P + +     P+ +AG+  ++ V+ +  N       A+ + ++
Sbjct  285  VYSSEDDTWRYVSGEKLPRKTM---RRPFAVAGVEDRVFVVGEGLN------VAEGRVDE  335

Query  548  NENEKESDANIWRVIASRNSGSAELI---SCQIL  640
             +N + S    WR+IAS +  +       SC +L
Sbjct  336  GQNGEFSVE--WRMIASSSHQARTQFSPASCHVL  367



>ref|XP_008775369.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Phoenix 
dactylifera]
Length=411

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 64/134 (48%), Gaps = 25/134 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP TG W  + SM                   ++   +   G+LY  +    W
Sbjct  226  LNSAEVLDPITGNWQPIASMGRNM---------------VSYDSAVLNGRLYTTEGCV-W  269

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDP  + W +M +GM EGW      T  SV+VDG L+ +   S ++  ++
Sbjct  270  PFLSSPRGQVYDPRADRWEDMAVGMREGW------TGSSVVVDGHLFVI---SEYERMRV  320

Query  368  KVYDSRDDSWKAIE  409
            KVYD   DSW  ++
Sbjct  321  KVYDVESDSWDIVD  334



>gb|ACU18853.1| unknown [Glycine max]
Length=245

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 96/222 (43%), Gaps = 39/222 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M         T  +  F+  +  G    +G L   +++ C 
Sbjct  50   LRSAEVYDPNRNRWSFISEM---------TTAMVPFIGVVHNGTWFLKG-LGSNRNVIC-  98

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y  ET+ W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  99   --------ESYSQETDTWTPVSNGMVNGW------RNPSISLNGQLYALDCQ---DGCKL  141

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQHN  544
            KVYD   DSWK           + +     L  L GKL +I  + + +++ VL +DR+  
Sbjct  142  KVYDRATDSWKKFIDSKLHLGSSHALDAAALVPLNGKLCIIRNNMSISLVDVLSSDRRVE  201

Query  545  QNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
             N    E+ A          N+W  IA R S  + ++ CQ+L
Sbjct  202  SNPQLWENIAGKGHVRSLVRNLWSTIAGRGSLKSHIVHCQVL  243



>ref|XP_002893599.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69858.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=398

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 68/135 (50%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV +P  G W  V +M    AHM   ++ A  L           GKL V +  + W
Sbjct  222  LDSAEVLNPLDGNWRPVSNM---VAHM--ASYDAAVLN----------GKLLVTEG-WLW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP T+ W  M MG+ EGW      T  SV++   L+ +   S  +  K+
Sbjct  266  PFFVSPRGQVYDPRTDQWETMSMGLREGW------TGTSVVIYDRLFIV---SELERMKM  316

Query  368  KVYDSRDDSWKAIEG  412
            KVYD   DSW+ I G
Sbjct  317  KVYDPVTDSWETING  331



>gb|KDP26940.1| hypothetical protein JCGZ_21033 [Jatropha curcas]
Length=434

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 99/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R            
Sbjct  239  LRSAEVYDPNKNRWSFISDM---STAMVPFIGVVYDGKWFLKGLGSHR------------  283

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPETN+W  +  GM  GW         S+ ++G LYALD     D  K+
Sbjct  284  ----EVMSEAYDPETNSWTPVSDGMVVGW------RNPSISLNGRLYALD---CRDGCKV  330

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW K I+  + +      E+  L+  L GKL ++  + + +++ V   D+Q 
Sbjct  331  RVYDGATDSWNKFIDSKLHLGSSHAMEAAALVP-LNGKLCIVRNNMSISLVDVCSPDKQV  389

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  390  ESNPHLWENIAGRGHFRTLVTNLWSSIAGRGGLKSHIVHCQVL  432



>ref|XP_010941194.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Elaeis guineensis]
Length=411

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 25/134 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  V SM                   ++   +   G+LY  +    W
Sbjct  225  LNSAEVLDPIKGTWQPVASMGRNM---------------VSYDSAVLNGRLYATEGCV-W  268

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDP+ ++W +M +GM EGW      T  SV+VDG L+ +   S ++  ++
Sbjct  269  PFLSSPRGQVYDPKADSWEDMAVGMREGW------TGSSVVVDGHLFVI---SEYERMRV  319

Query  368  KVYDSRDDSWKAIE  409
            KVYD   D+W  ++
Sbjct  320  KVYDVESDAWDTVD  333



>ref|XP_006415514.1| hypothetical protein EUTSA_v10007818mg [Eutrema salsugineum]
 gb|ESQ33867.1| hypothetical protein EUTSA_v10007818mg [Eutrema salsugineum]
Length=398

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 65/135 (48%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV +P  G W  V SM  T+      A L               GKL V +  + W
Sbjct  222  LDSAEVLNPLDGKWQSVSSM-VTRMASYDAAVL--------------NGKLLVTEG-WLW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PFFV   G+VYDP  + W  M MG+ EGW      T  SV+V   L+ +   S  +  K+
Sbjct  266  PFFVSPRGQVYDPRIDQWETMAMGLREGW------TGTSVVVYDRLFIV---SELERMKM  316

Query  368  KVYDSRDDSWKAIEG  412
            KVYDS  DSW+ I G
Sbjct  317  KVYDSVTDSWETICG  331



>emb|CDY34765.1| BnaA09g41320D [Brassica napus]
Length=372

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 96/216 (44%), Gaps = 42/216 (19%)
 Frame = +2

Query  11   QSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWP  190
            +  E +DPE+  W E   +P                  +A   S+  GK  +    + WP
Sbjct  191  KDVESYDPESDTWKESARLPMV----------------MAKYDSAVIGKEMLVTEGWAWP  234

Query  191  FFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIK  370
            F     G VYD + + W EM  GM EGW      T +SV+V G L+ +     F    +K
Sbjct  235  FMFPPMGHVYDSDEDTWREMSGGMKEGW------TGVSVVVRGRLFVISEHGDF---PMK  285

Query  371  VYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            VY S DD+W+ + G+ +P + +     P+ +AG+  ++ V+ +  N       A+ + N+
Sbjct  286  VYSSDDDTWRYVSGEKLPGKTM---RRPFAVAGVEDRVFVVGEGLN------VAEGRVNE  336

Query  548  NENEKESDANIWRVIASRNSGSAELI-----SCQIL  640
             +N + S    WR+IA  +S           SC +L
Sbjct  337  GQNGEFSVE--WRMIAFTSSSHQARTQFSPASCHVL  370



>emb|CDX99882.1| BnaC05g23040D [Brassica napus]
Length=398

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L +AEV +P  G W  V +M                     T ++SY      GKL V +
Sbjct  222  LDTAEVLNPLDGKWRSVSNM--------------------VTQMASYDAAVLNGKLLVTE  261

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP T+ W  M MG+ EGW      T  SV++   L+ +   S  
Sbjct  262  G-WLWPFFVSPRGQVYDPRTDQWETMAMGLREGW------TGTSVVIYDRLFIV---SEL  311

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS  DSW+ + G
Sbjct  312  ERMKMKVYDSVTDSWETVNG  331



>ref|XP_009115192.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Brassica rapa]
Length=398

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L +AEV +P  G W  V +M                     T ++SY      GKL V +
Sbjct  222  LDTAEVLNPLDGKWRSVSNM--------------------VTQMASYDAAVLNGKLLVTE  261

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP T+ W  M MG+ EGW      T  SV++   L+ +   S  
Sbjct  262  G-WLWPFFVSPRGQVYDPRTDQWETMAMGLREGW------TGTSVVIYDRLFIV---SEL  311

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS  DSW+ + G
Sbjct  312  ERMKMKVYDSVTDSWETVNG  331



>ref|XP_006578204.1| PREDICTED: F-box protein AFR-like [Glycine max]
Length=351

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 85/165 (52%), Gaps = 18/165 (11%)
 Frame = +2

Query  152  GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYA  331
            GK+YV +  + WPF     G VY+ E + W EM +GM +GW      + +SV V G ++ 
Sbjct  201  GKVYVSEGWW-WPFMYRPRGWVYETEKDTWREMGVGMRDGW------SGVSVAVGGRVFV  253

Query  332  LDPSSSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQN  511
            +   + +  A ++VYD   D+W+ ++G    RD+   + P+L  GL  ++ V + + N  
Sbjct  254  I---AEYGDAPVRVYDEEQDTWRYVKGGSFPRDVI--KRPFLATGLDNRIYVASYNLNVA  308

