BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4713_g1_i2 len=1899 path=[1925:0-1626 3551:1627-1738 25:1739-1898]

Length=1899
                                                                      Score     E

ref|XP_006344947.1|  PREDICTED: rab GDP dissociation inhibitor al...    871   0.0      
ref|XP_004251972.1|  PREDICTED: guanosine nucleotide diphosphate ...    870   0.0      
ref|NP_001274860.1|  rab GDP dissociation inhibitor alpha-like          868   0.0      
ref|XP_009629496.1|  PREDICTED: guanosine nucleotide diphosphate ...    867   0.0      
ref|XP_009620915.1|  PREDICTED: guanosine nucleotide diphosphate ...    866   0.0      
ref|XP_009784522.1|  PREDICTED: guanosine nucleotide diphosphate ...    863   0.0      
gb|AAW78520.1|  GDP dissociation inhibitor 1                            862   0.0      Solanum chilense
gb|ACN65853.1|  Rab GDP dissociation inhibitor                          862   0.0      Nicotiana benthamiana
ref|XP_006478491.1|  PREDICTED: rab GDP dissociation inhibitor al...    857   0.0      
ref|XP_011074023.1|  PREDICTED: guanosine nucleotide diphosphate ...    854   0.0      
ref|XP_006441986.1|  hypothetical protein CICLE_v10020158mg             854   0.0      
ref|XP_008394248.1|  PREDICTED: guanosine nucleotide diphosphate ...    852   0.0      
ref|XP_007026461.1|  Guanosine nucleotide diphosphate dissociatio...    851   0.0      
ref|XP_011014748.1|  PREDICTED: guanosine nucleotide diphosphate ...    850   0.0      
ref|XP_004244786.1|  PREDICTED: guanosine nucleotide diphosphate ...    850   0.0      
ref|XP_006351084.1|  PREDICTED: rab GDP dissociation inhibitor al...    849   0.0      
gb|EYU22361.1|  hypothetical protein MIMGU_mgv1a006444mg                849   0.0      
ref|XP_008354312.1|  PREDICTED: guanosine nucleotide diphosphate ...    848   0.0      
ref|XP_011004551.1|  PREDICTED: guanosine nucleotide diphosphate ...    848   0.0      
ref|XP_007026462.1|  Guanosine nucleotide diphosphate dissociatio...    847   0.0      
gb|KDP45816.1|  hypothetical protein JCGZ_17423                         847   0.0      
gb|AHF81486.1|  small GTP Rab-GDI                                       846   0.0      
ref|XP_006372308.1|  GDP dissociation inhibitor family protein          846   0.0      
gb|KHG05683.1|  Rab GDP dissociation inhibitor alpha                    845   0.0      
ref|NP_001266078.1|  rab GDP dissociation inhibitor alpha-like          845   0.0      
ref|XP_002513702.1|  protein with unknown function                      845   0.0      Ricinus communis
ref|XP_008243091.1|  PREDICTED: guanosine nucleotide diphosphate ...    845   0.0      
ref|XP_009366269.1|  PREDICTED: guanosine nucleotide diphosphate ...    844   0.0      
ref|XP_002280606.1|  PREDICTED: guanosine nucleotide diphosphate ...    843   0.0      Vitis vinifera
ref|XP_010251442.1|  PREDICTED: guanosine nucleotide diphosphate ...    843   0.0      
ref|XP_007202054.1|  hypothetical protein PRUPE_ppa005772mg             841   0.0      
ref|XP_011074031.1|  PREDICTED: guanosine nucleotide diphosphate ...    840   0.0      
emb|CDP11069.1|  unnamed protein product                                840   0.0      
ref|XP_002310371.1|  GDP dissociation inhibitor family protein          840   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003531293.1|  PREDICTED: rab GDP dissociation inhibitor al...    840   0.0      
ref|NP_001276273.1|  rab GDP dissociation inhibitor alpha-like          839   0.0      
ref|XP_003629947.1|  Rab GDP dissociation inhibitor                     838   0.0      
ref|XP_011005244.1|  PREDICTED: guanosine nucleotide diphosphate ...    838   0.0      
gb|ABU98948.1|  GDP-dissociation inhibitor                              838   0.0      Lupinus albus
emb|CAF02075.1|  GDP dissociation inhibitor                             836   0.0      Medicago truncatula
ref|XP_008441682.1|  PREDICTED: guanosine nucleotide diphosphate ...    835   0.0      
ref|XP_004287194.1|  PREDICTED: rab GDP dissociation inhibitor al...    833   0.0      
ref|XP_009410720.1|  PREDICTED: guanosine nucleotide diphosphate ...    833   0.0      
ref|XP_009404932.1|  PREDICTED: guanosine nucleotide diphosphate ...    832   0.0      
ref|XP_010277857.1|  PREDICTED: guanosine nucleotide diphosphate ...    832   0.0      
ref|XP_004138948.1|  PREDICTED: rab GDP dissociation inhibitor al...    832   0.0      
ref|XP_008812865.1|  PREDICTED: guanosine nucleotide diphosphate ...    832   0.0      
ref|XP_007159565.1|  hypothetical protein PHAVU_002G248100g             831   0.0      
ref|XP_010672532.1|  PREDICTED: guanosine nucleotide diphosphate ...    829   0.0      
ref|XP_008801341.1|  PREDICTED: guanosine nucleotide diphosphate ...    829   0.0      
ref|XP_008788293.1|  PREDICTED: guanosine nucleotide diphosphate ...    828   0.0      
ref|XP_010067212.1|  PREDICTED: guanosine nucleotide diphosphate ...    828   0.0      
ref|XP_010907542.1|  PREDICTED: guanosine nucleotide diphosphate ...    826   0.0      
ref|XP_010101313.1|  Rab GDP dissociation inhibitor alpha               826   0.0      
ref|XP_010908336.1|  PREDICTED: guanosine nucleotide diphosphate ...    825   0.0      
ref|XP_006372309.1|  hypothetical protein POPTR_0017s00420g             819   0.0      
ref|XP_006858694.1|  hypothetical protein AMTR_s00066p00096020          818   0.0      
gb|ABK25073.1|  unknown                                                 817   0.0      Picea sitchensis
ref|XP_004962065.1|  PREDICTED: rab GDP dissociation inhibitor al...    817   0.0      
ref|NP_001055142.1|  Os05g0304400                                       816   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010526899.1|  PREDICTED: guanosine nucleotide diphosphate ...    816   0.0      
ref|NP_001055566.1|  Os05g0418000                                       815   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93199.1|  predicted protein                                      815   0.0      
ref|XP_010524208.1|  PREDICTED: guanosine nucleotide diphosphate ...    815   0.0      
ref|XP_006654412.1|  PREDICTED: rab GDP dissociation inhibitor al...    815   0.0      
ref|XP_002439812.1|  hypothetical protein SORBIDRAFT_09g020540          812   0.0      Sorghum bicolor [broomcorn]
ref|XP_003568439.1|  PREDICTED: guanosine nucleotide diphosphate ...    811   0.0      
ref|NP_001183437.1|  Rab GDP dissociation inhibitor alpha               811   0.0      
ref|XP_006654244.1|  PREDICTED: rab GDP dissociation inhibitor al...    810   0.0      
ref|NP_001151199.1|  LOC100284832                                       808   0.0      Zea mays [maize]
ref|XP_008649650.1|  PREDICTED: guanosine nucleotide diphosphate ...    807   0.0      
ref|XP_010067472.1|  PREDICTED: guanosine nucleotide diphosphate ...    806   0.0      
gb|AAB69870.1|  GDP dissociation inhibitor protein OsGDI1               805   0.0      Oryza sativa [red rice]
ref|XP_004962068.1|  PREDICTED: rab GDP dissociation inhibitor al...    805   0.0      
gb|KHN06485.1|  Rab GDP dissociation inhibitor alpha                    815   0.0      
dbj|BAK00943.1|  predicted protein                                      802   0.0      
ref|XP_004288515.1|  PREDICTED: rab GDP dissociation inhibitor al...    801   0.0      
ref|XP_003568438.1|  PREDICTED: guanosine nucleotide diphosphate ...    798   0.0      
gb|ABR16699.1|  unknown                                                 797   0.0      Picea sitchensis
ref|XP_010067325.1|  PREDICTED: guanosine nucleotide diphosphate ...    797   0.0      
ref|XP_010067402.1|  PREDICTED: guanosine nucleotide diphosphate ...    796   0.0      
gb|AAB69871.1|  GDP dissociation inhibitor protein OsGDI2               796   0.0      Oryza sativa [red rice]
ref|XP_006397585.1|  hypothetical protein EUTSA_v10001450mg             795   0.0      
gb|KFK37228.1|  hypothetical protein AALP_AA4G230400                    792   0.0      
ref|XP_010469257.1|  PREDICTED: guanosine nucleotide diphosphate ...    791   0.0      
ref|XP_006402639.1|  hypothetical protein EUTSA_v10005975mg             790   0.0      
emb|CDX98399.1|  BnaC06g17600D                                          790   0.0      
ref|XP_010512285.1|  PREDICTED: guanosine nucleotide diphosphate ...    790   0.0      
ref|XP_006291137.1|  hypothetical protein CARUB_v10017252mg             790   0.0      
ref|XP_008455143.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
gb|AIK01834.1|  GDP dissociation inhibitor                              789   0.0      
ref|XP_010254526.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
ref|XP_010413620.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
ref|XP_008236115.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
ref|XP_010508340.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
emb|CDY45775.1|  BnaC04g22610D                                          789   0.0      
ref|XP_009138891.1|  PREDICTED: guanosine nucleotide diphosphate ...    789   0.0      
ref|NP_001288917.1|  guanosine nucleotide diphosphate dissociatio...    789   0.0      
ref|XP_006852946.1|  hypothetical protein AMTR_s00033p00239520          789   0.0      
gb|KFK35202.1|  hypothetical protein AALP_AA5G253800                    788   0.0      
ref|XP_004155432.1|  PREDICTED: rab GDP dissociation inhibitor al...    788   0.0      
ref|XP_010517995.1|  PREDICTED: guanosine nucleotide diphosphate ...    787   0.0      
ref|XP_007205201.1|  hypothetical protein PRUPE_ppa005809mg             787   0.0      
ref|XP_009104231.1|  PREDICTED: guanosine nucleotide diphosphate ...    786   0.0      
ref|XP_002880083.1|  ATGDI1                                             786   0.0      
ref|XP_010506315.1|  PREDICTED: guanosine nucleotide diphosphate ...    786   0.0      
ref|XP_006294223.1|  hypothetical protein CARUB_v10023221mg             786   0.0      
ref|XP_009380662.1|  PREDICTED: guanosine nucleotide diphosphate ...    785   0.0      
ref|XP_007042842.1|  GDP dissociation inhibitor family protein / ...    785   0.0      
ref|XP_002876528.1|  ATGDI2                                             785   0.0      
ref|XP_008385671.1|  PREDICTED: guanosine nucleotide diphosphate ...    785   0.0      
ref|XP_010646794.1|  PREDICTED: guanosine nucleotide diphosphate ...    785   0.0      
emb|CAN64340.1|  hypothetical protein VITISV_031564                     785   0.0      Vitis vinifera
ref|XP_009364258.1|  PREDICTED: guanosine nucleotide diphosphate ...    784   0.0      
gb|KDO49751.1|  hypothetical protein CISIN_1g013352mg                   783   0.0      
ref|XP_009345712.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    783   0.0      
ref|XP_008363741.1|  PREDICTED: guanosine nucleotide diphosphate ...    783   0.0      
ref|XP_002522655.1|  protein with unknown function                      782   0.0      Ricinus communis
ref|NP_181938.1|  guanosine nucleotide diphosphate dissociation i...    782   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533685.1|  protein with unknown function                      782   0.0      Ricinus communis
ref|XP_008801349.1|  PREDICTED: guanosine nucleotide diphosphate ...    781   0.0      
ref|XP_009790990.1|  PREDICTED: guanosine nucleotide diphosphate ...    782   0.0      
ref|NP_191551.1|  RAB GDP dissociation inhibitor 2                      781   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310487.1|  hypothetical protein POPTR_0007s03250g             781   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007042843.1|  GDP dissociation inhibitor family protein / ...    781   0.0      
ref|XP_009593951.1|  PREDICTED: guanosine nucleotide diphosphate ...    781   0.0      
ref|XP_011023058.1|  PREDICTED: guanosine nucleotide diphosphate ...    780   0.0      
emb|CAA69258.1|  GDP-associated inhibitor                               780   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984243.1|  PREDICTED: rab GDP dissociation inhibitor al...    780   0.0      
ref|XP_004962067.1|  PREDICTED: rab GDP dissociation inhibitor al...    780   0.0      
gb|AAR06264.1|  GDP dissociation inhibitor protein                      779   0.0      Hordeum vulgare [barley]
ref|XP_010937652.1|  PREDICTED: guanosine nucleotide diphosphate ...    778   0.0      
ref|XP_006351732.1|  PREDICTED: rab GDP dissociation inhibitor al...    778   0.0      
ref|XP_004230543.1|  PREDICTED: guanosine nucleotide diphosphate ...    778   0.0      
gb|AAL38263.1|  GDP dissociation inhibitor                              778   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAM64484.1|  GDP dissociation inhibitor                              778   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420147.1|  PREDICTED: guanosine nucleotide diphosphate ...    777   0.0      
ref|XP_006657603.1|  PREDICTED: rab GDP dissociation inhibitor al...    777   0.0      
ref|XP_006487500.1|  PREDICTED: rab GDP dissociation inhibitor al...    777   0.0      
ref|XP_004137066.1|  PREDICTED: rab GDP dissociation inhibitor al...    778   0.0      
ref|XP_009416240.1|  PREDICTED: guanosine nucleotide diphosphate ...    777   0.0      
ref|XP_008784526.1|  PREDICTED: guanosine nucleotide diphosphate ...    776   0.0      
ref|XP_009419946.1|  PREDICTED: guanosine nucleotide diphosphate ...    776   0.0      
ref|XP_002989142.1|  hypothetical protein SELMODRAFT_159958             776   0.0      
ref|XP_006423751.1|  hypothetical protein CICLE_v10029979mg             775   0.0      
ref|XP_003529259.1|  PREDICTED: rab GDP dissociation inhibitor al...    775   0.0      
ref|XP_002268877.1|  PREDICTED: guanosine nucleotide diphosphate ...    774   0.0      Vitis vinifera
gb|EMS53634.1|  Rab GDP dissociation inhibitor alpha                    778   0.0      
ref|XP_009116668.1|  PREDICTED: guanosine nucleotide diphosphate ...    774   0.0      
ref|XP_002987358.1|  hypothetical protein SELMODRAFT_271917             773   0.0      
ref|XP_003531017.1|  PREDICTED: rab GDP dissociation inhibitor al...    773   0.0      
ref|XP_003557314.1|  PREDICTED: guanosine nucleotide diphosphate ...    773   0.0      
ref|XP_007199860.1|  hypothetical protein PRUPE_ppa005763mg             773   0.0      
ref|XP_010277491.1|  PREDICTED: guanosine nucleotide diphosphate ...    772   0.0      
emb|CDY05962.1|  BnaA09g38180D                                          772   0.0      
emb|CAB94202.1|  GDP dissociation inhibitor                             771   0.0      Solanum lycopersicum
ref|NP_001059344.1|  Os07g0271000                                       772   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140939.1|  uncharacterized protein LOC100273017               771   0.0      Zea mays [maize]
ref|XP_009116667.1|  PREDICTED: guanosine nucleotide diphosphate ...    769   0.0      
ref|XP_004983945.1|  PREDICTED: rab GDP dissociation inhibitor al...    769   0.0      
ref|XP_008237140.1|  PREDICTED: guanosine nucleotide diphosphate ...    768   0.0      
ref|XP_002461825.1|  hypothetical protein SORBIDRAFT_02g008810          768   0.0      Sorghum bicolor [broomcorn]
ref|XP_004504841.1|  PREDICTED: rab GDP dissociation inhibitor al...    767   0.0      
ref|XP_006399435.1|  hypothetical protein EUTSA_v10013547mg             767   0.0      
ref|XP_006289683.1|  hypothetical protein CARUB_v10003247mg             766   0.0      
ref|XP_010422972.1|  PREDICTED: LOW QUALITY PROTEIN: guanosine nu...    766   0.0      
gb|EMS53635.1|  Rab GDP dissociation inhibitor alpha                    764   0.0      
ref|XP_010920623.1|  PREDICTED: guanosine nucleotide diphosphate ...    765   0.0      
emb|CDY21587.1|  BnaC09g47050D                                          765   0.0      
ref|XP_010030006.1|  PREDICTED: guanosine nucleotide diphosphate ...    765   0.0      
ref|XP_009131116.1|  PREDICTED: guanosine nucleotide diphosphate ...    764   0.0      
ref|XP_010930328.1|  PREDICTED: guanosine nucleotide diphosphate ...    762   0.0      
ref|NP_196517.3|  RAB GDP-dissociation inhibitor                        763   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY56553.1|  BnaA03g55960D                                          762   0.0      
ref|XP_009122523.1|  PREDICTED: guanosine nucleotide diphosphate ...    761   0.0      
ref|NP_001150143.1|  rab GDP dissociation inhibitor alpha               761   0.0      Zea mays [maize]
gb|EMT30538.1|  Rab GDP dissociation inhibitor alpha                    761   0.0      
gb|EYU39113.1|  hypothetical protein MIMGU_mgv1a006401mg                761   0.0      
gb|KCW87999.1|  hypothetical protein EUGRSUZ_A00408                     760   0.0      
gb|EMS53287.1|  Rab GDP dissociation inhibitor alpha                    761   0.0      
ref|XP_009125364.1|  PREDICTED: guanosine nucleotide diphosphate ...    761   0.0      
ref|XP_002871374.1|  rab GDP-dissociation inhibitor                     761   0.0      
ref|XP_007159145.1|  hypothetical protein PHAVU_002G212600g             761   0.0      
gb|EMT13930.1|  Rab GDP dissociation inhibitor alpha                    760   0.0      
ref|XP_002465085.1|  hypothetical protein SORBIDRAFT_01g031830          760   0.0      Sorghum bicolor [broomcorn]
ref|NP_001078054.1|  guanosine nucleotide diphosphate dissociatio...    759   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDP29973.1|  hypothetical protein JCGZ_18740                         760   0.0      
ref|XP_010452948.1|  PREDICTED: guanosine nucleotide diphosphate ...    760   0.0      
gb|ACL54441.1|  unknown                                                 759   0.0      Zea mays [maize]
ref|XP_003608428.1|  Rab-GDP dissociation inhibitor                     758   0.0      
gb|EEC81843.1|  hypothetical protein OsI_25604                          759   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006584963.1|  PREDICTED: rab GDP dissociation inhibitor al...    758   0.0      
gb|KFK25257.1|  hypothetical protein AALP_AA8G088700                    757   0.0      
gb|KCW87997.1|  hypothetical protein EUGRSUZ_A00406                     758   0.0      
ref|XP_010691404.1|  PREDICTED: guanosine nucleotide diphosphate ...    755   0.0      
ref|XP_006649851.1|  PREDICTED: rab GDP dissociation inhibitor be...    755   0.0      
gb|EMT13931.1|  Rab GDP dissociation inhibitor alpha                    758   0.0      
ref|XP_011092452.1|  PREDICTED: guanosine nucleotide diphosphate ...    753   0.0      
emb|CDX81131.1|  BnaC03g03850D                                          753   0.0      
emb|CDY44805.1|  BnaC02g00820D                                          759   0.0      
ref|XP_003558226.1|  PREDICTED: guanosine nucleotide diphosphate ...    749   0.0      
emb|CDO97391.1|  unnamed protein product                                748   0.0      
ref|XP_010107286.1|  Rab GDP dissociation inhibitor alpha               748   0.0      
ref|XP_010547647.1|  PREDICTED: guanosine nucleotide diphosphate ...    747   0.0      
ref|XP_010520728.1|  PREDICTED: guanosine nucleotide diphosphate ...    746   0.0      
ref|NP_001049717.1|  Os03g0277000                                       745   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHG21656.1|  Rab GDP dissociation inhibitor alpha                    742   0.0      
ref|XP_010930327.1|  PREDICTED: guanosine nucleotide diphosphate ...    738   0.0      
gb|EEE59061.1|  hypothetical protein OsJ_10849                          731   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277492.1|  PREDICTED: guanosine nucleotide diphosphate ...    730   0.0      
gb|KCW56943.1|  hypothetical protein EUGRSUZ_I02620                     725   0.0      
ref|XP_001773747.1|  predicted protein                                  725   0.0      
ref|XP_001766609.1|  predicted protein                                  725   0.0      
gb|KDO49754.1|  hypothetical protein CISIN_1g013352mg                   721   0.0      
ref|XP_001768163.1|  predicted protein                                  723   0.0      
ref|XP_010277493.1|  PREDICTED: guanosine nucleotide diphosphate ...    719   0.0      
ref|XP_006584964.1|  PREDICTED: rab GDP dissociation inhibitor al...    719   0.0      
ref|XP_001755959.1|  predicted protein                                  719   0.0      
gb|EPS65861.1|  hypothetical protein M569_08910                         717   0.0      
gb|KDP29761.1|  hypothetical protein JCGZ_18696                         709   0.0      
gb|AFK40299.1|  unknown                                                 700   0.0      
gb|KHG17909.1|  Rab GDP dissociation inhibitor alpha                    676   0.0      
emb|CDX71860.1|  BnaC08g30140D                                          669   0.0      
ref|XP_004962066.1|  PREDICTED: rab GDP dissociation inhibitor al...    654   0.0      
ref|XP_010030005.1|  PREDICTED: guanosine nucleotide diphosphate ...    650   0.0      
ref|XP_006584965.1|  PREDICTED: rab GDP dissociation inhibitor al...    645   0.0      
gb|KDO49752.1|  hypothetical protein CISIN_1g013352mg                   642   0.0      
ref|XP_002955697.1|  hypothetical protein VOLCADRAFT_83359              615   0.0      
ref|XP_005847470.1|  hypothetical protein CHLNCDRAFT_35621              613   0.0      
gb|AAB09058.1|  GDP dissociation inhibitor protein GDIV1p               612   0.0      Volvox carteri f. nagariensis
emb|CDY65664.1|  BnaC09g54770D                                          605   0.0      
ref|XP_005647685.1|  rab GDP dissociation inhibitor protein             606   0.0      
gb|KDD75407.1|  Rab GDP dissociation inhibitor                          601   0.0      
ref|XP_002501191.1|  predicted protein                                  599   0.0      Micromonas commoda
gb|KFM24244.1|  putative secretory pathway GDP dissociation inhib...    593   0.0      
ref|XP_001694920.1|  rab GDP dissociation inhibitor protein             588   0.0      Chlamydomonas reinhardtii
ref|XP_010101319.1|  Rab GDP dissociation inhibitor alpha               579   0.0      
ref|XP_003064630.1|  predicted protein                                  583   0.0      
gb|KDO49753.1|  hypothetical protein CISIN_1g013352mg                   562   0.0      
gb|EYU36628.1|  hypothetical protein MIMGU_mgv1a0068451mg               553   0.0      
ref|XP_002599716.1|  hypothetical protein BRAFLDRAFT_131482             553   0.0      Branchiostoma floridae
dbj|BAB97381.1|  rab GDP-dissociation inhibitor                         553   0.0      Branchiostoma belcheri
ref|XP_647506.1|  Rab GDP dissociation inhibitor alpha                  550   0.0      Dictyostelium discoideum AX4