Query  512  ILVLQADRQHNQNENEKESDANIWRVIASRNSGSAEL--ISCQIL  640
            I  +++DR   + + E    +  W V+ +  S   E    +CQ+L
Sbjct  309  IGKMKSDRIQGKGDFEV---SVTWEVVEA-PSAFREFSPCTCQVL  349



>ref|NP_564347.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 sp|Q9C6Z0.1|FBK17_ARATH RecName: Full=F-box/kelch-repeat protein At1g30090 [Arabidopsis 
thaliana]
 gb|AAG50856.1|AC074176_5 unknown protein [Arabidopsis thaliana]
 gb|AAL14414.1| At1g30090/T2H7_11 [Arabidopsis thaliana]
 gb|AAO11532.1| At1g30090/T2H7_11 [Arabidopsis thaliana]
 gb|AEE31177.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
Length=398

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 66/137 (48%), Gaps = 29/137 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLP--TAFLADFLKPIATGISSYRGKLYVPQSLY  181
            L  AEV +P  G W  V +M    AHM    TA L               GKL V +  +
Sbjct  222  LDCAEVLNPLDGNWRPVSNM---VAHMASYDTAVL--------------NGKLLVTEG-W  263

Query  182  CWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSA  361
             WPFFV   G+VYDP T+ W  M MG+ EGW      T  SV++   L+ +   S  +  
Sbjct  264  LWPFFVSPRGQVYDPRTDQWETMSMGLREGW------TGTSVVIYDRLFIV---SELERM  314

Query  362  KIKVYDSRDDSWKAIEG  412
            K+KVYD   DSW+ I G
Sbjct  315  KMKVYDPVTDSWETING  331



>emb|CDY26295.1| BnaA09g26460D [Brassica napus]
Length=398

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 67/140 (48%), Gaps = 35/140 (25%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSY-----RGKLYVPQ  172
            L +AEV +P  G W  V +M                     T ++SY      G+L V +
Sbjct  222  LDTAEVLNPLDGKWRSVSNM--------------------VTQMASYDAAVLNGRLLVTE  261

Query  173  SLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
              + WPFFV   G+VYDP T+ W  M MG+ EGW      T  SV++   L+ +   S  
Sbjct  262  G-WLWPFFVSPRGQVYDPRTDQWETMAMGLREGW------TGTSVVIYDRLFIV---SEL  311

Query  353  DSAKIKVYDSRDDSWKAIEG  412
            +  K+KVYDS  DSW+ + G
Sbjct  312  ERMKMKVYDSVTDSWETVNG  331



>ref|XP_010417210.1| PREDICTED: F-box protein AFR-like [Camelina sativa]
Length=374

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 89/198 (45%), Gaps = 36/198 (18%)
 Frame = +2

Query  17   AEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWPFF  196
            AE +DPET  W  +  +P                  +A   S+  GK       + WPF 
Sbjct  198  AESYDPETNTWTALKRVPMV----------------LAKYDSAVIGKEMCVTEGWAWPFM  241

Query  197  VDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKVY  376
                G+VYD + N W EM  GM EGW      T +SV++ G L+ +     F    +KVY
Sbjct  242  FPPMGQVYDSDENTWREMSGGMKEGW------TGVSVVIRGRLFVISEHGDF---PMKVY  292

Query  377  DSRDDSWKAIEGDIPIRDLTDSESPYLLAGL-LGKLNVIAKDANQNILVLQADRQHNQNE  553
             S DD+W+ + G+    D      P+ + G   G++ V+A   N       A+ + ++ E
Sbjct  293  FSEDDTWRYVSGEKLPGD--KMRRPFAVTGADDGRVFVVAGGLN------VAEGRVSEGE  344

Query  554  NEKESDANIWRVIASRNS  607
            N + S A  WR+++S  S
Sbjct  345  NGEFSVA--WRMVSSPQS  360



>ref|XP_002527061.1| Protein AFR, putative [Ricinus communis]
 gb|EEF35305.1| Protein AFR, putative [Ricinus communis]
Length=437

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 99/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNKNRWSFISDM---STAMVPFIGVVYDGKWFLKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E YDPETN+W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  290  -------SEAYDPETNSWTPISDGMVGGW------RNPSISLNGQLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHN  544
            +VYD   DSW K I+  + + +    E+  L+  L GKL ++  + + +++ + +  +H 
Sbjct  334  RVYDGATDSWNKFIDSKLHLGNSHALEAAALVP-LNGKLCIVRNNMSISLVDVSSPEKHV  392

Query  545  QNE-----------NEKESDANIWRVIASRNSGSAELISCQIL  640
            +             + +    N+W  IA R    + ++ CQ+L
Sbjct  393  ETNPHLWENIAGRGHFRTLVTNLWSSIAGRGGLKSHIVHCQVL  435



>gb|EPS58278.1| hypothetical protein M569_16536 [Genlisea aurea]
Length=437

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 100/223 (45%), Gaps = 40/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEVFDP    W  +  M      M+P   +    K    G+ ++R  L         
Sbjct  243  LRSAEVFDPNRNRWSFISEM---STAMVPFIGVVYDGKWFLKGLGTHREVL---------  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PETN W  +  GM  GW         SV ++G+LYALD     D  K+
Sbjct  291  -------SEAYAPETNVWSRVNNGMVSGW------RNPSVSLNGKLYALDCR---DGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            ++YD   DSW + ++  + + +    E+  L+A L GKL +I  + + +++ V   DR++
Sbjct  335  RMYDESTDSWIRFMDSKLHMGNSRAFEAAGLVA-LNGKLCIIRNNMSISVVDVSNPDRRN  393

Query  542  ---------NQNENEKESDANIWRVIASRNSGSAELISCQILD  643
                      ++       AN+W  IA R+   + ++ CQ+L 
Sbjct  394  PGGVWENFGGKSHLRNNIFANLWSSIAGRSGLKSHIVHCQVLQ  436



>ref|XP_010908284.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Elaeis 
guineensis]
Length=411

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 84/191 (44%), Gaps = 28/191 (15%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  V SM         +A L +              +LY  +    W
Sbjct  225  LNSAEVLDPIKGNWQPVASMGMNMVS-YDSAVLNE--------------RLYTTEGCV-W  268

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G VYDP+T+ W +M +GM EGW      T  SV+VDG L+ +     ++  K+
Sbjct  269  PFLSSPRGLVYDPKTDHWEDMAVGMREGW------TGSSVVVDGHLFVI---CEYERMKV  319

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            K+YD   DSW  +E   P+ +      P+ +  +  K+ VI +  +  +  ++       
Sbjct  320  KIYDVDSDSWDIVESS-PMPE--QIRKPFSVNSVGNKIFVIGRGLHVAVGHVEKKSCTGS  376

Query  548  NENEKESDANI  580
            N   K+   +I
Sbjct  377  NGKRKKQSFSI  387



>gb|KHG22974.1| hypothetical protein F383_01277 [Gossypium arboreum]
Length=438

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 99/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  V  M      M+P   +    K    G+ S+R            
Sbjct  243  LRSAEVYDPNKNRWSFVQDM---STAMVPFIGVVYDGKWFVKGLGSHR------------  287

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPE+N+W     GM  GW         S+ ++G+LYALD     D  K+
Sbjct  288  ----EVMSEAYDPESNSWSPASGGMISGW------RNPSISLNGQLYALD---CRDGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW K I+  + + +    E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  335  RVYDGATDSWNKFIDSKLHLGNSRVLEAAGLVP-LNGKLCIIRNNMSISLVDVSSPDKQV  393

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N    E+            NIW  IA R+   + ++ CQ+L
Sbjct  394  ESNPQLWENIGGRGHFRTLFTNIWSSIAGRSGLRSHIVHCQVL  436



>ref|XP_009117120.1| PREDICTED: F-box protein AFR [Brassica rapa]
Length=372

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 94/216 (44%), Gaps = 42/216 (19%)
 Frame = +2

Query  11   QSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWP  190
            +  E +DPE+  W E   +P   A                   S+  GK  +    + WP
Sbjct  191  KDVESYDPESDTWKESARLPMVMAKY----------------DSAVIGKEMLVTEGWAWP  234

Query  191  FFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIK  370
            F     G VYD + + W EM  GM EGW      T +SV+V G L+ +     F    +K
Sbjct  235  FMFPPMGHVYDSDEDTWREMSGGMKEGW------TGVSVVVRGRLFVISEHGDF---PMK  285

Query  371  VYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQ  547
            VY S DD+W+ + G+ +P + +     P+ +AG+  ++ V+ +  N       A+ + N+
Sbjct  286  VYSSDDDTWRYVSGEKLPGKTM---RRPFAVAGVEDRVFVVGEGLN------VAEGRVNE  336

Query  548  NENEKESDANIWRVIASRNSGSAELI-----SCQIL  640
             +N + S    WR++   +S           SC +L
Sbjct  337  GQNGEFSVE--WRMVTFTSSSHQARTQFSPASCHVL  370



>ref|XP_009375482.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=437

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 100/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  242  LRSAEIYDPNKNRWSFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  286

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM +GW         S+ ++G+LYALD     D
Sbjct  287  --------EVMSEAYAPEANTWTPISDGMVDGW------RNPSISLNGQLYALD---CHD  329

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   
Sbjct  330  GCKLRVYDRVSDSWSKFIDSKVHLGSSCALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  388

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D+    N +  E+ A          NIW  IA RN   + ++ CQ+L
Sbjct  389  DKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRNGLKSHIVHCQVL  435



>ref|XP_006842862.1| hypothetical protein AMTR_s00081p00156000 [Amborella trichopoda]
 gb|ERN04537.1| hypothetical protein AMTR_s00081p00156000 [Amborella trichopoda]
Length=311

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 98/223 (44%), Gaps = 42/223 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M       +   +    FLK    G+ S+R  +        
Sbjct  117  LRSAEVYDPNKNRWSFIADMSTAMVPFIGVVYEGRWFLK----GLGSHRQVM--------  164

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PE+N W  +  GM  GW         SV ++GELYALD     D  K
Sbjct  165  --------SEVYIPESNNWNPVYDGMVAGW------RNPSVSINGELYALDCK---DGCK  207

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQ  538
            I+VYD   DSW + I+  + + +    E+  L+  L GKL +I  + +  ++ V ++D  
Sbjct  208  IRVYDGATDSWSRHIDSRLHLGNSRALEAAALVP-LNGKLCIIRNNMSITLVDVSKSDES  266

Query  539  HNQNE---------NEKESDANIWRVIASRNSGSAELISCQIL  640
                +         + K    N+W  IA RN   + ++ CQ+L
Sbjct  267  RRVGQLWETIAGKGHFKTFVTNLWSSIAGRNRLKSHIVHCQVL  309



>ref|XP_010534884.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Tarenaya hassleriana]
Length=436

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 101/223 (45%), Gaps = 43/223 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  V  M      ++   +    FLK    G+ S++           
Sbjct  243  LRSAEVYDPNKTRWSFVSDMSTAMVPLIGVVYDGKWFLK----GLGSHQ-----------  287

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                 +   E YDPETN+W  M  GM  GW  R   T L    DG LYALD     D  K
Sbjct  288  -----EVMSEAYDPETNSWSPMSDGMVAGW--RNPCTSL----DGRLYALD---CRDGCK  333

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +++YD   DSW K ++  + +      E+  L+  L GKL +I  + + +++ +    ++
Sbjct  334  LRIYDESTDSWNKFVDSKLHLGSSRSVEAAALVP-LGGKLCIIRNNMSMSLVDVSGPDKN  392

Query  542  NQN----EN------EKESDANIWRVIASRNSGSAELISCQIL  640
            N +    EN       K   +NIW  IA R +  + ++ CQ+L
Sbjct  393  NNSPHVWENIVGKGQSKGILSNIWSSIAGR-ALKSHIVHCQVL  434



>ref|XP_010247992.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Nelumbo nucifera]
 ref|XP_010247993.1| PREDICTED: F-box/kelch-repeat protein At1g30090 [Nelumbo nucifera]
Length=406

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 25/135 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV DP  G W  V SM                +  ++   +    KL+V +  + W
Sbjct  222  LDSAEVLDPVKGNWHPVASMS---------------INMVSYDAAVLNDKLFVTEG-WVW  265

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G+VYDP ++ W  M +G+ EGW      T  SV+V+G L+ +   S  +  K+
Sbjct  266  PFLFSPRGQVYDPRSDKWESMSVGLREGW------TGSSVVVEGHLFVV---SEHERMKL  316

Query  368  KVYDSRDDSWKAIEG  412
            KVYD   DSW  + G
Sbjct  317  KVYDVETDSWDTVSG  331



>ref|XP_010429433.1| PREDICTED: F-box protein AFR-like [Camelina sativa]
Length=376

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 88/198 (44%), Gaps = 36/198 (18%)
 Frame = +2

Query  17   AEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWPFF  196
             E +DPET  W  V  +P                  +A   S+  GK       + WPF 
Sbjct  200  VESYDPETDTWTSVKRVPMV----------------LAKYDSAVIGKEMCVTEGWAWPFM  243

Query  197  VDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKVY  376
                G+VYD + N W EM  GM EGW      T +SV++ G L+ +     F    +KVY
Sbjct  244  FPPMGQVYDSDENTWREMSGGMKEGW------TGVSVVIRGRLFVISEHGDF---PMKVY  294

Query  377  DSRDDSWKAIEGDIPIRDLTDSESPYLLAGL-LGKLNVIAKDANQNILVLQADRQHNQNE  553
             S DD+W+ + G+    D      P+ + G   G++ V+A   N       A+ + ++ E
Sbjct  295  FSEDDTWRYVSGEKLPGD--KMRRPFAVTGADDGRVFVVAGGLN------VAEGRVSEGE  346

Query  554  NEKESDANIWRVIASRNS  607
            N + S   +WR+++S  S
Sbjct  347  NGEFSV--VWRMVSSPQS  362



>ref|XP_004228650.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Solanum lycopersicum]
Length=437

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 98/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  V  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNRNRWTFVADM---STAMVPFIGVIYDGKWFLKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PETN W  +  GM  GW         S+ ++G LYALD     D  K+
Sbjct  290  -------SEAYNPETNGWSPVTDGMVAGW------RNPSISMNGRLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW + I+  + +      E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  334  RVYDGASDSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISMVDVSSPDKQV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  393  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  435



>ref|XP_007222191.1| hypothetical protein PRUPE_ppa010058mg [Prunus persica]
 gb|EMJ23390.1| hypothetical protein PRUPE_ppa010058mg [Prunus persica]
Length=266

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 29/170 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            +++ + +DPE   W    ++P +         LA +   +         K+YV +  + W
Sbjct  86   IRAVDCYDPENDTWAASATLPTS---------LAKYDSNVVGN------KMYVTEG-WMW  129

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF +   G VYDP+ + W EM  GM +GW      T +SV+V   L  +   S +    +
Sbjct  130  PFMLSPRGVVYDPDEDTWQEMRQGMRDGW------TGVSVVVGERLLVI---SEYGDCPM  180

Query  368  KVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            KVYD  +D+W+ + GD  P   L     P+  +G+ G + V+A   N  I
Sbjct  181  KVYDPDEDTWRYVSGDKFPCEAL---RRPFAASGVEGNIYVVACGLNVGI  227



>gb|AFW61308.1| hypothetical protein ZEAMMB73_460431, partial [Zea mays]
Length=97

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query  308  IVDGELYALDPS-SSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLN  484
            +V+G+LYAL+P+ SS    +IK+YD+++D+WK     +      +S+SP LLA  LGKL+
Sbjct  2    VVEGDLYALEPTTSSSGGCEIKMYDAQEDAWKVAVSQVRAGAFDESDSPCLLAAFLGKLH  61

Query  485  VIAKDANQNILVLQADRQHNQNENEKESDANIWR  586
            ++ KD    I V+Q D      ++   S A   R
Sbjct  62   LVVKDMGSRISVVQMDSLMKPVDSPALSAATTCR  95



>ref|XP_003524946.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoformX1 [Glycine 
max]
 ref|XP_003524947.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoformX2 [Glycine 
max]
 ref|XP_006580153.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoform X3 [Glycine 
max]
 ref|XP_006580154.1| PREDICTED: F-box/kelch-repeat protein At1g55270 isoform X4 [Glycine 
max]
Length=437

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 96/223 (43%), Gaps = 39/223 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M         T  +  F+  +  G    +G L   +++ C 
Sbjct  242  LRSAEVYDPNRNRWSFISEM---------TTAMVPFIGVVHNGTWFLKG-LGSNRNVIC-  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y  ET+ W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  291  --------ESYSQETDTWTPVSNGMVNGW------RNPSISLNGQLYALDCQ---DGCKL  333

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQHN  544
            KVYD   DSWK           + +     L  L GKL +I  + + +++ VL ++R+  
Sbjct  334  KVYDRATDSWKKFIDSKLHLGSSHALDAAALVPLNGKLCIIRNNMSISLVDVLSSNRRVE  393