emb|CDX69899.1|  BnaA10g22480D                                          538   0.0      
ref|XP_002739493.1|  PREDICTED: rab GDP dissociation inhibitor be...    543   0.0      Saccoglossus kowalevskii
gb|EXX67654.1|  Gdi1p                                                   540   0.0      
ref|XP_003286368.1|  Rab GDP dissociation inhibitor alpha               540   0.0      
dbj|GAM18823.1|  hypothetical protein SAMD00019534_019980               538   0.0      
ref|XP_006373016.1|  hypothetical protein POPTR_0017s07190g             534   0.0      
ref|XP_004339226.1|  GDPassociated inhibitor, putative                  535   0.0      
gb|ABK24357.1|  unknown                                                 529   0.0      Picea sitchensis
ref|XP_004443399.1|  PREDICTED: rab GDP dissociation inhibitor alpha    530   6e-180   
ref|XP_007888513.1|  PREDICTED: rab GDP dissociation inhibitor al...    529   1e-179   
gb|EFA86431.1|  Rab GDP dissociation inhibitor alpha                    529   1e-179   Polysphondylium pallidum PN500
gb|ACE79066.1|  GDP dissociation inhibitor 1 (predicted)                529   2e-179   Sorex araneus [Eurasian shrew]
ref|XP_008157491.1|  PREDICTED: rab GDP dissociation inhibitor alpha    528   3e-179   
emb|CDH49238.1|  rab gdp-dissociation inhibitor                         528   4e-179   
ref|XP_008314202.1|  PREDICTED: rab GDP dissociation inhibitor be...    528   5e-179   
gb|ACC68908.1|  GDP dissociation inhibitor 1 (predicted)                528   5e-179   Rhinolophus ferrumequinum
ref|XP_006219613.1|  PREDICTED: rab GDP dissociation inhibitor al...    528   5e-179   
ref|NP_001018444.1|  rab GDP dissociation inhibitor alpha               527   1e-178   Danio rerio [leopard danio]
ref|XP_007955331.1|  PREDICTED: rab GDP dissociation inhibitor al...    527   1e-178   
ref|XP_007626276.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   1e-178   
ref|XP_005811145.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   1e-178   
ref|XP_005340703.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|XP_008587159.1|  PREDICTED: rab GDP dissociation inhibitor alpha    526   2e-178   
ref|XP_008286063.1|  PREDICTED: rab GDP dissociation inhibitor alpha    526   2e-178   
ref|XP_003360570.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|XP_004414560.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|XP_004001071.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|NP_001126688.1|  rab GDP dissociation inhibitor alpha               526   2e-178   Pongo abelii [orang utan]
ref|XP_005162229.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|XP_005086964.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   2e-178   
ref|NP_058784.2|  rab GDP dissociation inhibitor alpha                  526   2e-178   Rattus norvegicus [brown rat]
ref|XP_003438868.1|  PREDICTED: rab GDP dissociation inhibitor al...    526   3e-178   
ref|XP_003802617.1|  PREDICTED: rab GDP dissociation inhibitor alpha    526   3e-178   
ref|XP_007573030.1|  PREDICTED: rab GDP dissociation inhibitor alpha    525   3e-178   
ref|XP_004695295.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   4e-178   
ref|NP_001003185.1|  rab GDP dissociation inhibitor alpha               525   4e-178   Canis lupus familiaris [dogs]
ref|XP_004780787.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   4e-178   
ref|XP_007538359.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   4e-178   
gb|ELR45814.1|  Rab GDP dissociation inhibitor alpha                    525   4e-178   
dbj|BAE42320.1|  unnamed protein product                                525   5e-178   
ref|XP_004560353.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   5e-178   
ref|XP_008988353.1|  PREDICTED: rab GDP dissociation inhibitor alpha    525   5e-178   
ref|XP_001422173.1|  predicted protein                                  525   5e-178   
ref|NP_776489.1|  rab GDP dissociation inhibitor alpha                  525   5e-178   
ref|XP_006877271.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   6e-178   
gb|AAK49815.1|AF251042_1  rab GDP dissociation inhibitor alpha          525   6e-178   
ref|XP_004717611.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   6e-178   
gb|ACB21225.1|  GDP dissociation inhibitor 1 (predicted)                525   6e-178   
ref|NP_034403.1|  rab GDP dissociation inhibitor alpha                  525   6e-178   
ref|XP_005414257.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   6e-178   
pdb|1LV0|A  Chain A, Crystal Structure Of The Rab Effector Guanin...    525   6e-178   
ref|XP_003963632.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   7e-178   
ref|XP_003462185.1|  PREDICTED: rab GDP dissociation inhibitor al...    525   8e-178   
emb|CDS07176.1|  hypothetical protein LRAMOSA09699                      524   8e-178   
emb|CAA52413.1|  rab GDI alpha                                          525   9e-178   
ref|XP_005370748.1|  PREDICTED: rab GDP dissociation inhibitor al...    524   1e-177   
ref|XP_003943958.1|  PREDICTED: rab GDP dissociation inhibitor alpha    524   1e-177   
ref|XP_010735363.1|  PREDICTED: rab GDP dissociation inhibitor alpha    524   1e-177   
ref|XP_008827816.1|  PREDICTED: rab GDP dissociation inhibitor alpha    524   1e-177   
ref|XP_004390647.1|  PREDICTED: rab GDP dissociation inhibitor al...    524   2e-177   
ref|XP_004645140.1|  PREDICTED: rab GDP dissociation inhibitor al...    524   2e-177   
dbj|GAA99031.1|  hypothetical protein E5Q_05720                         524   2e-177   
ref|NP_001484.1|  rab GDP dissociation inhibitor alpha                  524   2e-177   
dbj|BAK62169.1|  rab GDP dissociation inhibitor alpha                   523   2e-177   
emb|CAI29668.1|  hypothetical protein                                   523   2e-177   
sp|Q7YQM0.1|GDIA_PONPY  RecName: Full=Rab GDP dissociation inhibi...    523   3e-177   
pdb|1D5T|A  Chain A, Guanine Nucleotide Dissociation Inhibitor, A...    523   3e-177   
ref|XP_003512331.2|  PREDICTED: rab GDP dissociation inhibitor al...    523   3e-177   
ref|NP_001162276.1|  rab GDP dissociation inhibitor alpha               523   3e-177   
ref|XP_004355101.1|  Rab GDP dissociation inhibitor alpha               523   3e-177   
emb|CDQ72013.1|  unnamed protein product                                523   3e-177   
ref|XP_004286714.1|  PREDICTED: rab GDP dissociation inhibitor al...    523   3e-177   
emb|CAG03848.1|  unnamed protein product                                523   3e-177   
ref|XP_004598930.1|  PREDICTED: rab GDP dissociation inhibitor al...    523   3e-177   
ref|XP_007457497.1|  PREDICTED: rab GDP dissociation inhibitor al...    523   4e-177   
ref|XP_010873487.1|  PREDICTED: rab GDP dissociation inhibitor alpha    523   4e-177   
emb|CAH92581.1|  hypothetical protein                                   523   4e-177   
ref|XP_010637113.1|  PREDICTED: rab GDP dissociation inhibitor alpha    523   5e-177   
gb|KFM69832.1|  Rab GDP dissociation inhibitor beta                     522   5e-177   
gb|ADF97610.1|  GDP dissociation inhibitor 2                            522   6e-177   
ref|XP_001362742.1|  PREDICTED: rab GDP dissociation inhibitor alpha    522   6e-177   
gb|EDL29822.1|  guanosine diphosphate (GDP) dissociation inhibito...    524   8e-177   
gb|AAL60197.1|  guanosine diphosphate dissociation inhibitor 1          522   8e-177   
gb|EMS22292.1|  rab GDP-dissociation inhibitor                          522   9e-177   
gb|AAQ91240.1|  GDP dissociation inhibitor 2                            521   1e-176   
ref|XP_001964879.1|  GF21994                                            521   1e-176   
gb|AAB16909.1|  GDP-dissociation inhibitor                              521   1e-176   
ref|XP_003279338.1|  PREDICTED: rab GDP dissociation inhibitor al...    521   1e-176   
ref|XP_004875060.1|  PREDICTED: rab GDP dissociation inhibitor al...    521   3e-176   
gb|EPB89717.1|  secretory pathway GDP dissociation inhibitor 1          520   3e-176   
ref|XP_002067035.1|  GK24240                                            520   3e-176   
ref|XP_004919702.1|  PREDICTED: rab GDP dissociation inhibitor al...    520   3e-176   
emb|CAH93371.1|  hypothetical protein                                   520   3e-176   
ref|XP_006625634.1|  PREDICTED: rab GDP dissociation inhibitor al...    520   4e-176   
ref|XP_007616643.1|  PREDICTED: rab GDP dissociation inhibitor beta     520   4e-176   
emb|CEG00803.1|  HSP20-like chaperone                                   520   5e-176   
gb|ABM82975.1|  GDP dissociation inhibitor 1                            520   5e-176   
ref|XP_002036337.1|  GM12441                                            520   5e-176   
ref|NP_001135205.1|  Rab GDP dissociation inhibitor beta                520   5e-176   
ref|NP_523524.2|  GDP dissociation inhibitor, isoform A                 520   6e-176   
ref|XP_005071794.1|  PREDICTED: rab GDP dissociation inhibitor beta     520   6e-176   
dbj|BAM17989.1|  GDP dissociation inhibitor                             520   7e-176   
emb|CDO73197.1|  hypothetical protein BN946_scf185007.g252              520   8e-176   
ref|XP_001357244.1|  GA18172                                            519   9e-176   
emb|CDQ78596.1|  unnamed protein product                                519   1e-175   
ref|XP_005354959.1|  PREDICTED: rab GDP dissociation inhibitor be...    519   1e-175   
ref|XP_003037452.1|  hypothetical protein SCHCODRAFT_255623             519   1e-175   
ref|XP_010885348.1|  PREDICTED: rab GDP dissociation inhibitor be...    519   1e-175   
ref|XP_001969306.1|  GG24025                                            519   1e-175   
ref|NP_001080236.1|  GDP dissociation inhibitor 2                       519   1e-175   
ref|XP_003494990.1|  PREDICTED: rab GDP dissociation inhibitor beta     518   2e-175   
ref|XP_001988047.1|  GH10775                                            518   2e-175   
gb|KFH72432.1|  secretory pathway GDP dissociation inhibitor 1          518   2e-175   
ref|XP_002002921.1|  GI17638                                            518   2e-175   
ref|XP_003230067.1|  PREDICTED: rab GDP dissociation inhibitor alpha    518   3e-175   
gb|AAH43955.1|  Gdi2-prov protein                                       518   3e-175   
ref|XP_006891928.1|  PREDICTED: rab GDP dissociation inhibitor be...    518   3e-175   
ref|XP_005531042.1|  PREDICTED: rab GDP dissociation inhibitor be...    518   4e-175   
ref|XP_006862797.1|  PREDICTED: rab GDP dissociation inhibitor be...    517   5e-175   
ref|NP_955949.1|  rab GDP dissociation inhibitor beta                   517   5e-175   
ref|XP_003220802.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    517   7e-175   
ref|XP_005311907.1|  PREDICTED: rab GDP dissociation inhibitor beta     517   7e-175   
emb|CDQ81740.1|  unnamed protein product                                520   7e-175   
ref|XP_010707648.1|  PREDICTED: rab GDP dissociation inhibitor beta     517   8e-175   
ref|XP_006990255.1|  PREDICTED: rab GDP dissociation inhibitor beta     517   8e-175   
ref|XP_005935394.1|  PREDICTED: rab GDP dissociation inhibitor be...    517   8e-175   
ref|XP_006915369.1|  PREDICTED: rab GDP dissociation inhibitor alpha    517   9e-175   
ref|XP_005742673.1|  PREDICTED: rab GDP dissociation inhibitor be...    516   1e-174   
ref|XP_002057578.1|  GJ18203                                            516   1e-174   
ref|XP_004575313.1|  PREDICTED: rab GDP dissociation inhibitor be...    516   1e-174   
ref|XP_002088933.1|  GE10500                                            516   1e-174   
ref|XP_007438704.1|  PREDICTED: rab GDP dissociation inhibitor alpha    516   2e-174   
ref|XP_003449793.1|  PREDICTED: rab GDP dissociation inhibitor be...    516   2e-174   
gb|ACO09349.1|  Rab GDP dissociation inhibitor beta                     516   2e-174   
ref|NP_001245097.1|  rab GDP dissociation inhibitor beta                515   2e-174   
gb|EFX87450.1|  hypothetical protein DAPPUDRAFT_207615                  515   3e-174   
dbj|BAN21234.1|  rab gdp-dissociation inhibitor                         515   3e-174   
ref|XP_003939096.1|  PREDICTED: rab GDP dissociation inhibitor beta     515   3e-174   
ref|XP_507638.3|  PREDICTED: rab GDP dissociation inhibitor beta ...    515   4e-174   
ref|XP_007252464.1|  PREDICTED: rab GDP dissociation inhibitor be...    515   4e-174   
gb|AAP36244.1|  Homo sapiens GDP dissociation inhibitor 2               514   5e-174   
ref|XP_006633347.1|  PREDICTED: rab GDP dissociation inhibitor be...    514   5e-174   
ref|NP_001485.2|  rab GDP dissociation inhibitor beta isoform 1         514   6e-174   
dbj|BAA03095.1|  human rab GDI                                          514   7e-174   
gb|AEE63143.1|  unknown                                                 514   8e-174   
ref|XP_004261039.1|  Rab GDP dissociation inhibitor alpha, putative     514   9e-174   
ref|NP_001087753.1|  GDP dissociation inhibitor 1                       514   9e-174   
gb|EJY73405.1|  Rab GDP dissociation inhibitor alpha, putative          514   9e-174   
ref|XP_004524684.1|  PREDICTED: rab GDP dissociation inhibitor al...    514   9e-174   
dbj|BAA08078.1|  rab GDI alpha                                          514   9e-174   
ref|XP_010589066.1|  PREDICTED: rab GDP dissociation inhibitor beta     514   1e-173   
ref|NP_990335.1|  rab GDP dissociation inhibitor beta                   514   1e-173   
ref|XP_008567641.1|  PREDICTED: rab GDP dissociation inhibitor beta     514   1e-173   
gb|KDR21130.1|  Rab GDP dissociation inhibitor alpha                    518   1e-173   
ref|XP_002750065.1|  PREDICTED: rab GDP dissociation inhibitor be...    514   1e-173   
ref|XP_006734826.1|  PREDICTED: rab GDP dissociation inhibitor be...    513   1e-173   
ref|XP_010619731.1|  PREDICTED: rab GDP dissociation inhibitor beta     513   1e-173   
ref|NP_058972.2|  rab GDP dissociation inhibitor beta                   513   1e-173   
emb|CBI38271.3|  unnamed protein product                                552   1e-173   
ref|XP_010735220.1|  PREDICTED: rab GDP dissociation inhibitor be...    513   2e-173   
gb|AAV74274.1|  GDP dissociation inhibitor 1                            513   2e-173   
ref|XP_001737423.1|  Rab GDP dissociation inhibitor alpha               513   2e-173   
gb|EHJ69256.1|  putative rab gdp-dissociation inhibitor                 513   2e-173   
gb|EDL32224.1|  guanosine diphosphate (GDP) dissociation inhibito...    514   2e-173   
dbj|BAB25321.1|  unnamed protein product                                513   2e-173   
ref|XP_001740658.1|  Rab GDP dissociation inhibitor alpha               513   2e-173   
emb|CEI94982.1|  Putative RAB proteins geranylgeranyltransferase ...    513   2e-173   
gb|ELK09749.1|  Rab GDP dissociation inhibitor alpha                    513   3e-173   
ref|XP_004049068.1|  PREDICTED: rab GDP dissociation inhibitor be...    513   3e-173   
ref|NP_001003184.1|  rab GDP dissociation inhibitor beta                513   3e-173   
ref|XP_008000366.1|  PREDICTED: rab GDP dissociation inhibitor beta     513   3e-173   
ref|XP_655209.2|  rab GDP dissociation inhibitor alpha                  513   3e-173   
ref|XP_002406620.1|  GDI-1 GDP dissociation inhibitor, putative         513   3e-173   
gb|ERL86573.1|  hypothetical protein D910_03980                         513   4e-173   
dbj|BAN38116.1|  rab GDP dissociation inhibitor alpha, putative         512   4e-173   
gb|EMD47254.1|  Rab GDP dissociation inhibitor alpha, putative          512   4e-173   
ref|XP_968281.1|  PREDICTED: rab GDP dissociation inhibitor alpha       512   4e-173   
emb|CEI92817.1|  Putative GDP dissociation inhibitor                    512   4e-173   
ref|XP_010888056.1|  PREDICTED: rab GDP dissociation inhibitor be...    512   5e-173   
ref|XP_004927762.1|  PREDICTED: rab GDP dissociation inhibitor al...    512   6e-173   
ref|XP_007167506.1|  PREDICTED: rab GDP dissociation inhibitor beta     512   6e-173   
ref|XP_008317185.1|  PREDICTED: rab GDP dissociation inhibitor alpha    512   6e-173   
ref|XP_004379774.1|  PREDICTED: rab GDP dissociation inhibitor be...    512   6e-173   
ref|XP_001913575.1|  rab GDP dissociation inhibitor alpha               511   7e-173   
ref|NP_001125301.1|  rab GDP dissociation inhibitor beta                512   7e-173   
dbj|BAE23494.1|  unnamed protein product                                512   8e-173   
ref|XP_004411873.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   8e-173   
dbj|BAN40431.1|  Rab GDP dissociation inhibitor alpha, putative         511   9e-173   
ref|XP_005886170.1|  PREDICTED: rab GDP dissociation inhibitor al...    511   9e-173   
gb|KDQ14429.1|  hypothetical protein BOTBODRAFT_32562                   511   1e-172   
ref|XP_008288117.1|  PREDICTED: rab GDP dissociation inhibitor beta     511   1e-172   
dbj|BAN39547.1|  rab GDP dissociation inhibitor alpha, putative         511   1e-172   
ref|XP_001663045.1|  rab gdp-dissociation inhibitor                     511   1e-172   
ref|XP_004281735.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   1e-172   
ref|XP_007842644.1|  rab gdp-dissociation inhibitor                     511   1e-172   
ref|XP_005008586.1|  PREDICTED: LOW QUALITY PROTEIN: GDP dissocia...    511   1e-172   
ref|XP_004425449.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   1e-172   
ref|XP_006088483.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   1e-172   
dbj|BAN39325.1|  rab GDP dissociation inhibitor alpha, putative         511   1e-172   
ref|XP_005992613.1|  PREDICTED: rab GDP dissociation inhibitor al...    511   1e-172   
dbj|BAE39709.1|  unnamed protein product                                511   2e-172   
dbj|BAN39409.1|  rab GDP dissociation inhibitor alpha, putative         511   2e-172   
ref|XP_005901020.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   2e-172   
ref|XP_006150132.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   2e-172   
ref|XP_004886169.1|  PREDICTED: rab GDP dissociation inhibitor be...    511   2e-172   
ref|NP_001028934.1|  rab GDP dissociation inhibitor beta                510   2e-172   
ref|NP_001155337.1|  rab GDP dissociation inhibitor beta                510   2e-172   
dbj|BAN38050.1|  rab GDP dissociation inhibitor alpha, putative         510   3e-172   
ref|XP_010846080.1|  PREDICTED: rab GDP dissociation inhibitor beta     510   3e-172   
dbj|BAN40148.1|  rab GDP dissociation inhibitor alpha, putative         510   3e-172   
dbj|BAN39838.1|  rab GDP dissociation inhibitor alpha, putative         510   3e-172   
dbj|BAN38914.1|  rab GDP dissociation inhibitor alpha, putative         510   3e-172   
ref|XP_005869567.1|  PREDICTED: rab GDP dissociation inhibitor beta     510   3e-172   
dbj|BAE29742.1|  unnamed protein product                                512   4e-172   
ref|XP_001829060.2|  RAB GDP-dissociation inhibitor                     510   4e-172   
dbj|BAE25494.1|  unnamed protein product                                512   4e-172   
gb|ENN81299.1|  hypothetical protein YQE_02302                          509   4e-172   
gb|ETN60099.1|  rab gdp-dissociation inhibitor                          509   5e-172   
ref|XP_007120069.1|  PREDICTED: rab GDP dissociation inhibitor alpha    516   5e-172   
gb|KFB52589.1|  AGAP010025-PA-like protein                              509   5e-172   
ref|XP_005614707.1|  PREDICTED: rab GDP dissociation inhibitor al...    509   5e-172   
ref|XP_007889014.1|  PREDICTED: rab GDP dissociation inhibitor beta     509   6e-172   
ref|XP_005320365.1|  PREDICTED: rab GDP dissociation inhibitor be...    509   6e-172   
ref|XP_007265419.1|  rab GTPase activator                               509   7e-172   
dbj|BAN37793.1|  rab GDP dissociation inhibitor alpha, putative         509   7e-172   
emb|CDS30282.1|  rab gdp dissociation inhibitor                         509   8e-172   
ref|XP_002433122.1|  Rab GDP dissociation inhibitor alpha, putative     509   8e-172   
ref|XP_319173.1|  AGAP010025-PA                                         509   1e-171   
ref|XP_001374514.1|  PREDICTED: rab GDP dissociation inhibitor beta     508   1e-171   
ref|XP_001865392.1|  rab gdp-dissociation inhibitor                     508   1e-171   
ref|XP_003978432.1|  PREDICTED: rab GDP dissociation inhibitor be...    508   2e-171   
ref|XP_004588549.1|  PREDICTED: rab GDP dissociation inhibitor be...    508   2e-171   
ref|XP_002920392.1|  PREDICTED: rab GDP dissociation inhibitor be...    508   2e-171   
ref|XP_006189977.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    508   2e-171   
dbj|BAN37800.1|  rab GDP dissociation inhibitor alpha, putative         508   2e-171   
gb|ERE63095.1|  rab GDP dissociation inhibitor alpha-like protein       508   2e-171   
ref|XP_008032590.1|  rab GDP-dissociation inhibitor                     508   2e-171   
ref|XP_006739409.1|  PREDICTED: rab GDP dissociation inhibitor alpha    508   2e-171   
gb|KDE08984.1|  secretory pathway GDP dissociation inhibitor 1          508   2e-171   
ref|XP_007860916.1|  rab GTPase activator                               508   3e-171   
ref|XP_004691279.1|  PREDICTED: rab GDP dissociation inhibitor be...    508   3e-171   
ref|XP_008399744.1|  PREDICTED: rab GDP dissociation inhibitor be...    508   3e-171   
ref|XP_008707437.1|  PREDICTED: rab GDP dissociation inhibitor alpha    507   4e-171   
ref|XP_006815070.1|  PREDICTED: LOW QUALITY PROTEIN: rab GDP diss...    507   4e-171   
emb|CDP98308.1|  Protein BM-GDI-1, isoform b                            507   4e-171   
gb|EFB13348.1|  hypothetical protein PANDA_019987                       507   4e-171   
emb|CDQ58199.1|  unnamed protein product                                507   5e-171   
ref|XP_007312808.1|  hypothetical protein SERLADRAFT_376219             507   5e-171   
ref|XP_005965191.1|  PREDICTED: rab GDP dissociation inhibitor alpha    506   6e-171   
ref|XP_007465883.1|  PREDICTED: rab GDP dissociation inhibitor be...    507   7e-171   
ref|XP_002721737.1|  PREDICTED: rab GDP dissociation inhibitor beta     506   9e-171   
ref|XP_005808195.1|  PREDICTED: rab GDP dissociation inhibitor be...    506   9e-171   
gb|KDQ30958.1|  hypothetical protein PLEOSDRAFT_1054110                 506   1e-170   
ref|XP_001873345.1|  predicted protein                                  506   1e-170   
gb|KFO34522.1|  Rab GDP dissociation inhibitor beta                     513   1e-170   
ref|XP_004319581.1|  PREDICTED: rab GDP dissociation inhibitor alpha    506   2e-170   
ref|XP_008547480.1|  PREDICTED: rab GDP dissociation inhibitor alpha    506   2e-170   