Query  545  QNENEKESDA----------NIWRVIASRNSGSAELISCQILD  643
             N    E+ A          N+W  IA R S  + ++ CQ+L 
Sbjct  394  SNPQLWENIAGKGHVRSLVRNLWSTIAGRGSLKSHIVHCQVLQ  436



>ref|XP_011025173.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Populus euphratica]
Length=438

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R            
Sbjct  243  LRSAEVYDPNKNRWSFISDM---STAMVPFIGVVYDGKWFLKGLGSHR------------  287

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPET+ W  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  288  ----EVMSEAYDPETSTWTPISDGMVAGW------RNPSISLDGRLYALD---CRDGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   D+W K I+  + +      E+  L+  L GKL ++  + + +++ V   D+  
Sbjct  335  RVYDEASDTWNKFIDSKLHLGSSHALEAAALVP-LNGKLCIVRNNMSVSLVDVSSPDKHV  393

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  394  ESNPHLWENIAGRGHLRTLVTNLWSSIAGRGGLKSHIVHCQVL  436



>ref|XP_004294988.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/227 (29%), Positives = 99/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  238  LRSAEIYDPNKNRWSFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  282

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  283  --------EVMSEAYSPEANTWNPISDGMVAGW------RNPSISLNGQLYALD---CRD  325

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   
Sbjct  326  GCKVRVYDRVTDSWNKCIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  384

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D+Q   N N  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  385  DKQVESNPNLWENIAGKGHFRTLVSNLWSSIAGRTGLKSHIVHCQVL  431



>ref|XP_009785252.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana sylvestris]
Length=437

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNRNRWSFIADM---STAMVPFIGVVYDGKWFLKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PE NAW  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  290  -------SESYNPEMNAWSPVNNGMVAGW------RNPSISMDGRLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SW + I+  + +      E+  L+  L GKL +I  + + +I+ V   D+Q 
Sbjct  334  RVYDEATHSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIVDVSNPDKQV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  393  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  435



>ref|XP_006354154.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
tuberosum]
Length=437

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 98/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNRNRWTFITDM---STAMVPFIGVIYDGKWFLKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PETN W  +  GM  GW         S+ ++G LYALD     D  K+
Sbjct  290  -------SEAYNPETNGWSPVTDGMVAGW------RNPSISMNGCLYALDCR---DGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW + I+  + +      E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  334  RVYDGASDSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISMVDVSSPDKQV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  393  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  435



>ref|XP_009785251.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana sylvestris]
Length=445

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  250  LRSAEVYDPNRNRWSFIADM---STAMVPFIGVVYDGKWFLKGLGSHREVL---------  297

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PE NAW  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  298  -------SESYNPEMNAWSPVNNGMVAGW------RNPSISMDGRLYALD---CRDGCKL  341

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SW + I+  + +      E+  L+  L GKL +I  + + +I+ V   D+Q 
Sbjct  342  RVYDEATHSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIVDVSNPDKQV  400

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  401  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  443



>ref|XP_003527811.2| PREDICTED: F-box protein AFR-like [Glycine max]
Length=399

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 18/164 (11%)
 Frame = +2

Query  152  GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYA  331
            GK+YV +  + WPF +   G VY+ E + W EM  GM EGW      + +SV V G ++ 
Sbjct  251  GKVYVSEGWW-WPFMLSPRGWVYETERDTWREMGSGMREGW------SGVSVAVGGRVFV  303

Query  332  LDPSSSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQN  511
            +   + +  A +KVYD   D+W+ ++G    RD+   + P+   GL  ++ V + D N  
Sbjct  304  I---AEYGDAPVKVYDEEFDTWRYVKGGRFPRDVI--KRPFCATGLEDRIYVASLDLNVA  358

Query  512  ILVLQADRQHNQNENEKESDANIWRVI-ASRNSGSAELISCQIL  640
            I  +      N   NE+ S    W V+ A R        SCQ+L
Sbjct  359  IGKINVGVNSN---NEQVSVT--WEVVEAPRAFREFSPSSCQML  397



>ref|XP_009603914.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana tomentosiformis]
Length=437

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNRNRWSFIADM---STAMVPFIGVVYDGKWFLKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PE NAW  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  290  -------SESYNPEMNAWSPVNNGMVAGW------RNPSISMDGRLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SW + I+  + +      E+  L+  L GKL +I  + + +I+ V   D+Q 
Sbjct  334  RVYDEATHSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIVDVSSPDKQV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  393  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  435



>ref|XP_009603913.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana tomentosiformis]
Length=445

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  250  LRSAEVYDPNRNRWSFIADM---STAMVPFIGVVYDGKWFLKGLGSHREVL---------  297

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+PE NAW  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  298  -------SESYNPEMNAWSPVNNGMVAGW------RNPSISMDGRLYALD---CRDGCKL  341

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SW + I+  + +      E+  L+  L GKL +I  + + +I+ V   D+Q 
Sbjct  342  RVYDEATHSWNRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIVDVSSPDKQV  400

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  401  ETNPHLWENIAGKGHFRTLFTNLWSSIAGRGGLKSHIVHCQVL  443



>ref|XP_008219946.1| PREDICTED: F-box protein AFR [Prunus mume]
Length=380

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 80/170 (47%), Gaps = 29/170 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            +++ + +DPE  +WV   ++P +         LA +   +         K+YV +  + W
Sbjct  200  IRAVDCYDPENDMWVASAALPTS---------LAKYDSNVVGN------KMYVTEG-WMW  243

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF +   G VYDP+ + W  M  GM +GW      T +SV+V   L  +   S +    +
Sbjct  244  PFMLSPRGVVYDPDEDTWQGMRRGMRDGW------TGVSVVVGERLLVI---SEYGDCPM  294

Query  368  KVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            KVYD  +D+W+ + GD  P   L     P+  +G+ G + V+A   N  I
Sbjct  295  KVYDPDEDTWRYVSGDKFPCEAL---RRPFAASGVEGNIYVVACGLNVGI  341



>ref|XP_006404987.1| hypothetical protein EUTSA_v10000205mg [Eutrema salsugineum]
 gb|ESQ46440.1| hypothetical protein EUTSA_v10000205mg [Eutrema salsugineum]
Length=365

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 95/211 (45%), Gaps = 38/211 (18%)
 Frame = +2

Query  14   SAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWPF  193
            + E +D E+  W E   +P                  +A   S+  GK  +    + WPF
Sbjct  189  AVESYDAESDTWTESARLPMV----------------LAKYDSAVIGKEMLVTEGWAWPF  232

Query  194  FVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKV  373
                 G+VYD + + W EM  GM EGW      T +SV++   L+ +     F    +KV
Sbjct  233  MFPPMGQVYDSDEDTWREMSGGMKEGW------TGVSVVIRERLFVISEHGDF---PMKV  283

Query  374  YDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQN  550
            Y S DD+W+ + G+ +P + +     P+ + G+  ++ V+A   N    ++ ++RQ+ + 
Sbjct  284  YSSEDDTWRYVSGEKLPGKTM---RRPFAVTGVDDRVFVVAGGLNVAEGIV-SERQNGEF  339

Query  551  ENEKESDANIWRVIASRNSGSA-ELISCQIL  640
              E       WRVI+S  + +     SC +L
Sbjct  340  SVE-------WRVISSPQACTQFSPASCHVL  363



>ref|XP_011089119.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Sesamum indicum]
Length=437

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 99/223 (44%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ ++R  L         
Sbjct  242  LRSAEVYDPNRNRWSFISDM---STAMVPFIGVVYDGKWFLKGLGTHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PETN W  M  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  290  -------SEAYTPETNTWSPMNDGMVAGW------RNPSISMNGKLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW + I+  + + +    E+  L+  L GKL +I  + + +++ V   D++ 
Sbjct  334  RVYDEGTDSWSRFIDSKLHLGNSRALEAAALVP-LNGKLCIIRNNMSISMVDVSNPDKRV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N    E+ A          N+W  IA R+   + ++ CQ+L
Sbjct  393  ESNPQIWENIASKGHLRNLFTNLWSSIAGRSGLKSHIVHCQVL  435



>ref|XP_008351710.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=437

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 98/227 (43%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  242  LRSAEIYDPNKNRWXFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  286

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  287  --------EVMSEAYTPEANTWTPISDGMVAGW------RNPSISLNGQLYALD---CRD  329

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   
Sbjct  330  GCKLRVYDRVSDSWNKFIDSKVHLGSSCALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  388