>ref|XP_006344947.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/440 (96%), Positives = 431/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLTRVTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDKPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSD+YLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFFE YDRFEPVNEPSLDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQVDEIFFEAYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_004251972.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/440 (95%), Positives = 431/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLTRVTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDKPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSD+YLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFFE YDRFEPVNEPSLDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQVDEIFFEAYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|NP_001274860.1| rab GDP dissociation inhibitor alpha-like [Solanum tuberosum]
 gb|ABB87112.1| GDP dissociation inhibitor 1-like [Solanum tuberosum]
Length=444

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/440 (95%), Positives = 431/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLTRVTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDKPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLSKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSD+YLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFFE YDRFEPVNEPSLDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQVDEIFFEAYDRFEPVNEPSLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_009629496.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana tomentosiformis]
Length=444

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/440 (95%), Positives = 430/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPP++
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPSQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVY+KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPAVDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG +DEIFFE YDRFEPVNEPSLDNCFISTSYD TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQIDEIFFEAYDRFEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_009620915.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Nicotiana tomentosiformis]
 ref|XP_009757991.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
 gb|AAB80717.1| GDP dissociation inhibitor [Nicotiana tabacum]
Length=444

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/440 (95%), Positives = 430/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRD+NVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDFNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GMDLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPAQDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELK G++LLGPVDEIF+ETYDR EPVNEPSLDNCFISTSYD+TTHFESTVDDVL +YT 
Sbjct  365   SELKQGVNLLGPVDEIFYETYDRSEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_009784522.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nicotiana sylvestris]
Length=444

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/440 (95%), Positives = 428/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPPQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANG+LVRVLIHTDVTKYLYFKAVDGSFVY+KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGSLVRVLIHTDVTKYLYFKAVDGSFVYSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EP LDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPVLDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVCGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFFE YDRFEPVNEPSLDNCFISTSYD TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQVDEIFFEAYDRFEPVNEPSLDNCFISTSYDPTTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>gb|AAW78520.1| GDP dissociation inhibitor 1 [Solanum chilense]
Length=444

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/440 (95%), Positives = 430/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLTRVTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTRVTARELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELP+AFARLSAV
Sbjct  185   GHALALHRDDRYLDKPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPRAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKV+FDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARA+AI
Sbjct  245   YGGTYMLNKPECKVDFDEEGKVCGVTSEGETAKCKKVVCDPSYLNNKVRKVGKVARAVAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSD+YLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDLYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFFE YDRFEPV EPSLDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   SELKPGIDLLGQVDEIFFEAYDRFEPVIEPSLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>gb|ACN65853.1| Rab GDP dissociation inhibitor [Nicotiana benthamiana]
Length=444

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/440 (94%), Positives = 429/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRD+NVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV KVPATDME
Sbjct  65    LGSSRDFNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVRKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GMDLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPAQDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SEL+ G++LLGPVDEIF+ETYDR EPVNEPSLDNCFISTSYD+TTHFESTVDDVL +YT 
Sbjct  365   SELEQGVNLLGPVDEIFYETYDRSEPVNEPSLDNCFISTSYDATTHFESTVDDVLNLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_006478491.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO49750.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=444

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/440 (92%), Positives = 431/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG+++PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHP+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIF++ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   TELKPGIDLLGPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_011074023.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Sesamum indicum]
Length=444

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/440 (93%), Positives = 428/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPK+IMANG LVRVLIHTDVTKYLYFKAVDGSFVYN+GK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKYIMANGELVRVLIHTDVTKYLYFKAVDGSFVYNRGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNE DPKTH+G+DLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNECDPKTHEGLDLTRVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKRIKLY++SLARF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRIKLYADSLARFAGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEF+EEG+V GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPDCKVEFNEEGQVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFF+TYDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVDEIFFDTYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_006441986.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
 gb|ESR55226.1| hypothetical protein CICLE_v10020158mg [Citrus clementina]
Length=444

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/440 (92%), Positives = 430/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG+++PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLSNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHP+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIF++ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   TELKPGIDLLGPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_008394248.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/440 (92%), Positives = 427/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE  SLNLVQLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDYNE+DPKTH+GM+LTRVT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYNETDPKTHEGMNLTRVTTRDLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVST+AETDHPE
Sbjct  305   MSHPIPNTNESHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDEIFFE YDR+EPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELRPGIDLLGPVDEIFFEMYDRYEPVNEPTLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_007026461.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
 gb|EOY06963.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
1 [Theobroma cacao]
Length=444

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 430/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V++KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E DPKTH+GMDL RVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDEKDPKTHEGMDLARVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDDCYL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDCYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV+GVTSEGETA+CKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGR+SDMY+FCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   TELRPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_011014748.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Populus euphratica]
Length=444

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/440 (91%), Positives = 429/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQ+Y ++DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQNYEDNDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKVAGVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVAGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   TELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_004244786.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Solanum lycopersicum]
Length=444

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/440 (93%), Positives = 426/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRF+GSDKPPAE
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFKGSDKPPAE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLT+VT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTKVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRKV KVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDAEGKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVSKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT++SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTSESHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+ LLGPVDEI +ETYDR EPVNE +LDNCF+STSYD+TTHFESTVDDVL +YT 
Sbjct  365   NELKPGVSLLGPVDEIVYETYDRSEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_006351084.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=444

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/440 (93%), Positives = 427/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRF+GSDKPPAE
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFKGSDKPPAE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYL FKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLSFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY ESDPKTH+GMDLT+VT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYKESDPKTHEGMDLTKVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPAVDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT++SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPNTSESHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+ LLGPVDEI +ETYDR EPVNE +LDNCF+STSYD+TTHFESTVDDVL +YT 
Sbjct  365   NELKPGVSLLGPVDEIVYETYDRSEPVNECTLDNCFVSTSYDATTHFESTVDDVLNLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>gb|EYU22361.1| hypothetical protein MIMGU_mgv1a006444mg [Erythranthe guttata]
Length=444

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/440 (93%), Positives = 423/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSDKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPPQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPK+IMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GM+LT VT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMNLTTVTTRQLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL RDD YL+EPA+DTVKR+KLY+ESLARF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALQRDDRYLDEPAIDTVKRMKLYAESLARFAGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLSNKVRKVGKVARAIVI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTND HS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDCHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFIS SYD+TTHFESTV DVL MYTL
Sbjct  365   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISASYDATTHFESTVVDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_008354312.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Malus domestica]
Length=444

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/440 (92%), Positives = 426/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE  SLNLVQLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKF +YVQDY+E+DPKTH+GMDLTRVT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFILYVQDYSETDPKTHEGMDLTRVTTRDLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVST+AETDHPE
Sbjct  305   MSHPIPNTNESHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFFETYDR+EPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVDEIFFETYDRYEPVNEPALDNCFISTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_011004551.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Populus euphratica]
Length=444

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 429/440 (98%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQ+Y ++DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQNYEDNDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLHEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKVAGVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVAGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   TELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_007026462.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
 gb|EOY06964.1| Guanosine nucleotide diphosphate dissociation inhibitor 1 isoform 
2 [Theobroma cacao]
Length=445

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/441 (91%), Positives = 430/441 (98%), Gaps = 1/441 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V++KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E DPKTH+GMDL RVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDEKDPKTHEGMDLARVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELP-QAFARLSA  858
             GHALALHRDDCYL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELP QAFARLSA
Sbjct  185   GHALALHRDDCYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLNKPECKVEFD+EGKV+GVTSEGETA+CKKVVCDPSYLP KVRK+G+VARAIA
Sbjct  245   VYGGTYMLNKPECKVEFDDEGKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGRVARAIA  304

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIPNTNDSHSVQIILPQKQLGR+SDMY+FCCSY+HNVAPKGKFIAFVSTEAETDHP
Sbjct  305   IMSHPIPNTNDSHSVQIILPQKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHP  364

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E+EL+PGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT
Sbjct  365   ETELRPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYT  424

Query  317   LITGKVLDLNVDLSAASAAEE  255
             +ITGKVLDL+VDLSAASAAEE
Sbjct  425   MITGKVLDLSVDLSAASAAEE  445



>gb|KDP45816.1| hypothetical protein JCGZ_17423 [Jatropha curcas]
Length=444

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 426/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE+ SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGEAASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLN+PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNDPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKV GVTSEGETA+CKKVVCDPSY+P KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVCGVTSEGETARCKKVVCDPSYMPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVS+EAETDHPE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF+E YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MY+L
Sbjct  365   VELKPGIDLLGPVDEIFYEIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKELDLSVDLSAASAAEE  444



>gb|AHF81486.1| small GTP Rab-GDI [Mangifera indica]
Length=444

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/440 (92%), Positives = 425/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG++ PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGNEPPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGGLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E DPKTH+GMDLTRVT KELI K+GLDDN +DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDEKDPKTHEGMDLTRVTTKELIAKYGLDDNAIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLQEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYLPGKVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVWGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPSTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FFE  DR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   AELRPGIDLLGPVDEMFFEVLDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_006372308.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|ABK93982.1| unknown [Populus trichocarpa]
 gb|ABK95445.1| unknown [Populus trichocarpa]
 gb|ERP50105.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/440 (91%), Positives = 427/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDG +V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+Y +SDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYEDSDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKVAGVTSEGETAKCKKVVCDPSYLP K RKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVAGVTSEGETAKCKKVVCDPSYLPNKARKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASAAEE
Sbjct  425   ITGKVVDLSVDLSAASAAEE  444



>gb|KHG05683.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=444

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 426/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGNDKPPAN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E DPKTH+GMDLTRV  + LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDEKDPKTHEGMDLTRVPTRALIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVE+DEEGKV GVTSEGETA+CKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEYDEEGKVCGVTSEGETARCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGP DEIFF+ YDR++PVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGPFDEIFFDIYDRYKPVNEPSLDNCFISTSYDATTHFESTVSDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|NP_001266078.1| rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
 emb|CAA06731.1| GDP dissociation inhibitor [Cicer arietinum]
Length=444

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/440 (92%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYN+DM PKFIMANG LVRVLIHTDVTKYLYFKAVDGSFV+NKGKVHKVP+ DME
Sbjct  65    LGSSKDYNIDMNPKFIMANGMLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPSNDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVT KELI KFGLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GV+SEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDGEGKVLGVSSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDRFEPVNEP+LDNCF+STSYD+TTHFESTV DVL MYTL
Sbjct  365   IELKPGIDLLGPVDEIFFDMYDRFEPVNEPTLDNCFVSTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAA AAEE
Sbjct  425   ITGKVLDLSVDLSAAGAAEE  444



>ref|XP_002513702.1| protein with unknown function [Ricinus communis]
 gb|EEF48649.1| protein with unknown function [Ricinus communis]
Length=444

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/440 (91%), Positives = 423/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES SLNL QLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESASLNLNQLWKRFRGSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP K RKV +VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKARKVSRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGR+SDMYLFCCSY+HNVAPKGK+IAFVS+EAETD+PE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKYIAFVSSEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFFE YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MY++
Sbjct  365   VELKPGIDLLGPVDEIFFEVYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYSM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_008243091.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Prunus mume]
Length=444

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/440 (91%), Positives = 425/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE  SLNLVQLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDYNESDPKTH+GMDL RVT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYNESDPKTHEGMDLRRVTTRDLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPAL+TVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALETVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF++EGKV GVTSEGETA+C KVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNDEGKVIGVTSEGETARCTKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPV+EIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVEEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_009366269.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Pyrus x bretschneideri]
Length=444

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/440 (91%), Positives = 426/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLH+DRNDYYGGE  SLNLVQLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHIDRNDYYGGECASLNLVQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKF +YVQDY+E+DPKT++GMDLTRVT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFILYVQDYSETDPKTYEGMDLTRVTTRDLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGK+ GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKIIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVST+AETDHPE
Sbjct  305   MSHPIPNTNESHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTDAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFFETYDR+EPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVDEIFFETYDRYEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_002280606.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Vitis vinifera]
 emb|CAN70679.1| hypothetical protein VITISV_044153 [Vitis vinifera]
 emb|CBI24770.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/440 (90%), Positives = 427/440 (97%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRF+G+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFKGNDKPPAS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPA D+E
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQDY+E+DP+TH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQDYDENDPRTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDDCYLNEPA+DTVKR+KLYSES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAIALHRDDCYLNEPAIDTVKRMKLYSESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGK  GVTSEGETA+CKKVVCDPSYLP KVRKVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDEEGKAVGVTSEGETARCKKVVCDPSYLPNKVRKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTSDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDEIF++ Y+RFEPVNEPSLD CFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGPVDEIFYDIYERFEPVNEPSLDQCFISTSYDATTHFESTVMDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_010251442.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
 ref|XP_010251443.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 424/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVVVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVFGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY HNVAPKGKFIAFV+TEAET+ PE
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYAHNVAPKGKFIAFVTTEAETNQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDEIFFDVYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             I GKVLDL VDLSAASAAEE
Sbjct  425   IIGKVLDLGVDLSAASAAEE  444



>ref|XP_007202054.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
 gb|EMJ03253.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica]
Length=444

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/440 (91%), Positives = 423/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE  SLNLVQLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDYNE+DPKTH+GMDL RVT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYNETDPKTHEGMDLRRVTTRDLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPAL+TVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLEEPALETVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF++EGKV GVTSEGETA+C KVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNDEGKVIGVTSEGETARCTKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPV+EIFF+ YDR+ PVNEPSLDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVEEIFFDIYDRYLPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_011074031.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Sesamum indicum]
Length=444

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/440 (91%), Positives = 424/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDMIPK+IMANG LVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGASRDYNVDMIPKYIMANGELVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNES+PKTH+GMDLT+VT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESEPKTHEGMDLTKVTTRQLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESL RF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLLRFAGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDGDGKACGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPSTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFFETYDR+EPVNEP  DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   TELKPGIDLLGPVDEIFFETYDRYEPVNEPGQDNCFISTSYDATTHFESTVVDVLNLYTS  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>emb|CDP11069.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/440 (92%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWK+FRGSD PP+ 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKKFRGSDNPPSN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKFIMANGALVRVLIHTDVTKYLYFKAVDGS+VY+KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMMPKFIMANGALVRVLIHTDVTKYLYFKAVDGSYVYSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQ YNE+DPKTH+GMDLTRVT +E I KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQAYNENDPKTHEGMDLTRVTTREFIAKFGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+RDD YL+EPALDTVKR+KLY ESLARF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALYRDDHYLDEPALDTVKRVKLYEESLARFGGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GV SEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVMGVASEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGR+SDMY+FC SY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRRSDMYVFCSSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD TTHFESTV DVL MYT+
Sbjct  365   TELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDPTTHFESTVVDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDLSAASAAEE
Sbjct  425   ITGKVLDLNVDLSAASAAEE  444



>ref|XP_002310371.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
 gb|EEE90821.1| GDP dissociation inhibitor family protein [Populus trichocarpa]
Length=444

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHT+VTKYLYFKAVDGSFV NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTNVTKYLYFKAVDGSFVLNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARK FIYV +Y ESDPKTH+GMDLTRVT +ELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKLFIYVHNYEESDPKTHEGMDLTRVTTRELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YLNEPALDTV R+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHRDDRYLNEPALDTVMRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLLNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_003531293.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
 gb|KHN48088.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=444

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYN+DM PKFIMANG LVRVLIHTDVTKYL FKAVDGSFV+NKGKVHKVPA DME
Sbjct  65    LGASRDYNIDMNPKFIMANGNLVRVLIHTDVTKYLSFKAVDGSFVFNKGKVHKVPANDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+YNESDPKTH+GMDLTRVT KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHSDDRYLAEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLPGKVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPSTDDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEP+LDNCF+STSYD+TTHFESTVDDVL MYTL
Sbjct  365   IELKPGIDLLGPVDEIFFDIYDRYEPVNEPTLDNCFVSTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASAAEE
Sbjct  425   ITGKVIDLSVDLSAASAAEE  444



>ref|NP_001276273.1| rab GDP dissociation inhibitor alpha-like [Glycine max]
 gb|ACU21333.1| unknown [Glycine max]
Length=444

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYN+DM PKFIMANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPA DME
Sbjct  65    LGASRDYNIDMNPKFIMANGNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+YNESDPKTH+GMDLTRVT KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHSDDRYLAEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLPGKVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPSTDDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
               LKPGIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   IGLKPGIDLLGPVDEIFFDIYDRYEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASAAEE
Sbjct  425   ITGKVIDLSVDLSAASAAEE  444



>ref|XP_003629947.1| Rab GDP dissociation inhibitor [Medicago truncatula]
 gb|AET04423.1| GDP dissociation inhibitor [Medicago truncatula]
 gb|AFK41459.1| unknown [Medicago truncatula]
Length=444

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/440 (91%), Positives = 418/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKEC+LSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FRG DKPP  
Sbjct  5     YDVIVLGTGLKECVLSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYN+DM PKFIMANG LVRVLIHTDVTKYLYFKAVDGSFV+NK KVHKVP+ DME
Sbjct  65    LGSSKDYNIDMNPKFIMANGTLVRVLIHTDVTKYLYFKAVDGSFVFNKAKVHKVPSNDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVT KELI KFGLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD++GKV GVTSEGETAKCKK+VCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDQGKVIGVTSEGETAKCKKLVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMYLFCCSY+HNV PKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDRFEPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   IELKPGIDLLGPVDEIFFDMYDRFEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL VDLSAASAAEE
Sbjct  425   ITGKVLDLTVDLSAASAAEE  444



>ref|XP_011005244.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
 ref|XP_011005245.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Populus euphratica]
Length=444

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/440 (91%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTDVTKYLYFKAVDGSYVLNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARK FIYV +Y ESDPKTH+GMDLTRVT +ELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKLFIYVHNYEESDPKTHEGMDLTRVTTRELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YLNEPALDTV R+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHRDDRYLNEPALDTVMRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKVAGVTSEG TAKCKKVVCDPSYL  KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVAGVTSEGATAKCKKVVCDPSYLLNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>gb|ABU98948.1| GDP-dissociation inhibitor [Lupinus albus]
Length=444

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/440 (90%), Positives = 420/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGL ECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLXECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDGSFV+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+ESDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDESDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YLNEPALDTVKR+KLY+ESLARFQGGS YIYPLYGLGELPQ F RLSAV
Sbjct  185   GHAIALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSSYIYPLYGLGELPQGFVRLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKV+FDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVKFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIVI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS EAET HPE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETGHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDEIF++ YDR+EPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   SELKPGIDLLGPVDEIFYDIYDRYEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>emb|CAF02075.1| GDP dissociation inhibitor [Medicago truncatula]
Length=444

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/440 (91%), Positives = 417/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKEC+LSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FRG DKPP  
Sbjct  5     YDVIVLGTGLKECVLSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYN+DM PKFIMANG LVRVLIHTDVTKYLYFKAVDGSFV+NK KVHKVP+ DME
Sbjct  65    LGSSKDYNIDMNPKFIMANGTLVRVLIHTDVTKYLYFKAVDGSFVFNKAKVHKVPSNDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVT KELI KFGLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTTKELIAKFGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD++GKV GVTSEGETAKCKK+VCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDQGKVIGVTSEGETAKCKKLVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMYLFCCSY+HNV PKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYLFCCSYSHNVCPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDRFEPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   IELKPGIDLLGPVDEIFFDMYDRFEPVNEPTLDNCFISTSYDATTHFESTVLDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL VDLS ASAAEE
Sbjct  425   ITGKVLDLTVDLSVASAAEE  444



>ref|XP_008441682.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Cucumis melo]
Length=444

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/440 (90%), Positives = 424/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGS+VYNKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFKAVDGSYVYNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQDY+ES+PKTH+GMDLTRVT KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQDYDESNPKTHEGMDLTRVTTKELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+ PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDLPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVIGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSH IPNTNDSHSVQII+PQKQLGR+SDMY+FCCSY+HNVAP+GKFIAFV+TEAETDHPE
Sbjct  305   MSHTIPNTNDSHSVQIIIPQKQLGRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG +DEIFF+TYDR+EPVNEPSLDNCFIS SYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGAIDEIFFDTYDRYEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKAVDLSVDLSAASAAEE  444



>ref|XP_004287194.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/440 (90%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGE  SLNL+QLWKRFRG DKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLIQLWKRFRGDDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDG FVYNKGKVHKVPA DME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLSFKAVDGGFVYNKGKVHKVPANDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDYNESDP+TH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYNESDPRTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKV GVTSEGETAKC KVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVIGVTSEGETAKCTKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTND HSVQ+ILPQKQLGR+SDMYLFC SY+HNVAPKGKFIAFVSTEAETD+P+
Sbjct  305   MSHPIPNTNDCHSVQVILPQKQLGRRSDMYLFCSSYSHNVAPKGKFIAFVSTEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPV+EIFF+ YDR+EPVNEP LDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   TELKPGIDLLGPVEEIFFDIYDRYEPVNEPVLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_009410720.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/440 (90%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDMIPKF+MANG LVR LIHTDVTKYL FKAVDGS+V+NKGK+HKVPATDME
Sbjct  65    LGASRDYNVDMIPKFMMANGILVRTLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRRARKFFIYVQDY+E+DPKTH+G+DLTRVT KELI K+GLDDNT+DFI
Sbjct  125   ALRSPLMGLFEKRRARKFFIYVQDYDENDPKTHEGLDLTRVTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLYEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGK  GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKACGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT++SHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD P+
Sbjct  305   MSHPIPNTDESHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPD  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FFETYDR+EPVNEPSLD+CFIS SYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDELFFETYDRYEPVNEPSLDHCFISASYDATTHFESTVTDVLSMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_009404932.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/440 (90%), Positives = 419/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRN+YYGGESTSLNL+QLWKRFRGSDKPPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNEYYGGESTSLNLIQLWKRFRGSDKPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVR LIHTDVTKYL FKAVDGS+V+NKGK+HKVPATDME
Sbjct  65    LGPSRDYNVDMIPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+Y+ESDPKTH+G+DLTRVT KE I KFGLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYDESDPKTHEGLDLTRVTTKEFISKFGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKRIKLY ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRIKLYEESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNK ECKVEFD EGK  GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKLECKVEFDMEGKACGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT++SHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MSHPIPNTDESHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FFETYD +EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDELFFETYDIYEPVNEPSLDNCFISTSYDATTHFESTVMDVLSMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKTLDLSVDLSAASAAEE  444



>ref|XP_010277857.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Nelumbo nucifera]
Length=444

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/440 (89%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKF +YVQDYNE+DPKTH+GMDLTRVT +ELI K+GLD NTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFLLYVQDYNENDPKTHEGMDLTRVTTRELIAKYGLDGNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVYGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHS Q+ILPQ+QLGR+SDMYLFC SY HNVAPKGKFIAFV+TEAET+ PE
Sbjct  305   MSHPIPNTSDSHSAQVILPQEQLGRRSDMYLFCSSYAHNVAPKGKFIAFVTTEAETNQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGP+DEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPIDEIFFDVYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLS+ASAAEE
Sbjct  425   ITGKVLDLSVDLSSASAAEE  444



>ref|XP_004138948.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 ref|XP_004168317.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN61451.1| hypothetical protein Csa_2G123620 [Cucumis sativus]
Length=444

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/440 (90%), Positives = 422/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGDDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGS+VYNKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFKAVDGSYVYNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQDY+ES+PKTH+GMDL RVT KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQDYDESNPKTHEGMDLARVTTKELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+ PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDLPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVIGVTSEGETAKCKKVVCDPSYLSNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSH IPNTNDSHSVQII+PQKQLGR+SDMY+FCCSY+HNVAP+GKFIAFV+TEAETDHPE
Sbjct  305   MSHTIPNTNDSHSVQIIIPQKQLGRRSDMYVFCCSYSHNVAPRGKFIAFVTTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIFF+TYDR+EPVNEPSLDNCFIS SYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGAVDEIFFDTYDRYEPVNEPSLDNCFISMSYDATTHFESTVVDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKAVDLSVDLSAASAAEE  444



>ref|XP_008812865.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Phoenix dactylifera]
Length=444

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/440 (91%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPAN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKFIMANG LVRVLIHTDVTKYL FKAVDGS+V+NKGK+HKVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFIMANGTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDIE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPKTH G+DLTRVT +ELI K+GLDDNTVD I
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDVI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDVEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAP+GKFIAFVSTEAETD PE
Sbjct  305   MSHPIPNTDDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPRGKFIAFVSTEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FF+TYDRF PVNEPSLDNCFISTSYD+TTHFESTV DVL MY +
Sbjct  365   IELKPGIDLLGPVDELFFDTYDRFVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKNVDLSVDLSAASAAEE  444



>ref|XP_007159565.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
 gb|ESW31559.1| hypothetical protein PHAVU_002G248100g [Phaseolus vulgaris]
Length=445

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/440 (90%), Positives = 420/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPPQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYN+DM PKFIMANG LVRVLIHTDVTKYL FKAVDGS+V+NKGKVHKVP+ DME
Sbjct  65    LGASRDYNIDMNPKFIMANGNLVRVLIHTDVTKYLSFKAVDGSYVFNKGKVHKVPSNDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+YN SDPK H+GMDLTRVT KELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYNVSDPKAHEGMDLTRVTTKELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLTEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVIGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVS+EAETD P 
Sbjct  305   MSHPIPSTDDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSSEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFIS SYD+TTHFESTVDDVL MYT+
Sbjct  365   IELKPGIDLLGPVDEIFFDIYDRYEPVNEPALDNCFISMSYDATTHFESTVDDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASAAEE
Sbjct  425   ITGKVIDLSVDLSAASAAEE  444



>ref|XP_010672532.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/440 (89%), Positives = 424/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTS+NL+QLWKRFRG+D+P A+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSINLIQLWKRFRGNDQPSAD  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKFIMANGALVRVLIHTDVTKYL FKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGPSRDYNVDMMPKFIMANGALVRVLIHTDVTKYLSFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQD+ ES+PKTH+G+DLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQDFEESNPKTHEGLDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDAEGKVVGVTSEGETAKCKKVVCDPSYLTNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHSVQIILPQKQLGR+SDMY+FCCSYTHNVAPKGKFIAFVSTEAETD+P+
Sbjct  305   MSHPIPSTNDSHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDE+FF+ YDR+EPVNEPSLDNCFISTSYD TTHFESTV DVL MYT+
Sbjct  365   TELKAGIDLLGPVDEMFFDIYDRYEPVNEPSLDNCFISTSYDGTTHFESTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDLNVDL+AASAAEE
Sbjct  425   ITGKVLDLNVDLNAASAAEE  444



>ref|XP_008801341.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Phoenix dactylifera]
Length=444

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/440 (89%), Positives = 423/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRF+G+D PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFQGNDSPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRRARKFFIYVQDY+E+DPKTH G+DLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALRSPLMGLFEKRRARKFFIYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GV+SEGETA+CKKVVCDPSYLP KV+KVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVSSEGETARCKKVVCDPSYLPNKVKKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAET+ P+
Sbjct  305   MSHPIPNTDDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+TYDR EPVNEP LDNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   VELKPGIDLLGPVDEIFFDTYDRCEPVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTIDLSVDLSAASAAEE  444



>ref|XP_008788293.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Phoenix dactylifera]
Length=444

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/440 (90%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRGSDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGSDKPPTH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+NKGK+HKVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDIE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPKTH+G+DLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKTHEGLDLTRVTTRELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDVEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+ SHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPNTDGSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FF+TYDRF PVNEPSLDNCFISTSYD TTHFESTV DVL MY +
Sbjct  365   MELKPGIDLLGPVDELFFDTYDRFVPVNEPSLDNCFISTSYDGTTHFESTVMDVLHMYRM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKDVDLSVDLSAASAAEE  444



>ref|XP_010067212.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Eucalyptus grandis]
Length=444

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/440 (88%), Positives = 424/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSV+GLKVLHMDRNDYYGGESTSLNLVQLWK+FR SDKPPA 
Sbjct  5     YDVVVLGTGLKECILSGLLSVNGLKVLHMDRNDYYGGESTSLNLVQLWKKFRNSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVT+YLYFKAVDGS+V++KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTRYLYFKAVDGSYVFSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL++PLMG+F+KRRARKFFIYVQDY+E+DPKTH+GMDLT +T +ELI K+GLDDNT+DFI
Sbjct  125   ALQTPLMGMFQKRRARKFFIYVQDYDENDPKTHEGMDLTLLTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YLNEPALDTVKR+KLY+ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAMALHRDDRYLNEPALDTVKRMKLYAESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF++EG+V GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAI+I
Sbjct  245   YGGTYMLNKPECKVEFNDEGQVIGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAISI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIPNTNDSHSVQ+I+PQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS EAETD PE
Sbjct  305   MGHPIPNTNDSHSVQVIIPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG+DLLGPVDEIF++TYDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  365   IELKPGLDLLGPVDEIFYDTYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_010907542.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Elaeis guineensis]
Length=444

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/440 (89%), Positives = 421/440 (96%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSD PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDMPPAN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+NKGK+HKVPATDME
Sbjct  65    LGPSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRRARKFFIYVQDY+E+DPKTH G+DLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALRSPLMGLFEKRRARKFFIYVQDYDENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPKCKVEFDVEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS+EAETD PE
Sbjct  305   MSHPIPNTDDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSSEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FF+TYDRFEPVNEPSLDNCFISTSYD+TTHFESTV DVL MY +
Sbjct  365   IELKPGIDLLGPVDELFFDTYDRFEPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLS ASAAEE
Sbjct  425   ITGKNVDLSVDLSVASAAEE  444



>ref|XP_010101313.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88260.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=452

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/448 (88%), Positives = 424/448 (95%), Gaps = 8/448 (2%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRG+D PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLNQLWKRFRGNDSPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRAR--------KFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGL  1059
             ALKSPLMGIFEKRRAR        KFFIYVQDY+E+DPKTHDG DLTRVT +EL+ K+GL
Sbjct  125   ALKSPLMGIFEKRRARNHYKRRARKFFIYVQDYDENDPKTHDGFDLTRVTTRELVSKYGL  184

Query  1058  DDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQ  879
             DDNT+DFIGHA+ALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ
Sbjct  185   DDNTLDFIGHAIALHRDDRYLNEPALDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQ  244

Query  878   AFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVG  699
             AFARLSAVYGGT MLNKPECKVEF+EEGKV GVTSEGETA+CKKVVCDPSYLP KVRKVG
Sbjct  245   AFARLSAVYGGTCMLNKPECKVEFNEEGKVIGVTSEGETARCKKVVCDPSYLPNKVRKVG  304

Query  698   KVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVST  519
             KVARAIAIMSHPIPNTNDSHSVQ+ILPQKQLGR SDMYLFCCSY+HNVAPKGKFIAFVST
Sbjct  305   KVARAIAIMSHPIPNTNDSHSVQVILPQKQLGRISDMYLFCCSYSHNVAPKGKFIAFVST  364