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D+    N +  E+ A          NIW  IA R    + ++ CQ+L
Sbjct  389  DKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQVL  435



>ref|XP_008344671.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=437

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 98/227 (43%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  242  LRSAEIYDPNKNRWXFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  286

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  287  --------EVMSEAYTPEANTWTPISDGMVAGW------RNPSISLNGQLYALD---CRD  329

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   
Sbjct  330  GCKLRVYDRVSDSWNKFIDSKVHLGSSCALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  388

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D+    N +  E+ A          NIW  IA R    + ++ CQ+L
Sbjct  389  DKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQVL  435



>ref|XP_002304010.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEE78989.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=438

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 97/223 (43%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R            
Sbjct  243  LRSAEVYDPNKNRWSFISDM---STAMVPFIGVVYDGKWFLKGLGSHR------------  287

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                +   E YDPET+ W  +  GM  GW         S+ +DG LYALD     D  K+
Sbjct  288  ----EVMSEAYDPETSTWTPINDGMVAGW------RNPSISLDGCLYALD---CRDGCKL  334

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   D+W K I+  + +      E+  L+  L GKL ++  + + +++ V   D+  
Sbjct  335  RVYDEASDTWNKFIDSKLHLGSSHALEAAALVP-LNGKLCIVRNNMSVSLVDVSSPDKHV  393

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  394  ESNPHLWENIAGRGHLRTLVTNLWSSIAGRGGLKSHIVHCQVL  436



>ref|XP_010914885.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Elaeis 
guineensis]
Length=426

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 93/223 (42%), Gaps = 42/223 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M       +   +    FLK    G+ S R  L        
Sbjct  232  LRSAEVYDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLK----GLGSQRQVL--------  279

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PET  W     GM  GW         SV ++G+LYALD     D  +
Sbjct  280  --------SEVYVPETGNWYPAFDGMVSGW------RNPSVCLNGQLYALDCK---DGCR  322

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            ++VYD   DSW K I+  + +      E+  L+  L GKL ++  + +  ++ +      
Sbjct  323  LRVYDGATDSWSKHIDSKMHLGSSRALEAAALIP-LNGKLCIVRNNMSITVVDVAGKNSR  381

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            +  +   E+ A          N+W  IA RN   + +I CQ+L
Sbjct  382  DSEDQCWETIAGKGHLKTFVTNLWSNIAGRNRLKSHIIHCQVL  424



>ref|XP_004501240.1| PREDICTED: F-box protein AFR-like isoform X1 [Cicer arietinum]
Length=340

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 76/164 (46%), Gaps = 21/164 (13%)
 Frame = +2

Query  152  GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYA  331
            GK+YV +  + WPF V   G VYD E++ W EM  GM +GW     G    V V  EL  
Sbjct  195  GKMYVTEG-WSWPFVVRPKGGVYDLESDTWREMRNGMSDGWIGVSVGVCGRVFVIPEL--  251

Query  332  LDPSSSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQN  511
                       ++VYD   D+W+ + GD+  RD+   + P +  GL  ++ V++   N  
Sbjct  252  --------DLPLRVYDEVSDTWRGVSGDLFPRDVM--KKPLVAKGLDDRIYVVSHGLNVA  301

Query  512  ILVLQADRQHNQNENEKESDANIWRVI-ASRNSGSAELISCQIL  640
            I  +  +       NE  +    W+V+ AS +       +CQ+L
Sbjct  302  IGTVVVN-------NECSTVNVTWQVVEASLSFREFSPSTCQVL  338



>ref|XP_008347651.1| PREDICTED: F-box protein AFR-like [Malus domestica]
Length=427

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 19/137 (14%)
 Frame = +2

Query  122  PIATGISSY-----RGKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQ  286
            P+  G++ Y       K+YV +  + WPF     G VYDP+ N W EM  GM +GW    
Sbjct  268  PLPGGLAKYDSNVVGNKMYVTEG-WTWPFMYSPRGVVYDPDDNTWQEMRPGMRDGW----  322

Query  287  AGTKLSVIVDGELYALDPSSSFDSAKIKVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLA  463
              T +SV+V G L  +   S +    +K YD   D+W+ + GD  P   L     P+  +
Sbjct  323  --TGVSVVVGGRLLVI---SEYGDCXMKAYDPDKDTWRYVGGDRFPCEAL---RRPFAAS  374

Query  464  GLLGKLNVIAKDANQNI  514
            G+ G + V+A   N  +
Sbjct  375  GVEGNIYVVACGLNVGV  391



>ref|XP_008378156.1| PREDICTED: F-box protein AFR-like [Malus domestica]
Length=379

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 67/141 (48%), Gaps = 19/141 (13%)
 Frame = +2

Query  122  PIATGISSY-----RGKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQ  286
            P+  G++ Y       K+YV +  + WPF     G VYDP+ N W EM  GM +GW    
Sbjct  220  PLPGGLAKYDSNVVGNKMYVTEG-WTWPFMYSPRGVVYDPDDNTWQEMRPGMRDGW----  274

Query  287  AGTKLSVIVDGELYALDPSSSFDSAKIKVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLA  463
              T +SV+V G L  +   S +    +K YD   D+W+ + GD  P   L     P+  +
Sbjct  275  --TGVSVVVGGRLLVI---SEYGDCXMKAYDPDKDTWRYVGGDRFPCEAL---RRPFAAS  326

Query  464  GLLGKLNVIAKDANQNILVLQ  526
            G+ G + V+A   N  +  L 
Sbjct  327  GVEGNIYVVACGLNVGVGXLS  347



>ref|XP_004501241.1| PREDICTED: F-box protein AFR-like isoform X2 [Cicer arietinum]
Length=341

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 76/164 (46%), Gaps = 21/164 (13%)
 Frame = +2

Query  152  GKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYA  331
            GK+YV +  + WPF V   G VYD E++ W EM  GM +GW     G    V V  EL  
Sbjct  196  GKMYVTEG-WSWPFVVRPKGGVYDLESDTWREMRNGMSDGWIGVSVGVCGRVFVIPEL--  252

Query  332  LDPSSSFDSAKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQN  511
                       ++VYD   D+W+ + GD+  RD+   + P +  GL  ++ V++   N  
Sbjct  253  --------DLPLRVYDEVSDTWRGVSGDLFPRDVM--KKPLVAKGLDDRIYVVSHGLNVA  302

Query  512  ILVLQADRQHNQNENEKESDANIWRVI-ASRNSGSAELISCQIL  640
            I  +  +       NE  +    W+V+ AS +       +CQ+L
Sbjct  303  IGTVVVN-------NECSTVNVTWQVVEASLSFREFSPSTCQVL  339



>emb|CCH50979.1| T4.18 [Malus x robusta]
Length=452

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 98/227 (43%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  257  LRSAEIYDPNKNRWSFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  301

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  302  --------EVMSEAYTPEANTWTPISDGMVAGW------RNPSISLNGQLYALD---CRD  344

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ V   
Sbjct  345  GCKLRVYDRVTDSWNKFIDSKVHLGSSCALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  403

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D+    N +  E+ A          NIW  IA R    + ++ CQ+L
Sbjct  404  DKHVESNPHLWENIAGKGHFRTLVSNIWSSIAGRTGLKSHIVHCQVL  450



>ref|XP_009353344.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein AFR-like [Pyrus 
x bretschneideri]
Length=427

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 19/137 (14%)
 Frame = +2

Query  122  PIATGISSY-----RGKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQ  286
            P+  G++ Y       K+YV +  + WPF     G VYDP+ N W EM  GM +GW    
Sbjct  268  PLPGGLAKYDSNVVGNKMYVTEG-WTWPFMYSPRGVVYDPDDNTWQEMRPGMRDGW----  322

Query  287  AGTKLSVIVDGELYALDPSSSFDSAKIKVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLA  463
              T +SV+V G L  +   S +    +K YD   D+W+ + GD  P   L     P+  +
Sbjct  323  --TGVSVVVGGRLLVI---SEYGDCPMKAYDPDKDTWRYVGGDRFPCEAL---RRPFAAS  374

Query  464  GLLGKLNVIAKDANQNI  514
            G+ G + V+A   N  +
Sbjct  375  GVEGNIYVVACGLNVGV  391



>ref|XP_009348468.1| PREDICTED: F-box protein AFR-like [Pyrus x bretschneideri]
Length=427