Query  518   EAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVD  339
             EAETD+PE+ELKPG DLLGPVDEIF++ YDR+EPVNEP+LDNCFISTSYD+TTHFESTV 
Sbjct  365   EAETDNPETELKPGTDLLGPVDEIFYDMYDRYEPVNEPTLDNCFISTSYDATTHFESTVI  424

Query  338   DVLGMYTLITGKVLDLNVDLSAASAAEE  255
             DVL MYTLITGKV+DL+VDLSAASAAEE
Sbjct  425   DVLNMYTLITGKVVDLSVDLSAASAAEE  452



>ref|XP_010908336.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Elaeis guineensis]
Length=444

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/440 (90%), Positives = 419/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKA DGS+V+NKGK+HKVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFKAADGSYVFNKGKIHKVPATDIE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKF IYVQDY+E+DPKTH+G+DLTRVT + LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFIIYVQDYDENDPKTHEGLDLTRVTTRALISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDVEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKF+AFVSTEAETDHPE
Sbjct  305   MSHPIPNTDDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFVAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FFETYDR  PVNEPSLDNCFISTSYD+TTHFESTV DVL MY +
Sbjct  365   IELKPGIDLLGPVDELFFETYDRSVPVNEPSLDNCFISTSYDATTHFESTVMDVLHMYRM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKDVDLSVDLSAASAAEE  444



>ref|XP_006372309.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
 gb|ERP50106.1| hypothetical protein POPTR_0017s00420g [Populus trichocarpa]
Length=454

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/425 (91%), Positives = 412/425 (97%), Gaps = 0/425 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES SLNL+QLWKRFRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESASLNLIQLWKRFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYLYFKAVDG +V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFMMANGNLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+Y +SDPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYEDSDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKVAGVTSEGETAKCKKVVCDPSYLP K RKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVAGVTSEGETAKCKKVVCDPSYLPNKARKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T++SHSVQ+ILPQKQLGR+SDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIPSTDESHSVQVILPQKQLGRRSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   SELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTM  424

Query  314   ITGKV  300
             ITGKV
Sbjct  425   ITGKV  429



>ref|XP_006858694.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
 gb|ERN20161.1| hypothetical protein AMTR_s00066p00096020 [Amborella trichopoda]
Length=444

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/440 (88%), Positives = 417/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRN+YYGGESTSLNL QLWKRFRG +KPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNEYYGGESTSLNLNQLWKRFRGDEKPPVH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVRVLIHT+VTKYL FKAVDGS+V+NKGK+HKVPA D+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGTLVRVLIHTEVTKYLSFKAVDGSYVFNKGKIHKVPANDLE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFF+YVQDY E+DPKTHDGM+LTRVT +ELI KFGLDDNTVD I
Sbjct  125   ALKSPLMGIFEKRRARKFFMYVQDYEETDPKTHDGMNLTRVTTRELIAKFGLDDNTVDVI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PALDTVKR+KLYSES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDYYLDQPALDTVKRMKLYSESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEGKV+GVTSEGETA+CKKVVCDPSYLP KVRK+GKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFNEEGKVSGVTSEGETARCKKVVCDPSYLPNKVRKIGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSY+H VAPKGKFIAFV+ +AET+ PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYSHMVAPKGKFIAFVAADAETNKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+
Sbjct  365   IELKPGIDLLGPVDEIFFDVYDRYEPVNEPSLDNCFISTSYDATTHFESTVQDVLSMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>gb|ABK25073.1| unknown [Picea sitchensis]
 gb|ABR17192.1| unknown [Picea sitchensis]
 gb|ACN40669.1| unknown [Picea sitchensis]
Length=444

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/440 (89%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGGESTSLNL QLWK+FRG+DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGESTSLNLTQLWKKFRGNDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG+LVRVLIHTDVTKYLYFKAVDGS+VYNKGK++KVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGSLVRVLIHTDVTKYLYFKAVDGSYVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQ+Y+++DPKTHDGMDLTRVT +ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQNYDQNDPKTHDGMDLTRVTTRELIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPAL+TVK+IKLY ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLFEPALETVKKIKLYEESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETA+CKKVVCDPSYL  KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETARCKKVVCDPSYLTNKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQIILPQKQLGRKSDMY+FCCSY+HNVAPKGK+IAFVS EA+TD PE
Sbjct  305   MSHPIPNTNDSQSVQIILPQKQLGRKSDMYVFCCSYSHNVAPKGKYIAFVSAEADTDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+PGI LLGPVDE+FF+TYDRF PVNEPSLDNCFISTSYD+TTHFE+TV DVL MYT 
Sbjct  365   VELQPGIALLGPVDEMFFDTYDRFVPVNEPSLDNCFISTSYDATTHFETTVQDVLAMYTH  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL VDLSAASAAEE
Sbjct  425   ITGKVLDLTVDLSAASAAEE  444



>ref|XP_004962065.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=445

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/440 (87%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWK+FRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+ KF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVLKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FF+YVQ+YNE+DP TH G+DLTR+T +ELI K GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFVYVQNYNEADPVTHQGLDLTRITTRELISKHGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDDCYLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDCYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SEL+PGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT 
Sbjct  365   SELRPGIDLLGQVDELFFDMYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTA  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|NP_001055142.1| Os05g0304400 [Oryza sativa Japonica Group]
 dbj|BAF17056.1| Os05g0304400 [Oryza sativa Japonica Group]
 gb|EAY97451.1| hypothetical protein OsI_19382 [Oryza sativa Indica Group]
 dbj|BAG93308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63167.1| hypothetical protein OsJ_17976 [Oryza sativa Japonica Group]
Length=445

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/440 (88%), Positives = 417/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGSSKDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLNEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI +TNDSHSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVSTEAETD+P+
Sbjct  305   MSHPIASTNDSHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKAVDLSVDLSAASAAEE  444



>ref|XP_010526899.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Tarenaya hassleriana]
Length=444

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/440 (88%), Positives = 417/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG DK PA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVRVLIHTDVTKYL FKAVDGS+V+NKGK HKVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRVLIHTDVTKYLSFKAVDGSYVFNKGKTHKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E++PKTHDGMDL RVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDETNPKTHDGMDLNRVTTKELISKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH DD YL++PA+DTV R+KLYSESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHLDDRYLSQPAIDTVMRMKLYSESLARFQGSSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+DLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGVDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFETTVVDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASA+EE
Sbjct  425   ITGKVLDLSVDLSAASASEE  444



>ref|NP_001055566.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|AAU10789.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 gb|AAV25637.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF17480.1| Os05g0418000 [Oryza sativa Japonica Group]
 gb|EAY98071.1| hypothetical protein OsI_19989 [Oryza sativa Indica Group]
 gb|EEE63749.1| hypothetical protein OsJ_18568 [Oryza sativa Japonica Group]
Length=445

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/440 (88%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDY+E+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLNEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI NTNDSHSVQIILPQKQLGRKSDMY+F CSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIANTNDSHSVQIILPQKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>dbj|BAJ93199.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/440 (88%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWK+FRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRAR FFIYVQDYN++DPKTH G+DLTR+T +ELI K GL D+T+DFI
Sbjct  125   ALKSPLMGIFEKRRARNFFIYVQDYNDADPKTHQGLDLTRMTTRELIAKHGLSDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLSEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLANKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPN NDSHSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNANDSHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEPSL NCF+S+SYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGPVDELFFDMYDRYEPVNEPSLGNCFVSSSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_010524208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Tarenaya hassleriana]
Length=444

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/440 (88%), Positives = 418/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG DK PA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVRVLIHTDVTKYL FKAVDGS+V+NKGK+HKVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRVLIHTDVTKYLSFKAVDGSYVFNKGKIHKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH GMDL RVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHGGMDLNRVTTKELISKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YL++PALDTV R+KLY+ESLARFQGGSPY+YPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHRDDSYLSQPALDTVMRMKLYAESLARFQGGSPYLYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLADKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGRKSDMY+FCCSY+HNVAP+GKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRKSDMYVFCCSYSHNVAPRGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIFF+ YDR+EPVNEPSLDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGIDLLGPVDEIFFDIYDRYEPVNEPSLDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASA++E
Sbjct  425   ITGKVLDLSVDLSAASASDE  444



>ref|XP_006654412.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/440 (87%), Positives = 419/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDY+E+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLN+PA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLNDPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI +TN+SHSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIGSTNESHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+TYDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGPVDELFFDTYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_002439812.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
 gb|EES18242.1| hypothetical protein SORBIDRAFT_09g020540 [Sorghum bicolor]
Length=445

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/440 (86%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DP+TH G+DLTRVT +ELI K+GL D+TVDF+
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPRTHQGLDLTRVTTRELISKYGLSDDTVDFV  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAP+GKFIAFVS EAETD P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDSPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIF++ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGSVDEIFYDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_003568439.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brachypodium distachyon]
Length=445

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (87%), Positives = 415/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWK+FRG +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEEKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRRAR FFIYVQDYN++DPKTH G DLTR+T KELI K GL D+TVDFI
Sbjct  125   ALRSPLMGLFEKRRARNFFIYVQDYNDADPKTHQGCDLTRMTTKELIAKHGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPN N+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNANESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+S SYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGSVDELFFDMYDRYEPVNEPSLDNCFVSASYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|NP_001183437.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACR36809.1| unknown [Zea mays]
 gb|AFW81914.1| Rab GDP dissociation inhibitor alpha [Zea mays]
 gb|AFW81915.1| Rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/440 (86%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DP+TH G+DLTRVT +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPRTHQGLDLTRVTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAP+GKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEI ++ YDR+EPVNEPSLDNCF++TSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGSVDEILYDIYDRYEPVNEPSLDNCFVTTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_006654244.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=445

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/440 (87%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPA+DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLNEPAIDTVNRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI NTNDSHSVQIILPQKQLGRKSDMY+F CSYTHNVAPKGKFIAFVS EAETD+PE
Sbjct  305   MSHPIGNTNDSHSVQIILPQKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGPVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|NP_001151199.1| LOC100284832 [Zea mays]
 gb|ACF87775.1| unknown [Zea mays]
 gb|ACG41958.1| rab GDP dissociation inhibitor alpha [Zea mays]
Length=445

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (87%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++K K+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKRKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FF+YVQ+YNE+DP TH G+DLTR+T +ELI K GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFVYVQNYNEADPVTHQGLDLTRITTRELILKHGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDIEGKVCGVTSEGETAKCKKVVCDPSYLPSKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHS+QIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNESHSIQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR++PVNEPSLDNCF+S SYD+TTHFE+TV DVL MYT 
Sbjct  365   SELKPGIDLLGQVDELFFDMYDRYKPVNEPSLDNCFVSMSYDATTHFETTVTDVLSMYTA  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_008649650.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Zea mays]
 gb|AFW78025.1| hypothetical protein ZEAMMB73_176599 [Zea mays]
Length=445

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/440 (86%), Positives = 416/440 (95%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DP+TH G+DLTRVT +ELI K+GL D+TVDF+
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPRTHQGLDLTRVTTRELIAKYGLSDDTVDFV  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY++SLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYADSLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLQNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAP+GKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDEIF++ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGSVDEIFYDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>ref|XP_010067472.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X3 [Eucalyptus grandis]
Length=450

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/446 (86%), Positives = 417/446 (93%), Gaps = 6/446 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYG ESTSLNL+QLWK+FR SDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGAESTSLNLIQLWKKFRNSDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDG +V+NKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGMFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD +L+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRFLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEG+V GVTSEGETAKCKKVVCDPSYL  KVRK+GKV+RAI I
Sbjct  245   YGGTYMLNKPECKVEFNEEGQVIGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVSRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS EAETD PE
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDS------TTHFESTVDDV  333
              ELKPG+DLLGPVDEIF++TYDR+EPVNEPSLDNCFIST   +       + FESTV DV
Sbjct  365   IELKPGVDLLGPVDEIFYDTYDRYEPVNEPSLDNCFISTVTINYIDIMLISCFESTVMDV  424

Query  332   LGMYTLITGKVLDLNVDLSAASAAEE  255
             L MYT+ITGKVLDL+VDLSAASAAEE
Sbjct  425   LNMYTMITGKVLDLSVDLSAASAAEE  450



>gb|AAB69870.1| GDP dissociation inhibitor protein OsGDI1 [Oryza sativa]
Length=445

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/440 (87%), Positives = 413/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDY+E+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYDEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPA+DTVKR+KLY+ESL RFQGGSP IYPLYGLGELPQ FARL AV
Sbjct  185   GHALALHRDDRYLNEPAIDTVKRMKLYAESLPRFQGGSPSIYPLYGLGELPQGFARLRAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD EGKV GVTSEGE+AKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPDCKVEFDMEGKVCGVTSEGESAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI NTNDSHSVQIILPQKQLGRKSDMY+F CSYTHNVAPKGKFIAFVSTEAETDHPE
Sbjct  305   MSHPIANTNDSHSVQIILPQKQLGRKSDMYVFGCSYTHNVAPKGKFIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAEK  444



>ref|XP_004962068.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=445

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/440 (86%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPTH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DPKTH G+DLT VT +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPKTHQGLDLTMVTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLLNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAP+GKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPG+DLLG VDEIF++ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGLDLLGSVDEIFYDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKTVDLSVDLSAASAAEE  444



>gb|KHN06485.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=761

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/424 (92%), Positives = 407/424 (96%), Gaps = 0/424 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGDDKPPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYN+DM PKFIMANG LVRVLIHTDVTKYLYFKAVDGS+V+NKGKVHKVPA DME
Sbjct  65    LGASRDYNIDMNPKFIMANGNLVRVLIHTDVTKYLYFKAVDGSYVFNKGKVHKVPANDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+YNESDPKTH+GMDLTRVT KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQNYNESDPKTHEGMDLTRVTTKELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHSDDRYLAEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLPGKVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPGKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD P 
Sbjct  305   MSHPIPSTDDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDQPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFESTVDDVL MYTL
Sbjct  365   IELKPGIDLLGPVDEIFFDIYDRYEPVNEPTLDNCFISTSYDATTHFESTVDDVLNMYTL  424

Query  314   ITGK  303
             ITGK
Sbjct  425   ITGK  428



>dbj|BAK00943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/440 (86%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWK+FRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGSFV++KGK+HKVPATDME
Sbjct  65    LGSSKDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSFVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KSPLMG+FEKRRAR FFIYVQ+Y+E+DPKTH G+DLT +T KELI K GL D+TVDFI
Sbjct  125   AVKSPLMGLFEKRRARNFFIYVQNYDEADPKTHQGLDLTTLTTKELIAKHGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD +LNEPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRHLNEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFD EGK  GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAI
Sbjct  245   YGGTYMLCKPECKVEFDMEGKACGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR SDMY+FCCSYTHNVAPKGKFIAFVS EAE+D+ +
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEPSLDNCFISTSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGIDLLGPVDELFFDMYDRYEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL VDLSAASAAEE
Sbjct  425   ITGKAIDLTVDLSAASAAEE  444



>ref|XP_004288515.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/440 (87%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGKVHKVPA D+E
Sbjct  65    LGSSRDYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF+YVQD+ E+DPKTH+GMDLT+VTAKELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFLYVQDFEENDPKTHEGMDLTKVTAKELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPAL  VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDTYLEEPALAFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEFD  GKV GVTSEGETAKCKKVVCDPSYLP KV KVGKVARAI I
Sbjct  245   YGGTYMLSKPECKVEFDGSGKVIGVTSEGETAKCKKVVCDPSYLPDKVTKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV TEAETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG DLLGPVD+IFF+TYDR+EP N+   D+CFIS SYD+TTHFE+TV DV+ MY  
Sbjct  365   VELKPGTDLLGPVDDIFFDTYDRYEPTNQSEADHCFISGSYDATTHFETTVQDVIAMYGN  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL VDLSAASAAEE
Sbjct  425   ITGKVLDLTVDLSAASAAEE  444



>ref|XP_003568438.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Brachypodium distachyon]
Length=444

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/440 (87%), Positives = 411/440 (93%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGSFV++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSFVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+ EKRRAR FFIYVQDYNE+DPKTH G+DLT +T KELI K GL D+TVDFI
Sbjct  125   ALKSPLMGLLEKRRARNFFIYVQDYNEADPKTHKGLDLTVLTTKELITKHGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD +LNEPALDTVKR+KLYSESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRHLNEPALDTVKRMKLYSESLARFQGLSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT D+HSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVSTEAE+D   
Sbjct  305   MSHPIPNT-DAHSVQIILPQKQLGRKSDMYIFCCSYTHNVAPKGKFIAFVSTEAESDDIR  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SEL PG+DLLGP+DE+FF+ YDR+EPVNEPSLDNCFISTSYD+TTHFE+TV DVL MYT+
Sbjct  364   SELMPGVDLLGPIDELFFDMYDRYEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTM  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  424   ITGKTVDLSVDLSAASAAEE  443



>gb|ABR16699.1| unknown [Picea sitchensis]
Length=444

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/440 (86%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGGES SLNL QLWK+FR S  PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGESASLNLNQLWKKFRSSSSPPTH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM PKF+MANGALVRVLIHTDVTKYLYFKAVDGS+VYNKGK+HKVP TDME
Sbjct  65    LGSSRDYNVDMSPKFMMANGALVRVLIHTDVTKYLYFKAVDGSYVYNKGKIHKVPTTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQ+Y E+DPKTHDG+DLTR+TAKEL  K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQEYLETDPKTHDGLDLTRITAKELFTKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+RDD YL EPAL+TVKRIKL +ESLARFQGGSPYIYPLYGLGELPQAF+RLSAV
Sbjct  185   GHALALYRDDRYLCEPALETVKRIKLCAESLARFQGGSPYIYPLYGLGELPQAFSRLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKV FDEEGK  GVTSEGETA+CKKVVCDPSYLP KV+KVGKV+RAI I
Sbjct  245   YGGTYMLNKPDCKVTFDEEGKANGVTSEGETARCKKVVCDPSYLPNKVKKVGKVSRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQIILPQKQLGRKSDMY+FCCS++HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDSQSVQIILPQKQLGRKSDMYVFCCSHSHNVAPKGKYIAFVSTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+PG++LLG VDE+FF+TYD +EPVNEPSLDNCFIS SYD+TTHFE+TV DVL MYT 
Sbjct  365   KELQPGLNLLGAVDEMFFDTYDIYEPVNEPSLDNCFISKSYDATTHFETTVQDVLAMYTQ  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_010067325.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X1 [Eucalyptus grandis]
Length=444

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FR SDKPPA 
Sbjct  5     YDVVVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRNSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKFIMANGALVRVLIHTDVTKY+YFKAVDGS+V+NKGKVHKVPAT ME
Sbjct  65    LGSSRDYNVDMVPKFIMANGALVRVLIHTDVTKYMYFKAVDGSYVFNKGKVHKVPATAME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL++PLMG+FEK RARKFF YV DYNE+DP+TH+GMDLTRVT ++LI K+GL D+ ++FI
Sbjct  125   ALQTPLMGMFEKYRARKFFTYVHDYNENDPRTHEGMDLTRVTTRKLIAKYGLGDDAIEFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYEESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGG YMLNK ECKVEF++EG+V GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGIYMLNKRECKVEFNDEGQVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN S SVQ+I+PQ+QLGRKSDMYLFCCS +H VAPKGKFIAFVS EAETD PE
Sbjct  305   MSHPIPNTNYSQSVQVIIPQRQLGRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG++LLGPVDEIF++TYDR+EPVNE S+DNCFIS+SYD+TTHFESTV DVL MYT+
Sbjct  365   IELKPGVNLLGPVDEIFYDTYDRYEPVNESSVDNCFISSSYDATTHFESTVMDVLNMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>ref|XP_010067402.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like isoform X2 [Eucalyptus grandis]
 gb|KCW87998.1| hypothetical protein EUGRSUZ_A00407 [Eucalyptus grandis]
Length=444