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 19/137 (14%)
 Frame = +2

Query  122  PIATGISSY-----RGKLYVPQSLYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQ  286
            P+  G++ Y       K+YV +  + WPF     G VYDP+ N W EM  GM +GW    
Sbjct  268  PLPGGLAKYDSNVVGNKMYVTEG-WTWPFMYSPRGVVYDPDDNTWQEMRPGMRDGW----  322

Query  287  AGTKLSVIVDGELYALDPSSSFDSAKIKVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLA  463
              T +SV+V G L  +   S +    +K YD   D+W+ + GD  P   L     P+  +
Sbjct  323  --TGVSVVVGGRLLVI---SEYGDCPMKAYDPDKDTWRYVGGDRFPCEAL---RRPFAAS  374

Query  464  GLLGKLNVIAKDANQNI  514
            G+ G + V+A   N  +
Sbjct  375  GVEGNIYVVACGLNVGV  391



>ref|XP_006294444.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
 ref|XP_006294445.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
 ref|XP_006294446.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
 gb|EOA27342.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
 gb|EOA27343.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
 gb|EOA27344.1| hypothetical protein CARUB_v10023458mg [Capsella rubella]
Length=372

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 38/209 (18%)
 Frame = +2

Query  20   EVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWPFFV  199
            E +D ET  W  V  +P                  +A   S+  GK       + WPF  
Sbjct  198  ESYDQETDTWTAVKRVPMV----------------LAKYDSAVIGKEMCVTEGWAWPFMF  241

Query  200  DAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKVYD  379
               G VYD + N W EM  GM EGW      T +SV++ G L+ +     F    +KVY 
Sbjct  242  PPMGHVYDSDENTWREMSGGMKEGW------TGVSVVIHGRLFVISEHGDF---PMKVYF  292

Query  380  SRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQHNQNEN  556
            S DD+W+ + G+ +P   +     P+ + G   ++ V+A   N       A+ + ++ +N
Sbjct  293  SEDDTWRYVSGEKLPGEKM---RRPFAVTGAGDRVFVVAGGIN------VAEGRVSEGQN  343

Query  557  EKESDANIWRVIASRNSG-SAELISCQIL  640
             + S    WR+++S  S       SC +L
Sbjct  344  GEFSVE--WRMVSSPQSFVHFSPASCHVL  370



>ref|XP_008393946.1| PREDICTED: F-box protein AFR [Malus domestica]
 ref|XP_008367708.1| PREDICTED: F-box protein AFR-like [Malus domestica]
Length=381

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 76/170 (45%), Gaps = 29/170 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            +++ + +DP    W    ++P         A LA +   +         K+YV +  + W
Sbjct  204  IRAVDCYDPVKDTWAPCATLP---------AGLAKYDSNVVGN------KMYVTEG-WTW  247

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
            PF     G VYDP+ + W EM  GM +GW      T +SV+V G L  +   S +    I
Sbjct  248  PFMHSPRGVVYDPDDDTWQEMRPGMRDGW------TGVSVVVGGRLLVI---SEYGDCPI  298

Query  368  KVYDSRDDSWKAIEGD-IPIRDLTDSESPYLLAGLLGKLNVIAKDANQNI  514
            K YD   D+W+ + GD  P   L     P+  +G+ G + V+A   N  I
Sbjct  299  KAYDPDKDTWRYVGGDRFPCEAL---RRPFAASGVEGNICVVACGLNVGI  345



>ref|XP_003531234.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
 gb|KHN47962.1| F-box/kelch-repeat protein [Glycine soja]
Length=437

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 94/223 (42%), Gaps = 39/223 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M         T  +  F+  +  G    +G L   +++ C 
Sbjct  242  LRSAEVYDPNRNRWSFISEM---------TTAMVPFIGVVHNGTWFLKG-LGSNRNVIC-  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y  ET+ W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  291  --------ESYSQETDTWTPVSNGMVNGW------RNPSISLNGQLYALDCQ---DGCKL  333

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQHN  544
            KVYD   DSWK           + +     L  L GKL +I  + + +++ V   +R+  
Sbjct  334  KVYDRASDSWKKFIDSKLHLGRSRALDAAALVPLNGKLCIIRNNMSISLVDVSSPNRRVE  393

Query  545  QNENEKESDA----------NIWRVIASRNSGSAELISCQILD  643
             N    E+ A          N+W  IA R S  + ++ CQ+L 
Sbjct  394  SNPQLWENIAGKGHVRSLVRNLWSTIAGRGSLKSHIVHCQVLQ  436



>ref|XP_010047816.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Eucalyptus 
grandis]
 gb|KCW79805.1| hypothetical protein EUGRSUZ_C01139 [Eucalyptus grandis]
Length=432

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 96/224 (43%), Gaps = 42/224 (19%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            ++SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  236  MRSAEVYDPNRNRWSFISEM---STAMVPFIGVVYEGKWYLKGLGSHRQVL---------  283

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    EVY PET++W  +  GM  GW         SV  +G LYALD     D  K+
Sbjct  284  -------SEVYQPETDSWFPVYDGMVAGW------RNPSVSFNGHLYALDCK---DGCKL  327

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD   DSW K I+  + + +    E+  L+  L GKL VI  + + +++ V ++D   
Sbjct  328  RVYDEVTDSWSKHIDSKMHLGNSQALEAAALVP-LNGKLCVIRNNMSISVVDVSKSDGGR  386

Query  542  NQNENE-----------KESDANIWRVIASRNSGSAELISCQIL  640
                             +    N+W  IA RN   + ++ CQ+L
Sbjct  387  GATAEHLWETIAGKSQLRTMVTNLWSNIAGRNRLKSHIVHCQVL  430



>ref|XP_006341889.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341890.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006341891.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006341892.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X4 [Solanum tuberosum]
Length=437

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 99/225 (44%), Gaps = 41/225 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ S+R  L         
Sbjct  242  LRSAEVYDPNRKRWSFIADM---STAMVPFIGVVYDGKWFIKGLGSHREVL---------  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y+P+TNAW  +   M  GW         S+ ++G LYALD     D  K+
Sbjct  290  -------SEAYNPDTNAWSPVNNRMVAGW------RNPSISMNGRLYALD---CRDGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SW + I+  + +      E+  L+  L GKL +I  + + +I+ VL  D++ 
Sbjct  334  RVYDESTQSWIRFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISIIDVLSPDKRV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQILDM  646
              N +  E+ A          N+W  IA R    + ++ CQ+L +
Sbjct  393  ETNPHLWENIAGKGHFRTMFTNLWSSIAGRAGLKSHIVHCQVLQV  437



>ref|XP_009368827.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
 ref|XP_009368828.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=428

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 96/229 (42%), Gaps = 48/229 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M    A  +   +    FLK    G+ S+R  L        
Sbjct  232  LKSAEVYDPNKNRWSFISEMSTAMAPYIGVIYEGKWFLK----GLGSHRQVL--------  279

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PE ++W  +  GM  GW         SV ++G LYA   S   D  K
Sbjct  280  --------SEVYQPENDSWYSVYDGMVAGW------RNPSVALNGHLYA---SECKDGCK  322

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            +KVYD   DSW K I+  + + +    E+  L+  L GKL +I    N +I ++   +  
Sbjct  323  LKVYDKATDSWSKHIDSKMHLGNSKALEAASLVP-LNGKLCIIRN--NMSISLVDVSKSS  379

Query  542  NQNENEKES--------------DANIWRVIASRNSGSAELISCQILDM  646
            +  E   E                 N+W  +A RN   + ++ CQ+L +
Sbjct  380  DVGEASAEYLWETIAGKGQFRTLVTNLWSNLAGRNRLKSHIVHCQVLQV  428



>ref|XP_010472463.1| PREDICTED: F-box protein AFR [Camelina sativa]
Length=374

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 83/197 (42%), Gaps = 36/197 (18%)
 Frame = +2

Query  20   EVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCWPFFV  199
            E +DPE   W  +  +P                  +A   S+  GK       + WPF  
Sbjct  199  ESYDPECDTWTVLKRVPMV----------------LAKYDSAVIGKEMCVTEGWAWPFMF  242

Query  200  DAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKIKVYD  379
               G+VYD + N W EM  GM EGW      T +SV++ G L+ +     F    +KVY 
Sbjct  243  PPMGQVYDSDENTWREMSGGMKEGW------TGVSVVIRGRLFVISEHGDF---PMKVYF  293

Query  380  SRDDSWKAIEGDIPIRDLTDSESPYLLAGL-LGKLNVIAKDANQNILVLQADRQHNQNEN  556
            S DD+W+ + G+    D      P+ + G   G++ V+A   N          +   +E 
Sbjct  294  SEDDTWRYVSGEKLPGD--KMRRPFAVTGADDGRVFVVAGGLNV--------AEGTVSEG  343

Query  557  EKESDANIWRVIASRNS  607
            E    + +WR+++S  S
Sbjct  344  ENGEFSVVWRMVSSPQS  360



>ref|XP_010656414.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Vitis vinifera]
Length=431

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 99/227 (44%), Gaps = 48/227 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M       +   +    FLK    G+ S+R  L        
Sbjct  235  LRSAEVYDPNRNRWSFISDMSTAMVPFIGVVYEGKWFLK----GLGSHRQVL--------  282

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PET++W  +  GM  GW         S  ++G+LYALD     D  K
Sbjct  283  --------SEVYQPETDSWYPVYDGMVAGW------RNPSASLNGQLYALDCK---DGCK  325

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            ++VYD   DSW K I+  + + +    E+  L+  L GKL +I    N +I ++   +  
Sbjct  326  LRVYDEVSDSWSKHIDSKMHLGNSQALEAAALVP-LHGKLCIIRN--NMSISLVNVSKSE  382

Query  542  NQN----ENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            +      E+  E+ A          N+W  +A RN   + ++ CQ+L
Sbjct  383  DMTGPTAEHLWETIAGRGQFKTLVTNLWSSLAGRNRLKSHIVHCQVL  429



>gb|EYU24437.1| hypothetical protein MIMGU_mgv1a024107mg, partial [Erythranthe 
guttata]
Length=272

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 101/225 (45%), Gaps = 41/225 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ ++R  L         
Sbjct  77   LRSAEVYDPNRNRWSFIADMSTA---MVPFIGVVYDGKWFLKGLGAHREVL---------  124

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PE+N W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  125  -------SEAYTPESNLWSPINDGMVSGW------RNPSISMNGKLYALDCR---DGCKL  168

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD + DSW + I+  I + +    E+  L+  + GKL +I  + + +++ V   D++ 
Sbjct  169  RVYDEKTDSWSRFIDSKIHLGNSRALEAAALVP-INGKLCIIRNNMSISMVDVSGTDKRA  227

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQILDM  646
              +    E+ A          N+W  IA R+   + ++ CQ+L +
Sbjct  228  EGSSGIWENIAIKGHFRNLFTNLWSSIAGRSGLKSHIVHCQVLQV  272



>ref|XP_004142161.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 ref|XP_004173631.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 gb|KGN54077.1| hypothetical protein Csa_4G280540 [Cucumis sativus]
Length=437

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 101/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M    + M+P      F+  +  G+   +G     + +   
Sbjct  242  LRSAEVYDPNKNRWSFISDM---SSAMVP------FIGVVHDGLWFLKGLGTRREVM---  289

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PETN W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  290  -------SEAYSPETNTWTTVSDGMVSGW------RNPSISLNGQLYALDCQ---DGCKL  333

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYDS  DSW + I+  +        E+  L++ L GKL +I  + + +++ V   D++ 
Sbjct  334  RVYDSATDSWNRFIDSKLHFGSSRALEAAALVS-LNGKLCIIRNNMSISLVDVSSPDKRV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+   IA RN   + ++ CQ+L
Sbjct  393  ESNPHLWENIAGRGHLRTLVTNLLSSIAGRNGLKSHIVHCQVL  435



>ref|XP_010688025.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=443

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 94/228 (41%), Gaps = 49/228 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M       +   F    +LK    G+ ++R  L        
Sbjct  246  LRSAEVYDPNKNRWSIISDMSTAMVPFIGVVFDGKWYLK----GLGTHRQVL--------  293

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PE++ W  +  GM  GW         S  ++G+LYALD     D  K
Sbjct  294  --------SEVYHPESDNWYPVYDGMVAGW------RNPSAAMNGKLYALDCK---DGCK  336

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            ++VYD   DSW K I+  + + +    E+  L+  L GKL ++    N +I  + A R  
Sbjct  337  LRVYDEASDSWSKHIDSRVHLGNSKALEAAALVP-LNGKLCIVRN--NMSISFVDASRSE  393

Query  542  NQNENE---------------KESDANIWRVIASRNSGSAELISCQIL  640
            +    E               K    NIW  IA R    + ++ CQIL
Sbjct  394  DVGSAETSEHLWETITGRGQFKTIMMNIWSSIAGRKHLKSHIVHCQIL  441



>ref|XP_010688026.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688027.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=429

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 94/228 (41%), Gaps = 49/228 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M       +   F    +LK    G+ ++R  L        
Sbjct  232  LRSAEVYDPNKNRWSIISDMSTAMVPFIGVVFDGKWYLK----GLGTHRQVL--------  279

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PE++ W  +  GM  GW         S  ++G+LYALD     D  K
Sbjct  280  --------SEVYHPESDNWYPVYDGMVAGW------RNPSAAMNGKLYALDCK---DGCK  322

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            ++VYD   DSW K I+  + + +    E+  L+  L GKL ++    N +I  + A R  
Sbjct  323  LRVYDEASDSWSKHIDSRVHLGNSKALEAAALVP-LNGKLCIVRN--NMSISFVDASRSE  379

Query  542  NQNENE---------------KESDANIWRVIASRNSGSAELISCQIL  640
            +    E               K    NIW  IA R    + ++ CQIL
Sbjct  380  DVGSAETSEHLWETITGRGQFKTIMMNIWSSIAGRKHLKSHIVHCQIL  427



>gb|KDP33188.1| hypothetical protein JCGZ_12710 [Jatropha curcas]
Length=373

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 37/180 (21%)
 Frame = +2

Query  14   SAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRG-----KLYVPQSL  178
            +AE +DPET  W  V  M                     TG+  Y       ++YV +  
Sbjct  197  AAECYDPETDTWTPVAKM--------------------RTGLCRYDSAVVGNRMYVTEG-  235

Query  179  YCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDS  358
            + WPF     G +YDPE + W E+  G+ EGW      T LS+++   L+ +   S    
Sbjct  236  WTWPFMFSPRGGIYDPEKDTWQELRDGIREGW------TGLSLVLSDRLFVI---SEHGD  286

Query  359  AKIKVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQ  538
              +KVY    D+W+ + GD   R     + P+ ++G  GK+ V++   N  I  +  D+ 
Sbjct  287  CPMKVYLPDLDTWRYVGGDKFPRQAM--QRPFAVSGAEGKVYVVSSGLNVAIGRIYEDKN  344



>ref|XP_009364116.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=437

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 99/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAE++DP    W  +  M      M+P   +      FLK    G+ S+R        
Sbjct  242  LRSAEIYDPNKNRWSFISDM---STAMVPFIGVVHDGMWFLK----GLGSHR--------  286

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PE N W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  287  --------EVMSEAYTPEANTWTPISDGMVAGW------RNPSISLNGQLYALD---CRD  329

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQAD  532
              K++VYD   DSW K I+  + +      E+  L+  L GKL +I  + + +++ + + 
Sbjct  330  GCKLRVYDRVSDSWIKFIDSKLHLGSSRALEAAALVP-LNGKLCIIRNNMSISLVDVSSP  388

Query  533  RQHNQNENE-----------KESDANIWRVIASRNSGSAELISCQIL  640
             +H ++  +           +   +N+W  IA R    + ++ CQ+L
Sbjct  389  DKHVESNPQLWENIAGKGHFRTLVSNLWSSIAGRTGLKSHIVHCQVL  435



>ref|XP_008449801.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Cucumis melo]
Length=437

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 101/227 (44%), Gaps = 49/227 (22%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD----FLKPIATGISSYRGKLYVPQS  175
            L+SAEV+DP    W  +  M    + M+P   +      FLK    G+ + R        
Sbjct  242  LRSAEVYDPNKNRWSFISDM---SSAMVPFIGVVHDGLWFLK----GLGTRR--------  286

Query  176  LYCWPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFD  355
                    +   E Y PETN W  +  GM  GW         S+ ++G+LYALD     D
Sbjct  287  --------EVMSEAYSPETNTWTTVSDGMVAGW------RNPSISLNGQLYALDCQ---D  329

Query  356  SAKIKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQA  529
              K++VYDS  DSW + I+  +        E+  L++ L GKL +I  + + +++ V   
Sbjct  330  GCKLRVYDSATDSWNRFIDSKLHFGSSRALEAAALVS-LNGKLCIIRNNMSISLVDVSSP  388

Query  530  DRQHNQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
            D++   N +  E+ A          N+   IA RN   + ++ CQ+L
Sbjct  389  DKRVESNPHLWENIAGRGHLRTLVTNLLSSIAGRNGLKSHIVHCQVL  435