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK+FR SDKPPA 
Sbjct  5     YDVVVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKKFRNSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKFIMANGALVRVLIHTDVTKY+YFKAVDGS+V+NKGKVHKVPAT ME
Sbjct  65    LGSSRDYNVDMVPKFIMANGALVRVLIHTDVTKYMYFKAVDGSYVFNKGKVHKVPATAME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL++PLMG+FEK RARKFF YV DYNE+DP+TH+GMDLTRVT ++LI K+GL D+ ++FI
Sbjct  125   ALQTPLMGMFEKYRARKFFTYVHDYNENDPRTHEGMDLTRVTTRKLIAKYGLGDDAIEFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY ES ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYEESFARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGG YMLNK ECKVEF++EG+V GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGIYMLNKRECKVEFNDEGQVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN S SVQ+I+PQ+QLGRKSDMYLFCCS +H VAPKGKFIAFVS EAETD PE
Sbjct  305   MSHPIPNTNYSQSVQVIIPQRQLGRKSDMYLFCCSNSHKVAPKGKFIAFVSAEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG++LLGPVDEIF++TYDR+EPVNE S+DNCFIS+SYD+TTHFESTV DVL MYT 
Sbjct  365   IELKPGVNLLGPVDEIFYDTYDRYEPVNESSVDNCFISSSYDATTHFESTVKDVLNMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  425   ITGKVLDLSVDLSAASAAEE  444



>gb|AAB69871.1| GDP dissociation inhibitor protein OsGDI2 [Oryza sativa]
Length=445

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/440 (86%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD+IVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPPA 
Sbjct  5     YDLIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  65    LGSSKDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DPKTH G+DLT +T +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPKTHQGLDLTTMTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH+DD YLNEPA+DTVKR+K+Y+ESLA FQGGSP IYPLYGLGELPQ  ARLSAV
Sbjct  185   GHALALHKDDRYLNEPAIDTVKRMKVYAESLAPFQGGSPSIYPLYGLGELPQGHARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTY+LNKP+CKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK  KVARAIAI
Sbjct  245   YGGTYILNKPDCKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKDRKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPI +TNDSHSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVSTEAETD+P+
Sbjct  305   MSHPIASTNDSHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSTEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLG VDE+FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYTL
Sbjct  365   SELKPGIDLLGQVDELFFDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  425   ITGKAVDLSVDLSAASAAEE  444



>ref|XP_006397585.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
 gb|ESQ39038.1| hypothetical protein EUTSA_v10001450mg [Eutrema salsugineum]
Length=444

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/440 (86%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDG+DL RVT KELI KFGLD+NT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHSNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>gb|KFK37228.1| hypothetical protein AALP_AA4G230400 [Arabis alpina]
Length=445

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 414/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTHDGMDLTRVT KELI KFGL+++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHDGMDLTRVTTKELIAKFGLNEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHSNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPEC VEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECTVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNESHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_010469257.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Camelina sativa]
Length=444

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF +VQ+Y+E DPKTH+GMDLTRVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLHQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_006402639.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
 gb|ESQ44092.1| hypothetical protein EUTSA_v10005975mg [Eutrema salsugineum]
Length=444

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+F+G +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFKGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT+VT KELI KFGLD+NT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDENTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLHQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLG VDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGIDLLGAVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>emb|CDX98399.1| BnaC06g17600D [Brassica napus]
 emb|CDX67817.1| BnaA07g18570D [Brassica napus]
Length=444

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT+VT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +LN+PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLNQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDEEGKV GVTSEGETAKCKK+VCDPSYLP KVRK+G VARAIAI
Sbjct  245   YGGTYMLCKPECKVEFDEEGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_010512285.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF +VQ+Y+E DPKTH+GMDLTRVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLHQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_006291137.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
 gb|EOA24035.1| hypothetical protein CARUB_v10017252mg [Capsella rubella]
Length=444

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF +VQ+Y+E+DPKTH+GMDLTRVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSFVQEYDETDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLHQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL R+SDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARRSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAAEE
Sbjct  425   ITGKQLDLTVDLSAASAAEE  444



>ref|XP_008455143.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Cucumis melo]
Length=445

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL+QLWKRFRG+DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDMIPKF+MANG LVRVLIHTDVTKYL+FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGLSKEYNVDMIPKFMMANGGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY ESDPK+H+G+DL++VTA+ELI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEESDPKSHEGLDLSKVTARELITKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YLN PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHFDDSYLNGPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFDGDGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF+ETYDR+ P+N    D+CFISTSYD +THFESTV DVL MY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYETYDRYIPINNHETDSCFISTSYDGSTHFESTVKDVLAMYSN  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAA E
Sbjct  425   ITGKAVDLSVDLSAASAASE  444



>gb|AIK01834.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDY17885.1| BnaC04g03340D [Brassica napus]
Length=444

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG DK PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT +E
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMGIFEKRRA KFF YVQ+Y+E DPKTHDG+DL RVT KELI KFGLD+NT+DFI
Sbjct  125   ALKSSLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHSNDSHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLG VDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGQVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_010254526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Nelumbo nucifera]
Length=445

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/440 (85%), Positives = 407/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNLVQLWKRFRG+DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLVQLWKRFRGNDKPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK+HKVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E+D K+H+G+DL +V AK+LI K+GL+DNTVDFI
Sbjct  125   ALKSQLMGLFEKRRARKFFIYVQDYEENDTKSHEGLDLKKVKAKDLISKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD Y++EPA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHIDDRYIDEPAMDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDSDGKAFGVTSEGETAKCKKVVCDPSYLPDKVRKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQ+ILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPHTSDSHSVQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI LLGPVDE+FF+ YDR+EP+N    DNCFISTSYD+TTHFESTV DV+ MY+ 
Sbjct  365   VELKPGIGLLGPVDEMFFDIYDRYEPINNHDADNCFISTSYDATTHFESTVKDVIAMYSQ  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAA E
Sbjct  425   ITGKTLDLTVDLSAASAASE  444



>ref|XP_010413620.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Camelina sativa]
Length=444

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF +VQ+Y+E DPKTH+GMDLTRVT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSFVQEYDEKDPKTHNGMDLTRVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLHQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLSNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_008236115.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Prunus mume]
Length=443

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 410/440 (93%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK+HKVPA D+E
Sbjct  65    LGSSRDYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G+DL +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH+DD YL EPA+D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHQDDSYLGEPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E GK  GVTSEGETAKCKKVVCDPSYLP KV+K+GKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ENGKAFGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPSTHDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELK G DLLGP+DEIFF+TYDR+EP N+   DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKAGTDLLGPIDEIFFDTYDRYEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKTLDLSVDLSAASAAEE  443



>ref|XP_010508340.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDL RVT KELI  FGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>emb|CDY45775.1| BnaC04g22610D [Brassica napus]
Length=444

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG DK P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLTR+T KELI KFGLD+NTVDFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTRLTTKELIAKFGLDENTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +LN+PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLNQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETA+CKK+VCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVIGVTSEGETARCKKIVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDVYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAAS  EE
Sbjct  425   ITGKQLDLSVDLSAASTEEE  444



>ref|XP_009138891.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 [Brassica rapa]
 emb|CDX89038.1| BnaA04g01480D [Brassica napus]
Length=444

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/440 (84%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG DK P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLTR+T KELI KFGLD+NT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTRLTTKELIAKFGLDENTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +LN+PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLNQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETA+CKK+VCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETARCKKIVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDVYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAAS  EE
Sbjct  425   ITGKQLDLSVDLSAASTEEE  444



>ref|NP_001288917.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Brassica 
rapa]
 dbj|BAF81523.1| GDP dissociation inhibitor [Brassica rapa]
 gb|AIK01835.1| GDP dissociation inhibitor [Brassica napus]
 emb|CDX79782.1| BnaA05g03740D [Brassica napus]
Length=444

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG DK PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEDKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT +E
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMGIFEKRRA KFF YVQ+Y+E DPKTHDG+DL RVT KELI KFGLD+NT+DFI
Sbjct  125   ALKSSLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGVDLKRVTTKELIAKFGLDENTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHSNDSHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVMGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLG VDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGQVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_006852946.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
 gb|ERN14413.1| hypothetical protein AMTR_s00033p00239520 [Amborella trichopoda]
Length=448

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/440 (85%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESTSLNLNQLWKRFRGDDKPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF MANG LVR LIHT+VTKYL FKAVDGS+VYNKGK+HKVPATD+E
Sbjct  65    LGSSREYNVDMIPKFTMANGGLVRTLIHTNVTKYLNFKAVDGSYVYNKGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA+KFF++VQDY ESDPKTHDGMDL +VT  ELI K+GLD NTVDFI
Sbjct  125   ALKSPLMGLFEKRRAQKFFVFVQDYEESDPKTHDGMDLMKVTTSELITKYGLDANTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPALDTVKR+KLY+ESLARFQGGSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLGEPALDTVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNK ECKVE D EGKV GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKQECKVELDAEGKVFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTSDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDEPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE FF+ YDR+EP N+   DNCFISTSYD++THFESTV+DVL MY+ 
Sbjct  365   VELKPGIDLLGPVDEKFFDIYDRYEPTNKHDGDNCFISTSYDASTHFESTVEDVLAMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL VDLS ASA+ E
Sbjct  425   ITGKVLDLTVDLSGASASGE  444



>gb|KFK35202.1| hypothetical protein AALP_AA5G253800 [Arabis alpina]
Length=444

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 407/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT+VT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +LN+PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLNQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKK+VCDPSYLP KVRK+G VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AET +P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETGNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPGLDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKELDLSVDLSAASAAEE  444



>ref|XP_004155432.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
 gb|KGN43758.1| hypothetical protein Csa_7G065170 [Cucumis sativus]
Length=445

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL+QLWKRFRG+DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDMIPKF+MANG LVRVLIHTDVTKYL+FKAVDGSFVYNKGKV+KVPATD+E
Sbjct  65    LGLSKEYNVDMIPKFMMANGGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKVYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+ESDPK+H+G+DL++VTA+ELI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDESDPKSHEGLDLSKVTARELITKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YLN PA D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHFDDSYLNGPASDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF  +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFAGDGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF+ETYDR+ P+N    DNCFISTSYD +THFESTV DVL MY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYETYDRYVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAA E
Sbjct  425   ITGKAVDLSVDLSAASAASE  444



>ref|XP_010517995.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1 [Camelina sativa]
Length=444

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTH+GMDL RVT KELI  FGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   SELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_007205201.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
 gb|EMJ06400.1| hypothetical protein PRUPE_ppa005809mg [Prunus persica]
Length=443

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/440 (85%), Positives = 409/440 (93%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK+HKVPA D+E
Sbjct  65    LGSSRDYNVDMIPKFMMANGGLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G++L +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLELNKVTARELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPA+D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLGEPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E GK  GVTSEGETAKCKKVVCDPSYLP KV+K+GKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ENGKAFGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPSTHDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELK G DLLGP+DEIFF+TYDR+EP N+   DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKAGTDLLGPIDEIFFDTYDRYEPTNQNDGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKTLDLSVDLSAASAAEE  443



>ref|XP_009104231.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brassica rapa]
Length=444

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FR  +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRREEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT+VT KELI KFGLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLTKVTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +LN+PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLNQPALDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDEEGKV GVTSEGETAKCKK+VCDPSYLP KVRK+G VARAIAI
Sbjct  245   YGGTYMLCKPECKVEFDEEGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGTVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPALDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_002880083.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56342.1| ATGDI1 [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A KSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   AFKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLGEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLSNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   SELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_010506315.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
1-like [Camelina sativa]
Length=444

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLW +FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDYYGGESTSLNLNQLWNKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQDY+E DPKTH+GMDL RVT KELI  FGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQDYDEKDPKTHNGMDLRRVTTKELIATFGLGEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_006294223.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
 gb|EOA27121.1| hypothetical protein CARUB_v10023221mg [Capsella rubella]
Length=444

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 413/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRND+YGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGIKVLHMDRNDHYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLGEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELKPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_009380662.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Musa acuminata subsp. malaccensis]
Length=446

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/440 (85%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRF+G+DKP   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFKGNDKPSEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT KE+I K+GL+DNT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYAEDDPKSHEGLDLHKVTTKEVISKYGLEDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DT+KR+KLYS+SLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTIKRMKLYSDSLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDADGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQL RKSDMYLFCCSYTHNVAPKGK+IAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLSRKSDMYLFCCSYTHNVAPKGKYIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLG VDE FF  YDR+EP N    DNCFISTSYD+TTHFESTV DV+ MY  
Sbjct  365   MELKPGIDLLGLVDETFFHIYDRYEPTNNHEHDNCFISTSYDATTHFESTVQDVISMYRK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK  DL VDLSAASAA E
Sbjct  425   ITGKEPDLTVDLSAASAATE  444



>ref|XP_007042842.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
 gb|EOX98673.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 1 [Theobroma cacao]
Length=444

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/440 (84%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLMQLWKRFRGDDKPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR++NVDMIPKF+MANG LVR+LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGASREFNVDMIPKFMMANGGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY ++DPK+H+G+DL +VTA+ELI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDNDPKSHEGLDLNKVTARELISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHIDDSYLDQPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETA+CKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDGDGKAIGVTSEGETARCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD+PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++TYDR+ P N    DNCFIS SYD TTHFE+TV DV+ MY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDTYDRYVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKALDLSVDLSAASAAEE  444



>ref|XP_002876528.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52787.1| ATGDI2 [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/440 (84%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMGIFEKRRA KFF +VQ+Y+E DPKTHDGMDL+RVT KELI K+GLD NT+DFI
Sbjct  125   ALKSSLMGIFEKRRAGKFFSFVQEYDEKDPKTHDGMDLSRVTTKELIAKYGLDGNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLDQPALDTVLRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKK+VCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVTGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_008385671.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
 ref|XP_008359208.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Malus domestica]
Length=443

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/440 (85%), Positives = 407/440 (93%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYNVDMIPKF+MANG LVRVLIHT+VTKYL FKAVDGSFVYNKGKVHKVPA D+E
Sbjct  65    LGSSKDYNVDMIPKFMMANGGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+GMDL +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGMDLNKVTARELILKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPA+  VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLAEPAMAFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E  K  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ENKKAIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPNTQDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG DLLG VDEIFF+TYDR+EP N+ + DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKPGTDLLGAVDEIFFDTYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKALDLSVDLSAASAAEE  443



>ref|XP_010646794.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
Length=445

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSV+GLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGILSVNGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYN+DMIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK+HKVPATD+E
Sbjct  65    LGSSKDYNIDMIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+ MDL +VTA+E+I K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEKMDLRKVTAREVISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YL++PALD +K++KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALYTDDKYLDKPALDFIKKMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV  VGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAFGVTSEGETAKCKKVVCDPSYLPDKVGTVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV+TEAETD+PE
Sbjct  305   MSHPIPNTSDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLG VDEIFF+ YDR+EP N+   DNCFISTSYD+TTHFESTV+DV+ MY+ 
Sbjct  365   IELKPGIELLGQVDEIFFDAYDRYEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAA+E
Sbjct  425   ITGKNLDLTVDLSAASAADE  444



>emb|CAN64340.1| hypothetical protein VITISV_031564 [Vitis vinifera]
Length=445

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/440 (85%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSV+GLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGILSVNGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYN+DMIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK+HKVPATD+E
Sbjct  65    LGSSKDYNIDMIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+ MDL +VTA+E+I K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEKMDLRKVTAREVISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YL++PALD +K++KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALYTDDKYLDKPALDFIKKMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV  VGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAFGVTSEGETAKCKKVVCDPSYLPDKVGTVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV+TEAETD+PE
Sbjct  305   MSHPIPNTSDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLG VDEIFF+ YDR+EP N+   DNCFISTSYD+TTHFESTV+DV+ MY+ 
Sbjct  365   IELKPGIELLGQVDEIFFDAYDRYEPANKQDEDNCFISTSYDATTHFESTVEDVIAMYSR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAA+E
Sbjct  425   ITGKNLDLTVDLSAASAADE  444



>ref|XP_009364258.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 406/440 (92%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS+DYNVDMIPKF+MANG LVRVLIHT+VTKYL FKAVDGSFVYNKGKVHKVPA D+E
Sbjct  65    LGSSKDYNVDMIPKFMMANGGLVRVLIHTNVTKYLNFKAVDGSFVYNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+GMDL +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGMDLNKVTAQELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL EPA+  VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLAEPAMAFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E  K  GVTSEGETAKCKKVVCDPSYLP K +KVGKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ENNKAIGVTSEGETAKCKKVVCDPSYLPDKGKKVGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPNTQDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG DLLG VDEIFF+TYDR+EP N+ + DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKPGTDLLGAVDEIFFDTYDRYEPTNQDAGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKALDLSVDLSAASAAEE  443



>gb|KDO49751.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=419

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/399 (92%), Positives = 392/399 (98%), Gaps = 0/399 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG+++PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHP+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFIST  378
             +ELKPGIDLLGPVDEIF++ YDR+EPVNEPSLDNCFIST
Sbjct  365   TELKPGIDLLGPVDEIFYDIYDRYEPVNEPSLDNCFIST  403



>ref|XP_009345712.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Pyrus x bretschneideri]
Length=443

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 406/440 (92%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGKVHKVPA D+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G+DL +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL +DD YL EPA+D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALQQDDNYLAEPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E GK  GVTSEGETAKCKKVVCDPSYLP KV+  GKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ESGKAIGVTSEGETAKCKKVVCDPSYLPNKVKLXGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVA KGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG DLLG VDEIFF+TYDR+EP N+   DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKPGTDLLGAVDEIFFDTYDRYEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKALDLSVDLSAASAAEE  443



>ref|XP_008363741.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Malus domestica]
Length=443

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/440 (85%), Positives = 406/440 (92%), Gaps = 1/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK FRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKXFRGEDKPPET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGKVHKVPA D+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKVHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G+DL +VTA+ELI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLNKVTARELISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL +DD YL EPA+D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALQQDDNYLAEPAMDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEF E GK  GVTSEGETAKCKKVVCDPSYLP KV+ VGKVARAI I
Sbjct  245   YGGTYMLSKPECKVEF-ENGKAIGVTSEGETAKCKKVVCDPSYLPNKVKIVGKVARAICI  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVA KGK+IAFV TEAETD+P+
Sbjct  304   MSHPIPNTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVLTEAETDNPQ  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG DLLG VDEIFF+TYDR+EP N+   DNCFIS SYD+TTHFE+TV DV+ MY+ 
Sbjct  364   VELKPGTDLLGAVDEIFFDTYDRYEPTNQGDGDNCFISASYDATTHFETTVQDVIAMYSK  423

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  424   ITGKALDLSVDLSAASAAEE  443



>ref|XP_002522655.1| protein with unknown function [Ricinus communis]
 gb|EEF39742.1| protein with unknown function [Ricinus communis]
Length=443

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/439 (84%), Positives = 409/439 (93%), Gaps = 0/439 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL QLWKRFRGSDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDQNDYYGGESSSLNLNQLWKRFRGSDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDMIPKFI+ANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPA D+E
Sbjct  65    LGPSKEYNVDMIPKFIIANGNLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY ++DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDNDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PALD VKR+KLY+ESLARFQGGSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALHLDDSYLDQPALDFVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYL  KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDADGKAIGVTSEGETAKCKKVVCDPSYLSNKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAP+GK+IAFV+TEAETD PE
Sbjct  305   MSHPIPNTSDSHSVQLILPQKQLGRKSDMYLFCCSYSHNVAPRGKYIAFVTTEAETDTPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEI +ETYDR+ P N P  DNCFISTSYD+TTHFE+TVDDV+ MY+ 
Sbjct  365   VELKPGIDLLGPVDEILYETYDRYIPANNPEADNCFISTSYDATTHFETTVDDVIAMYSK  424