>ref|XP_008337311.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
 ref|XP_008337312.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=428

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 96/229 (42%), Gaps = 48/229 (21%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLAD-FLKPIATGISSYRGKLYVPQSLYC  184
            L+SAEV+DP    W  +  M    A  +   +    FLK    G+ S+R  L        
Sbjct  232  LKSAEVYDPNKNRWSFISEMSTGMAPYIGVVYEGKWFLK----GLGSHRQVL--------  279

Query  185  WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAK  364
                     EVY PE ++W  +  GM  GW         SV ++G LYA   S   D  K
Sbjct  280  --------SEVYQPENDSWYSVYDGMVAGW------RNPSVALNGHLYA---SECKDGCK  322

Query  365  IKVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQADRQH  541
            ++VYD   DSW K I+  + + +    E+  L+  L GKL +I    N +I ++   +  
Sbjct  323  LRVYDKATDSWSKHIDSKMHLGNSKALEAASLVP-LNGKLCIIRN--NMSISLVDVSKSS  379

Query  542  NQNENEKES--------------DANIWRVIASRNSGSAELISCQILDM  646
            +  E   E                 N+W  +A RN   + ++ CQ+L +
Sbjct  380  DVGEASAEYLWETIAGKGQFRTLVTNLWSNLAGRNRLKSHIVHCQVLQV  428



>ref|XP_011089699.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
Length=437

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L SAEV+DP    W  +  M  T A M+P   +    K    G+ ++R  L         
Sbjct  242  LSSAEVYDPNRNRWSFIADM--TTA-MVPFIGVVYDGKWFVKGLGAHREVLC--------  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PETNAW  M   +  GW         S+ ++G+LYALD     D  K+
Sbjct  291  --------EAYTPETNAWNPMNDTLVSGW------RNPSISMNGKLYALD---CRDGCKL  333

Query  368  KVYDSRDDSWKA-IEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD    SWK  I+  + + +    E+  L+  L GKL +I  + + +++ V   D+Q 
Sbjct  334  RVYDEGTKSWKRFIDSKLHLGNSRALEAAALVP-LNGKLCIIRNNMSISMVDVSNPDKQI  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R+   + ++ CQ+L
Sbjct  393  ESNPHIWENIANKGHFKTLFTNLWSSIAGRSGLKSHIVHCQVL  435



>ref|XP_003629702.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AET04178.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=437

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 94/223 (42%), Gaps = 39/223 (17%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M         T  +  F+  I  G    +G L   +++ C 
Sbjct  242  LRSAEVYDPNRNRWSFISEM---------TTAMVPFIGVIHNGTWFLKG-LGSNRNVIC-  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y  E++ W  +  GM  GW         S+ ++GELYALD     D  K+
Sbjct  291  --------EAYSQESDTWTPVNNGMVVGW------RNPSISLNGELYALDCQ---DGCKL  333

Query  368  KVYDSRDDSWKAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQHN  544
            KVYD   DSWK           + +     L  L GKL +I  + + +++ V   +R+  
Sbjct  334  KVYDMATDSWKKFIDSRLHLGSSRALDAAALVSLNGKLCIIRNNMSISLVDVSSPNRRVE  393

Query  545  QNENEKESDA----------NIWRVIASRNSGSAELISCQILD  643
             N +  E+ A          N+W  IA R    + ++ CQ+L 
Sbjct  394  SNPHLWENIAGKGPVRSLVRNLWSTIAGRGGLKSHIVHCQVLQ  436



>ref|XP_004504335.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cicer arietinum]
Length=437

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M         T  +  F+  I  G    +G L   +++ C 
Sbjct  242  LRSAEVYDPNRNRWSFISEM---------TTAMVPFIGVIHNGAWFLKG-LGSNRNVIC-  290

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y  ET+ W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  291  --------ESYSQETDTWTPISNGMVNGW------RNPSISLNGQLYALDCQ---DGCKL  333

Query  368  KVYDSRDDSWKA-IEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            KVYD   DSWK  I+  + +      ++  L++ L GKL +I  + + +++ V   +++ 
Sbjct  334  KVYDGATDSWKKFIDSRVHLGSSRALDAAALVS-LNGKLCIIRNNMSISLVDVSSPNKRV  392

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              N +  E+ A          N+W  IA R    + ++ CQ+L
Sbjct  393  ESNPHLWENIAGKGPARSLVRNLWSTIAGRGGLKSHIVHCQVL  435



>ref|XP_006845596.1| hypothetical protein AMTR_s00019p00203560 [Amborella trichopoda]
 gb|ERN07271.1| hypothetical protein AMTR_s00019p00203560 [Amborella trichopoda]
Length=410

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 99/219 (45%), Gaps = 52/219 (24%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYC-  184
            L S E +DP TG W  V  M                      G++ Y   ++  + +Y  
Sbjct  234  LASVESYDPVTGQWARVADM--------------------RVGMTRYDAAVFA-RRMYIT  272

Query  185  ----WPFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSF  352
                WPF V   G VY+PE+++W EM  GM EGW      T LSV+V+G L+ +   S  
Sbjct  273  EGWEWPFDVPPRGAVYNPESDSWEEMRRGMREGW------TGLSVVVEGNLFVI---SEH  323

Query  353  DSAKIKVYDSRDDSWK-AIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNILVLQA  529
             ++++KVY    D W+ A  G +P     +   P+ ++ +  ++ V++  +  ++ V   
Sbjct  324  KNSRVKVYVPERDVWEYAGGGCVP----GEVRRPFTVSAIGDRMYVVS--SGLHVAVGTV  377

Query  530  DRQHNQNENEKESDANIWRVIASRNSGSAELI-SC-QIL  640
             R       E       W V+A+   G AELI SC Q+L
Sbjct  378  ARGPGGVSVE-------WEVVAA-PPGFAELIPSCSQVL  408



>gb|EYU39246.1| hypothetical protein MIMGU_mgv1a006629mg [Erythranthe guttata]
Length=312

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ ++R  L         
Sbjct  117  LRSAEVYDPNRNRWSFIADM---STAMVPFIGVVYDGKWFLKGLGAHREVL---------  164

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PE+N W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  165  -------SEAYTPESNLWSPINDGMVSGW------RNPSISMNGKLYALDCR---DGCKL  208

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD + DSW + I+  I + +    E+  L+  + GKL +I  + + +++ V   D++ 
Sbjct  209  RVYDEKTDSWSRFIDSKIHLGNSRALEAAALVP-INGKLCIIRNNMSISMVDVSGTDKRA  267

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              +    E+ A          N+W  IA R+   + ++ CQ+L
Sbjct  268  EGSSGIWENIAIKGHFRNLFTNLWSSIAGRSGLKSHIVHCQVL  310



>gb|EYU24438.1| hypothetical protein MIMGU_mgv1a026698mg, partial [Erythranthe 
guttata]
Length=272

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 100/223 (45%), Gaps = 41/223 (18%)
 Frame = +2

Query  8    LQSAEVFDPETGIWVEVPSMPFTKAHMLPTAFLADFLKPIATGISSYRGKLYVPQSLYCW  187
            L+SAEV+DP    W  +  M      M+P   +    K    G+ ++R  L         
Sbjct  77   LRSAEVYDPNRNRWSFIADMSTA---MVPFIGVVYDGKWFLKGLGAHREVL---------  124

Query  188  PFFVDAGGEVYDPETNAWVEMPMGMGEGWPARQAGTKLSVIVDGELYALDPSSSFDSAKI  367
                    E Y PE+N W  +  GM  GW         S+ ++G+LYALD     D  K+
Sbjct  125  -------SEAYTPESNLWSPINDGMVYGW------RNPSISMNGKLYALDCR---DGCKL  168

Query  368  KVYDSRDDSW-KAIEGDIPIRDLTDSESPYLLAGLLGKLNVIAKDANQNIL-VLQADRQH  541
            +VYD + DSW + I+  I + +    E+  L+  + GKL +I  + + +++ V   D++ 
Sbjct  169  RVYDEKTDSWSRFIDSKIHLGNSRALEAAALVP-INGKLCIIRNNMSISMVDVSGTDKRA  227

Query  542  NQNENEKESDA----------NIWRVIASRNSGSAELISCQIL  640
              +    E+ A          N+W  IA R+   + ++ CQ+L
Sbjct  228  EGSSGIWENIAIKGHFRNLFTNLWSSIAGRSGLKSHIVHCQVL  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1389194222792