Query  314   ITGKVLDLNVDLSAASAAE  258
             ITGK LDL+VDLSAASAAE
Sbjct  425   ITGKTLDLSVDLSAASAAE  443



>ref|NP_181938.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 sp|Q96254.1|GDI1_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
1; Short=AtGDI1 [Arabidopsis thaliana]
 gb|AAK32814.1|AF361801_1 At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAA11944.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAC23429.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAK91434.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 gb|AAM47344.1| At2g44100/F6E13.23 [Arabidopsis thaliana]
 dbj|BAE98797.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 dbj|BAE99631.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEC10374.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=445

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/440 (84%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ +GKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV+GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_002533685.1| protein with unknown function [Ricinus communis]
 gb|EEF28701.1| protein with unknown function [Ricinus communis]
Length=445

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVVVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGDDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDMIPKF+MANGALVR+LIHTDVTKYL FKAVDGSFVYNKGK+HKVPA D+E
Sbjct  65    LGASRDYNVDMIPKFMMANGALVRILIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+ +DL +V A+++I K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHERLDLNKVKARDVISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YL+EPALD VKR+KLY++SLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALYLDDNYLDEPALDFVKRMKLYADSLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+ +GKVARAI I
Sbjct  245   YGGTYMLSKPECKVEFDVDGKAYGVTSEGETAKCKKVVCDPSYLPNKVKTIGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQL RKSDMYLFCCSYTHNVAPKGK+IAFV+TEAETD P+
Sbjct  305   MSHPIPNTHDSHSVQVILPQKQLARKSDMYLFCCSYTHNVAPKGKYIAFVTTEAETDDPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+DLLGPVDE+FFETYDR+EP N+  +DNCFISTSYD+TTHFE+TV DV+ MY+ 
Sbjct  365   TELKPGLDLLGPVDEMFFETYDRYEPTNQHDVDNCFISTSYDATTHFETTVQDVIAMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDL+AA AA E
Sbjct  425   ITGKTLDLTVDLNAAGAATE  444



>ref|XP_008801349.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Phoenix dactylifera]
Length=416

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/415 (89%), Positives = 398/415 (96%), Gaps = 0/415 (0%)
 Frame = -2

Query  1499  VLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVRV  1320
             VLHMDRNDYYGGESTSLNL+QLWKRF+G+D PPA LGSSRDYNVDMIPKF+MANG LVRV
Sbjct  2     VLHMDRNDYYGGESTSLNLIQLWKRFQGNDSPPAHLGSSRDYNVDMIPKFMMANGTLVRV  61

Query  1319  LIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDY  1140
             LIHTDVTKYLYFKAVDGS+V+NKGK+HKVPATDMEAL+SPLMG+FEKRRARKFFIYVQDY
Sbjct  62    LIHTDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDY  121

Query  1139  NESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRIK  960
             +E+DPKTH G+DLTRVT +ELI K+GLDDNTVDFIGHALALHRDD YL+EPALDTVKR+K
Sbjct  122   DENDPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDRYLDEPALDTVKRMK  181

Query  959   LYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGV  780
             LY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKV GV
Sbjct  182   LYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGV  241

Query  779   TSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGR  600
             +SEGETA+CKKVVCDPSYLP KV+KVGKVARAIAIMSHPIPNT+DSHSVQ+ILPQKQLGR
Sbjct  242   SSEGETARCKKVVCDPSYLPNKVKKVGKVARAIAIMSHPIPNTDDSHSVQVILPQKQLGR  301

Query  599   KSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFE  420
             KSDMYLFCCSY+HNVAPKGKFIAFVSTEAET+ P+ ELKPGIDLLGPVDEIFF+TYDR E
Sbjct  302   KSDMYLFCCSYSHNVAPKGKFIAFVSTEAETNQPQVELKPGIDLLGPVDEIFFDTYDRCE  361

Query  419   PVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
             PVNEP LDNCFISTSYD+TTHFESTV DVL +YT ITGK +DL+VDLSAASAAEE
Sbjct  362   PVNEPLLDNCFISTSYDATTHFESTVMDVLAIYTKITGKTIDLSVDLSAASAAEE  416



>ref|XP_009790990.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana sylvestris]
Length=445

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL+QLWKRFRG+DKPP E
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDKPPEE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKF MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGTSKEYNVDMIPKFAMANGTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF+YVQD+ ESDPKTH+GMDL ++TAKE I K+ L+ +T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFLYVQDFEESDPKTHEGMDLNKITAKEFIAKYELEADTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YL++PA+D VKR+KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALYTDDNYLDQPAMDFVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFDE GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDENGKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+D+LGPVDEIF+ETYDRF P ++ + DNCFIS SYDSTTHFESTV DVL MY+ 
Sbjct  365   TELKPGVDILGPVDEIFYETYDRFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASA  E
Sbjct  425   ITGKVVDLSVDLSAASATAE  444



>ref|NP_191551.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
 sp|O24653.1|GDI2_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
2; Short=AtGDI2 [Arabidopsis thaliana]
 dbj|BAA22504.1| AtGDI2 [Arabidopsis thaliana]
 emb|CAA04727.1| GDI2 [Arabidopsis thaliana]
 emb|CAB75811.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAL91158.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AAN15330.1| Rab GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AEE79985.1| RAB GDP dissociation inhibitor 2 [Arabidopsis thaliana]
Length=444

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVPAT ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMGIFEKRRA KFF +VQ+Y+E DPKTHDGMDLTRVT KELI K+GLD NT+DFI
Sbjct  125   ALKSSLMGIFEKRRAGKFFSFVQEYDEKDPKTHDGMDLTRVTTKELIAKYGLDGNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHTNDQHLDQPAFDTVMRMKLYAESLARFQGTSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GKV GVTSEGETAKCKK+VCDPSYLP KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEGGKVIGVTSEGETAKCKKIVCDPSYLPNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG DLLGPVDEIFF+ YDR+EPVNEP LDNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKPGTDLLGPVDEIFFDMYDRYEPVNEPELDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_002310487.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
 gb|EEE90937.1| hypothetical protein POPTR_0007s03250g [Populus trichocarpa]
Length=444

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 407/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGSDTPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKFI+ANG LVRVLIHTDVTKYL+FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGASKEYNVDMIPKFIIANGGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY E+DPK+H+G+DLT+VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEENDPKSHEGLDLTKVTAREVISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA D VKR+KLY++SLARFQGGSPYIYPLYGL ELPQ+FARLSAV
Sbjct  185   GHALALHLDDSYLDQPASDFVKRMKLYADSLARFQGGSPYIYPLYGLAELPQSFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+ VGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAIGVTSEGETAKCKKVVCDPSYLPNKVKNVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP T+DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GKFIAFVS EAETD+PE
Sbjct  305   MSHPIPATSDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKFIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF+ETYDR+ P+N    DNCFISTSYD+TTHFE+TV DV+ MY+ 
Sbjct  365   IELKPGIDLLGPVDEIFYETYDRYVPINTMKDDNCFISTSYDATTHFETTVQDVIAMYSE  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>ref|XP_007042843.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
 gb|EOX98674.1| GDP dissociation inhibitor family protein / Rab GTPase activator 
family protein isoform 2 [Theobroma cacao]
Length=445

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/441 (84%), Positives = 410/441 (93%), Gaps = 1/441 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRG DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLMQLWKRFRGDDKPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR++NVDMIPKF+MANG LVR+LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGASREFNVDMIPKFMMANGGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY ++DPK+H+G+DL +VTA+ELI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDNDPKSHEGLDLNKVTARELISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELP-QAFARLSA  858
             GHALALH DD YL++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELP QAFARLSA
Sbjct  185   GHALALHIDDSYLDQPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLNKPECKVEFD +GK  GVTSEGETA+CKKVVCDPSYLP KV+KVGKVARAI 
Sbjct  245   VYGGTYMLNKPECKVEFDGDGKAIGVTSEGETARCKKVVCDPSYLPDKVQKVGKVARAIC  304

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD+P
Sbjct  305   IMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNP  364

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E ELKPGIDLLGPVDEIF++TYDR+ P N    DNCFIS SYD TTHFE+TV DV+ MY+
Sbjct  365   EVELKPGIDLLGPVDEIFYDTYDRYVPTNNHGADNCFISASYDPTTHFETTVTDVIEMYS  424

Query  317   LITGKVLDLNVDLSAASAAEE  255
              ITGK LDL+VDLSAASAAEE
Sbjct  425   KITGKALDLSVDLSAASAAEE  445



>ref|XP_009593951.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Nicotiana tomentosiformis]
Length=445

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL+QLWKRFRG+DKPP E
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDKPPEE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKF MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGTSKEYNVDMIPKFAMANGTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF+YVQD+ E+DPKTH+GMDL ++TAKE I K+ L+ +T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFLYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEADTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YLN+PA+D VKR+KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALYTDDNYLNQPAMDFVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFDE GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDENGKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD P+
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+D+LGPVDEIF+ETYD+F P ++ + DNCFIS SYDSTTHFESTV DVL MY+ 
Sbjct  365   TELKPGVDILGPVDEIFYETYDQFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASA  E
Sbjct  425   ITGKVVDLSVDLSAASATAE  444



>ref|XP_011023058.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Populus euphratica]
Length=444

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 407/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGSDTPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKFI+ANG LVRVLIHTDVTKYL+FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGASKEYNVDMIPKFIIANGGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY E+DPK+H+G+DLT+VTA+E+I K+GL+D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEENDPKSHEGLDLTKVTAREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL +PALD VKR+KLY++SLARFQGGSPYIYPLYGL ELPQ+FARLSAV
Sbjct  185   GHALALHLDDSYLAQPALDFVKRMKLYADSLARFQGGSPYIYPLYGLAELPQSFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+ VGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAIGVTSEGETAKCKKVVCDPSYLPNKVKNVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP T+DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GK+IAFVS EAETD+PE
Sbjct  305   MSHPIPATSDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF+ETYDR+ P+N    DNCFISTSYD+TTHFE+TV DV+ +Y+ 
Sbjct  365   LELKPGIDLLGPVDEIFYETYDRYVPINTMKEDNCFISTSYDATTHFETTVQDVIAIYSE  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAVE  444



>emb|CAA69258.1| GDP-associated inhibitor [Arabidopsis thaliana]
Length=445

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/440 (84%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ +GKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV+GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+ ASAAEE
Sbjct  425   ITGKELDLSVDLNPASAAEE  444



>ref|XP_004984243.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=446

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 410/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G + PP++
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPSQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMVPKFMMANGALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E+DP TH G DLT++T K+LI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKENDPSTHKGYDLTKLTTKQLISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YL+EPA+DTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHRDDSYLSEPAIDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVCGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT +SHSVQIILPQKQL RKSDMY+FCCSY+HNVA KGKFIAFVS +AETD+PE
Sbjct  305   MSHPIPNTAESHSVQIILPQKQLSRKSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+F +TYDR+EP N+ S DNC+ISTSYD+TTHFESTV DVL +YT 
Sbjct  365   TELKPGIDLLGPVDELFIDTYDRYEPTNDSSSDNCYISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASA+E+
Sbjct  425   ITGKAVDLSVDLSAASASED  444



>ref|XP_004962067.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Setaria italica]
Length=462

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/425 (86%), Positives = 400/425 (94%), Gaps = 0/425 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGDSTSLNLNQLWKRFRGEDKPPTH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK++KVPATDME
Sbjct  65    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIYKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYNE+DPKTH G+DLT VT +ELI K+GL D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARNFFIYVQDYNEADPKTHQGLDLTMVTTRELIAKYGLSDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDRYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+G+V RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLLNKVRKIGRVVRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+SHSVQIILPQKQLGR+SDMY+FCCSYTHNVAP+GKFIAFVS EAETD+P+
Sbjct  305   MSHPIPNTNESHSVQIILPQKQLGRRSDMYVFCCSYTHNVAPRGKFIAFVSAEAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPG+DLLG VDEIF++ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT+
Sbjct  365   SELKPGLDLLGSVDEIFYDIYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLNMYTM  424

Query  314   ITGKV  300
             ITGKV
Sbjct  425   ITGKV  429



>gb|AAR06264.1| GDP dissociation inhibitor protein [Hordeum vulgare]
Length=445

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/440 (83%), Positives = 412/440 (94%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGDGTPPAN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMVPKFMMANGALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E+DP TH G+DLT++T+K+LI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKENDPSTHKGLDLTKMTSKQLISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH+DD YL+EPA++ VKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKDDSYLSEPAIEIVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSY+P KV+KVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVRGVTSEGETAKCKKVVCDPSYVPDKVKKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT +SHSVQII+PQKQLGR+SDMY+FCCSY+HNVA KGKFIAFVS +AE+D+PE
Sbjct  305   MSHPIPNTAESHSVQIIIPQKQLGRRSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+FF+TYDR+EP N+PS DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   AELKPGIDLLGPVDELFFDTYDRYEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAED  444



>ref|XP_010937652.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Elaeis guineensis]
Length=446

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKR +G+D  P +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRLKGNDNHPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDMIPKF+MANGALVRVLIHT VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMIPKFMMANGALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARK FIYVQDY ++DPK+H+G+DL +V  KEL+ K+GL+DNTVDFI
Sbjct  125   ALKSTLMGLFEKRRARKLFIYVQDYEDNDPKSHEGLDLNKVKTKELMAKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTSEGETA+CKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDANGKAHGVTSEGETARCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQ+ RKSDMY+FCCSYTHNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQIERKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLG VDEIFF+ YDR+EP+N+   DNCFISTSYD+TTHFESTV DV+ MY+ 
Sbjct  365   VELKPGIDLLGSVDEIFFDIYDRYEPINKHDEDNCFISTSYDATTHFESTVQDVISMYSR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAA E
Sbjct  425   ITGKELDLTVDLSAASAAPE  444



>ref|XP_006351732.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum 
tuberosum]
Length=445

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/440 (83%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL+QLWKRFRG+D+PP E
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKF MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGTSKEYNVDMIPKFAMANGTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF+YVQD+ E+DPKTH+GMDL ++TAKE I K+ L+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFLYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL  DD YL +PA+D +KR+KLY+ESLARFQ GSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALCTDDNYLAQPAMDFIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFDE GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDEGGKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPG+D+LG VDEIF+ETYDRF P ++ + DNCFIS SYDSTTHFESTV DVL MY+ 
Sbjct  365   SELKPGVDILGAVDEIFYETYDRFVPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLS+ASA  E
Sbjct  425   ITGKVIDLSVDLSSASATAE  444



>ref|XP_004230543.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Solanum lycopersicum]
 emb|CAM97308.1| Rab-GDP dissociation inhibitor [Solanum lycopersicum]
Length=445

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/440 (83%), Positives = 408/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL+QLWKRFRG+D+PP E
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKF MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGTSKEYNVDMIPKFAMANGTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF+YVQD+ E+DPKTH+GMDL ++TAKE I K+ L+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFLYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL  DD YL +PA+D +KR+KLY+ESLARFQ GSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALCTDDNYLAQPAMDFIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD+ GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDDGGKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPG+D+LG VDEIF+ETYDRF P ++ + DNCFIS SYDSTTHFESTV DVL MY+ 
Sbjct  365   SELKPGVDILGAVDEIFYETYDRFIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKV+DL+VDLSAASA  E
Sbjct  425   ITGKVIDLSVDLSAASATAE  444



>gb|AAL38263.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ +GKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLG+LPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGKLPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV+GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK  DL+VDL+AASAAEE
Sbjct  425   ITGKEPDLSVDLNAASAAEE  444



>gb|AAM64484.1| GDP dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/440 (84%), Positives = 411/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ +GKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV+GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMY+FC SY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCFSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASAAEE
Sbjct  425   ITGKELDLSVDLNAASAAEE  444



>ref|XP_009420147.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/440 (83%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDG KVLHMDRN YYGGESTSLNL+Q+WKRFRGSDKPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGFKVLHMDRNGYYGGESTSLNLIQIWKRFRGSDKPPAY  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG L+  L+HT+VTKYL FK VDGS+V+NKGK+HKVPATDME
Sbjct  65    LGPSRDYNVDMIPKFMMANGTLMCTLVHTNVTKYLSFKTVDGSYVFNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQ+Y+ESDPKTH+G++L+RVT ++LI K+GL+DNT +FI
Sbjct  125   ALKSSLMGLFEKRRARKFFIYVQNYDESDPKTHEGLNLSRVTTRQLISKYGLNDNTTEFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+K+Y+ SL+RFQGGSPYIYPLYGLGELPQAFARLSA 
Sbjct  185   GHALALHRDDQYLNEPALDTVKRMKMYAASLSRFQGGSPYIYPLYGLGELPQAFARLSAA  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTSEG TA+CKKVVCDPSYLP KVRKVGKVARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDMRGKAYGVTSEGTTARCKKVVCDPSYLPNKVRKVGKVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TN SHSVQIILPQKQLGRKSDMYLFCCSY H VAPKGKFIAFVSTEAETD PE
Sbjct  305   MSHPIPDTNWSHSVQIILPQKQLGRKSDMYLFCCSYLHKVAPKGKFIAFVSTEAETDRPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE+FFETYDR++P+N PS D+C+ISTS+D+TTHFESTV DVL MYT+
Sbjct  365   VELKPGIDLLGPVDELFFETYDRYKPINTPSSDHCYISTSHDATTHFESTVMDVLSMYTM  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DLN+D SAA  A E
Sbjct  425   ITGKTIDLNMDPSAAGIAIE  444



>ref|XP_006657603.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Oryza brachyantha]
Length=446

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G + PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDMIPKF+MANGALVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMIPKFMMANGALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E+DP TH G DLT++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKENDPSTHKGYDLTKMTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH++D YL EPA+DTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKEDNYLTEPAIDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP CKVEF+++GKV GVTSEGETAKCKKVVCDPSY+P KVRKVGKV RAIAI
Sbjct  245   YGGTYMLNKPGCKVEFNDQGKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DSHSVQII+PQKQLGRKSDMY+FCCSY+HNVA KGKFIAFVS +AE+++PE
Sbjct  305   MSHPIPNTADSHSVQIIIPQKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+F +TYDRFEP N+PS DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   AELKPGIDLLGPVDELFIDTYDRFEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAED  444



>ref|XP_006487500.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus 
sinensis]
 gb|KDO51543.1| hypothetical protein CISIN_1g036458mg [Citrus sinensis]
Length=445

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSVDGLKVLHMDRN YYGGESTSLNL QLWKRF+G DKPP  
Sbjct  5     YDVIVLGTGLKECILSGVLSVDGLKVLHMDRNAYYGGESTSLNLTQLWKRFKGDDKPPER  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDMIPKF+MANG LVR+LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMIPKFMMANGGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+Y E DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQEYEEDDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH +D YL EPA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHINDSYLEEPAMDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDGDGKVIGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M+HPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP G++IAFVSTEAETD+PE
Sbjct  305   MNHPIPDTNDSHSCQVILPQKQLGRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+TYDRF P N    D+CFISTSYD+TTHFESTV DVL MYT 
Sbjct  365   VELKPGIDLLGPVDEIFFDTYDRFVPTNNHEADHCFISTSYDATTHFESTVQDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASA  E
Sbjct  425   ITGKAVDLSVDLSAASATAE  444



>ref|XP_004137066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cucumis 
sativus]
Length=469

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/437 (84%), Positives = 406/437 (93%), Gaps = 0/437 (0%)
 Frame = -2

Query  1565  IVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGS  1386
              +LGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL+QLWKRFRG+DKPP +LG 
Sbjct  32    FLLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLIQLWKRFRGNDKPPEQLGL  91

Query  1385  SRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALK  1206
             S++YNVDMIPKF+MANG LVRVLIHTDVTKYL+FKAVDGSFVYNKGKV+KVPATD+EALK
Sbjct  92    SKEYNVDMIPKFMMANGGLVRVLIHTDVTKYLHFKAVDGSFVYNKGKVYKVPATDVEALK  151

Query  1205  SPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHA  1026
             SPLMG+FEKRRARKFFIYVQDY+ESDPK+H+G+DL++VTA+ELI K+GL+D+T+DFIGHA
Sbjct  152   SPLMGLFEKRRARKFFIYVQDYDESDPKSHEGLDLSKVTARELITKYGLEDDTIDFIGHA  211

Query  1025  LALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGG  846
             LALH DD YLN PA D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGG
Sbjct  212   LALHFDDSYLNGPASDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGG  271

Query  845   TYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSH  666
             TYMLNKPECKVEF  +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARA+ IMSH
Sbjct  272   TYMLNKPECKVEFAGDGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCIMSH  331

Query  665   PIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESEL  486
             PIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD+PE EL
Sbjct  332   PIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDNPEVEL  391

Query  485   KPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITG  306
             KPGIDLLGPVDEIF+ETYDR+ P+N    DNCFISTSYD +THFESTV DVL MY+ ITG
Sbjct  392   KPGIDLLGPVDEIFYETYDRYVPINNHETDNCFISTSYDGSTHFESTVTDVLAMYSKITG  451

Query  305   KVLDLNVDLSAASAAEE  255
             K +DL+VDLSAASAA E
Sbjct  452   KAVDLSVDLSAASAASE  468



>ref|XP_009416240.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSL+LVQLWKRFR +DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLSLVQLWKRFRSNDKPPEL  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANG LVRVLI T VTKYL FKAVDGSFVYN GK++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGTLVRVLIRTGVTKYLNFKAVDGSFVYNNGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY + +PK+H+G+DL +VT +++I K+GL+DNTVDFI
Sbjct  125   ALKSTLMGLFEKRRARKFFIYVQDYEDDEPKSHEGLDLNKVTTRDVISKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+ TVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIYTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDTDGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGR+SDMY+FCCSY HNVAPKGK+IAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRRSDMYVFCCSYAHNVAPKGKYIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE FF+ YDR+EP N    DNCFISTSYD+TTHFESTV DV+ MY  
Sbjct  365   TELKPGIDLLGPVDETFFDIYDRYEPANHDEQDNCFISTSYDATTHFESTVQDVISMYKK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKELDLSVDLSAASAAGE  444



>ref|XP_008784526.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Phoenix dactylifera]
Length=446

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKR +G+DKP   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRLKGNDKPTEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARK FIYVQDY E+DPK+H+G+DL +VT KEL  K+GL+DNTVDFI
Sbjct  125   ALKSTLMGLFEKRRARKLFIYVQDYEENDPKSHEGLDLNKVTTKELFAKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLN+PA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLNDPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTSE ETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDANGKAYGVTSESETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQIILPQKQLGRKSDMY+FCCSYTHNVAP+GK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPRGKYIAFVSTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLG VDE FF+ YD ++PVN+   DNCFISTSYD+TTHFESTV DVL MY+ 
Sbjct  365   VELKPGINLLGSVDETFFDIYDIYDPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYSR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASA  E
Sbjct  425   ITGKELDLTVDLSAASATAE  444



>ref|XP_009419946.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Musa acuminata subsp. malaccensis]
Length=446

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/433 (84%), Positives = 403/433 (93%), Gaps = 0/433 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRF+G+DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFKGTDKPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANG LVRVLIHT VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGPSKEYNVDMVPKFMMANGGLVRVLIHTSVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E++PK+H+GMDL +VT++E+I K+GLDDNT+DFI
Sbjct  125   ALKSTLMGLFEKRRARKFFIYVQDYEENEPKSHEGMDLHKVTSREVISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAYGVTSEGETAKCKKVVCDPSYLPSKVKKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQIILPQKQLGR+SDMY+FCCSYTHNVAPKGK+IAFVSTEAETDHPE
Sbjct  305   MSHPIPNTNDSQSVQIILPQKQLGRRSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDHPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPV+E FF+TYDR+EP N    D+CFISTSYD+TTHFE+TV+DV+ MY  
Sbjct  365   TELKPGIDLLGPVNETFFDTYDRYEPTNNHEEDSCFISTSYDATTHFETTVEDVISMYRK  424

Query  314   ITGKVLDLNVDLS  276
             ITGK  DL VDL+
Sbjct  425   ITGKEPDLTVDLN  437



>ref|XP_002989142.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
 gb|EFJ09736.1| hypothetical protein SELMODRAFT_159958 [Selaginella moellendorffii]
Length=444

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGGES SLNLVQL+++FR SDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGESASLNLVQLYQKFRNSDKPPPS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGQLVRVLIHTDVTKYLAFKAVDGSFVYTKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KS LMGIFEKRRARKFFIYVQDYNE+DP+THDGMDL+RVT KEL   FGLDDNT+DFI
Sbjct  125   AIKSTLMGIFEKRRARKFFIYVQDYNEADPRTHDGMDLSRVTTKELFAHFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD YL+EPAL+TVKR KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHSLALHRDDRYLSEPALETVKRFKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KP+C +EFDEEGKV GVTSEGETA+ KKVVCDPSY   KVRKVGKV RAI I
Sbjct  245   YGGTYMLQKPDCTIEFDEEGKVRGVTSEGETARTKKVVCDPSYARNKVRKVGKVVRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGR+SDMY+FCCSY+HNVAPKGKFIAFVSTE ET  PE
Sbjct  305   MSHPIPNTNDSSSVQVILPQKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+PG+ LLGPVDE+F + YDRFEPVN+ +LDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   KELQPGLSLLGPVDEMFIDVYDRFEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAA+E
Sbjct  425   ITGKVLDLSVDLSAASAADE  444



>ref|XP_006423751.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
 gb|ESR36991.1| hypothetical protein CICLE_v10029979mg [Citrus clementina]
Length=445

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSVDGLKVLHMDRN YYGGESTSLNL QLWKRF+G DKPP  
Sbjct  5     YDVIVLGTGLKECILSGVLSVDGLKVLHMDRNAYYGGESTSLNLTQLWKRFKGDDKPPER  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDMIPKF+MANG LVR+LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMIPKFMMANGGLVRILIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQ+Y E DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQEYEEDDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH +D YL EPA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHINDSYLEEPAMDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDGDGKVIGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M+HPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP G++IAFVSTEAETD+PE
Sbjct  305   MNHPIPDTNDSHSCQVILPQKQLGRKSDMYLFCCSYAHNVAPNGQYIAFVSTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIFF+TYDRF P N    D+CFIS+SYD+TTHFESTV DVL MYT 
Sbjct  365   VELKPGIDLLGPVDEIFFDTYDRFVPTNNHEADHCFISSSYDATTHFESTVQDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASA  E
Sbjct  425   ITGKAVDLSVDLSAASATAE  444



>ref|XP_003529259.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Glycine 
max]
Length=445

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 403/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFRG D P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPSEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA D V R+K+Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAKDFVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+ GK  GVTSEGETAKCKKVVCDPSYL  KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDDNGKAIGVTSEGETAKCKKVVCDPSYLSDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVA KGK+IAFV+TEAETD PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++ YDRFEP N+   D CFISTSYD+TTHFE+TV DV+ +Y+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDIYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAA E
Sbjct  425   ITGKVLDLSVDLSAASAATE  444



>ref|XP_002268877.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Vitis vinifera]
 emb|CBI34015.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/438 (83%), Positives = 409/438 (93%), Gaps = 0/438 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSV+G KVLHMDRN+YYGGES+SL+L QLW+RFRG+D+PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVNGFKVLHMDRNEYYGGESSSLSLKQLWQRFRGNDQPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGGLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY E+DPK+H+GMDL +VTA++LI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEENDPKSHEGMDLNKVTARDLISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALH DD YL+EPA++ VKR+KLY+ESLARFQGGSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHSLALHSDDSYLDEPAMEFVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAFGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSH IP+TNDSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFV+TEAETD PE
Sbjct  305   MSHSIPDTNDSHSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELK G+DLLGPVDEIF+ETYDRFEP N+  +D+CFISTSYD+TTHFESTV +V+ MY+ 
Sbjct  365   VELKRGVDLLGPVDEIFYETYDRFEPKNDHEVDHCFISTSYDATTHFESTVKNVIAMYSK  424

Query  314   ITGKVLDLNVDLSAASAA  261
             ITG+ LDL VDLSAASAA
Sbjct  425   ITGEELDLTVDLSAASAA  442



>gb|EMS53634.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=544

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/488 (78%), Positives = 413/488 (85%), Gaps = 48/488 (10%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLK-----------------------------------  1500
             YDVIVLGTGLKECILSGLLSVDGLK                                   
Sbjct  55    YDVIVLGTGLKECILSGLLSVDGLKIQNPWVLAADRWLAVAAPLVLMRCIFPRVPQKVLA  114

Query  1499  -------------VLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMI  1359
                          VLHMDRNDYYGG+STSLNL QLWK+FRG DKPPA LGSS+DYNVDM+
Sbjct  115   RKYPYDEIRIDKDVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGSSKDYNVDMV  174

Query  1358  PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEK  1179
             PKF+MANG LVR LIHT+VTKYL FKAVDGSFV++KGK+HKVPATDMEALKSPLMG+FEK
Sbjct  175   PKFMMANGTLVRTLIHTNVTKYLSFKAVDGSFVFSKGKIHKVPATDMEALKSPLMGLFEK  234

Query  1178  RRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCY  999
             RRAR FFIYVQ+Y+E+DPKTH G+DLT +T KELI K+GL D+TVDFIGHALALHRDD +
Sbjct  235   RRARNFFIYVQNYDEADPKTHQGLDLTTLTTKELIAKYGLVDDTVDFIGHALALHRDDRH  294

Query  998   LNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPEC  819
             LNEPALDTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQ FARLSAVYGGTYML+KPEC
Sbjct  295   LNEPALDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPEC  354

Query  818   KVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSH  639
             KVEFD EGK  GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAIMSHPIPNTN+SH
Sbjct  355   KVEFDMEGKACGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNTNESH  414

Query  638   SVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGP  459
             SVQIILPQKQLGR SDMY+FCCSYTHNVAPKGKFIAFVS EAE+D+ +SELKPGIDLLGP
Sbjct  415   SVQIILPQKQLGRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGP  474

Query  458   VDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDL  279
             VDE+FF+ YDR+EPVNEP LDNCFISTSYD+TTHFE+TV DVL MYT+ITGK +DL+VDL
Sbjct  475   VDELFFDMYDRYEPVNEPYLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDL  534

Query  278   SAASAAEE  255
             SAASAAEE
Sbjct  535   SAASAAEE  542


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKV  1497
             YDVIVLGTGL+ECILSGLLSVDGLK+
Sbjct  5     YDVIVLGTGLQECILSGLLSVDGLKI  30



>ref|XP_009116668.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X2 [Brassica rapa]
Length=444

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/440 (83%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KV+HMDRNDYYGGESTSL L QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVIHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KS LMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT++T KELI KFGLDDNT+DFI
Sbjct  125   AMKSNLMGIFEKRRAGKFFGYVQDYDEKDPKTHNGMDLTKLTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAIALHTNDEHLHQPALDTVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+C VEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KV K+G+VARAIAI
Sbjct  245   YGGTYMLNKPDCTVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+ DNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>ref|XP_002987358.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
 gb|EFJ11673.1| hypothetical protein SELMODRAFT_271917 [Selaginella moellendorffii]
Length=444

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/440 (84%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGGES SLNLVQL+++FR SDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGESASLNLVQLYQKFRNSDKPPPS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGPSRDYNVDMIPKFMMANGQLVRVLIHTDVTKYLAFKAVDGSFVYTKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KS LMGIFEKRRARKFFIYVQDYNE+DP+T DGMDL+RVT KEL   FGLDDNT+DFI
Sbjct  125   AIKSTLMGIFEKRRARKFFIYVQDYNEADPRTQDGMDLSRVTTKELFAHFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD YL+EPAL+TVKR KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHSLALHRDDRYLSEPALETVKRFKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KP+C +EFDEEGKV GVTSEGETA+ KKVVCDPSY   KVRKVGKV RAI I
Sbjct  245   YGGTYMLQKPDCTIEFDEEGKVRGVTSEGETARTKKVVCDPSYARNKVRKVGKVVRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGR+SDMY+FCCSY+HNVAPKGKFIAFVSTE ET  PE
Sbjct  305   MSHPIPNTNDSSSVQVILPQKQLGRRSDMYVFCCSYSHNVAPKGKFIAFVSTEVETSEPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+PG+ LLGPVDE+F + YDRFEPVN+ +LDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   KELQPGLSLLGPVDEMFIDVYDRFEPVNDWTLDNCFISKSYDPTTHFETTVQDVLAMYTR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAA+E
Sbjct  425   ITGKVLDLSVDLSAASAADE  444



>ref|XP_003531017.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X1 [Glycine max]
 gb|KHN46259.1| Rab GDP dissociation inhibitor alpha [Glycine soja]
Length=445

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/440 (83%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFRG D P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPAEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA D V R+K+Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLDEPAKDFVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKK+VCDPSYL  KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVA KGK+IAFV+TEAETD+PE
Sbjct  305   MSHPIPDTKDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++TYDRFEP N+   D CFISTSYD+TTHFE+TV DV+ +Y+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDTYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAA E
Sbjct  425   ITGKVLDLSVDLSAASAATE  444



>ref|XP_003557314.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like [Brachypodium distachyon]
Length=446

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 409/440 (93%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMVPKFMMANGALVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E+DP TH G+DLT++T+KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKENDPSTHKGLDLTKMTSKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH+DD YL+EPA++ VKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKDDSYLSEPAIEIVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+EGKV GVTSEGETAKC+KVVCDPSY+P KV+KVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKVEFDDEGKVCGVTSEGETAKCRKVVCDPSYVPEKVKKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT +SHSVQII+PQKQLGRKSDMY+FCCSY+HNVA KGKFIAFVS +AE+D+PE
Sbjct  305   MSHPIPNTAESHSVQIIIPQKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+F + YDR EP N+PS DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   AELKPGIDLLGPVDELFIDIYDRSEPANDPSSDNCFISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAED  444



>ref|XP_007199860.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
 gb|EMJ01059.1| hypothetical protein PRUPE_ppa005763mg [Prunus persica]
Length=445

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/440 (83%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVYNK K++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGGLVRVLIHTDVTKYLNFKAVDGSFVYNKKKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQD+ E+DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDFEENDPKSHEGLDLNKVTAREVITKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL+EPA++ VK++KLY+ESLARF+GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHIDDSYLDEPAMEFVKKMKLYAESLARFEGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPEC+V+FD+ G   GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECQVKFDDNGNAIGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHSVQ+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD P+
Sbjct  305   MSHPIPDTNDSHSVQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELK GIDLLGP+DEIF++TYDR+ P N+  +D+C+IS+SYD+TTHFESTV DVL MYT 
Sbjct  365   VELKSGIDLLGPLDEIFYDTYDRYVPTNDHQVDSCYISSSYDATTHFESTVQDVLAMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKALDLSVDLSAASATAE  444



>ref|XP_010277491.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Nelumbo nucifera]
Length=445

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/432 (84%), Positives = 405/432 (94%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSV+GLKVLHMDRNDYYGGESTSLNL+QLWKRFRG+DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVNGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKG++HKVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGQIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E+DPK+H+G+DL +VTA+++I K+GL+DNTVDFI
Sbjct  125   ALKSQLMGLFEKRRARKFFIYVQDYEENDPKSHEGLDLNKVTARDVISKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL+EPA+D VKRI+LY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHIDDKYLDEPAMDFVKRIRLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETA+CKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDENGKAFGVTSEGETARCKKVVCDPSYLPDKVQKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV  EAET+ PE
Sbjct  305   MSHPIPNTSDSHSVQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGPV+E+FF+ YDR+EP+N+  +DNC+ISTSYD+TTHFESTV DV+ MY+ 
Sbjct  365   VELKPGIELLGPVEEMFFDIYDRYEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSR  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKDLDLSVDL  436



>emb|CDY05962.1| BnaA09g38180D [Brassica napus]
Length=444

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/440 (83%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDRNDYYGGESTSL L QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KS LMGIFEKRRA KFF YVQDY+E +PKTH+GMDLT++T KE+I KFGLDDNT+DFI
Sbjct  125   AVKSNLMGIFEKRRAGKFFGYVQDYDEKEPKTHNGMDLTKLTTKEMITKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAIALHTNDQHLHQPALDTVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+C VEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KV K+G+VARAIAI
Sbjct  245   YGGTYMLNKPDCTVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+ DNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKQLDLSVDLSAASAAEE  444



>emb|CAB94202.1| GDP dissociation inhibitor [Solanum lycopersicum]
Length=438

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/437 (83%), Positives = 405/437 (93%), Gaps = 0/437 (0%)
 Frame = -2

Query  1565  IVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGS  1386
             IVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL+QLWKRFRG+D+PP ELG+
Sbjct  1     IVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLIQLWKRFRGNDQPPEELGT  60

Query  1385  SRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALK  1206
             S++YNVDMIPKF MANG LVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+EALK
Sbjct  61    SKEYNVDMIPKFAMANGTLVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALK  120

Query  1205  SPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHA  1026
             SPLMG+FEKRRARKFF+YVQD+ E+DPKTH+GMDL ++TAKE I K+ L+D+T+DFIGHA
Sbjct  121   SPLMGLFEKRRARKFFLYVQDFEETDPKTHEGMDLNKITAKEFIAKYELEDDTIDFIGHA  180

Query  1025  LALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGG  846
             LAL  DD YL +PA+D +KR+KLY+ESLARFQ GSPYIYPLYGLGELPQAFARLSAVYGG
Sbjct  181   LALCTDDNYLAQPAMDFIKRVKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAVYGG  240

Query  845   TYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSH  666
             TYMLNKP+CKVEFD+ GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARAI IMSH
Sbjct  241   TYMLNKPQCKVEFDDGGKVVGVTSEGETAKCKKVVCDPSYLPDKVQKVGKVARAICIMSH  300

Query  665   PIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESEL  486
             PIPNTNDSHS Q+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PESEL
Sbjct  301   PIPNTNDSHSAQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDDPESEL  360

Query  485   KPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITG  306
             KPG+D+LG VDEIF+ETYDRF P ++ + DNCFIS SYDSTTHFESTV DVL MY+ ITG
Sbjct  361   KPGVDILGAVDEIFYETYDRFIPSHDSAADNCFISKSYDSTTHFESTVMDVLDMYSKITG  420

Query  305   KVLDLNVDLSAASAAEE  255
             KV+DL+VDLSAASA  E
Sbjct  421   KVIDLSVDLSAASATAE  437



>ref|NP_001059344.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAC79568.1| putative GDP dissociation inhibitor [Oryza sativa Japonica Group]
 dbj|BAF21258.1| Os07g0271000 [Oryza sativa Japonica Group]
 dbj|BAG91529.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDMIPKF+MANG LVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMIPKFMMANGTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF++VQDY E+DP TH G DL ++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH++D YL EPA+DTVKR+KLY+ES+ RFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKEDNYLTEPAIDTVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECK+EF++EGKV GVTSEGETAKCKKVVCDPSY+P KVRKVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKIEFNDEGKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DSHSVQII+PQKQLGRKSDMY+FCCSY+HNVA KGKFIAFVS +AE+++P 
Sbjct  305   MSHPIPNTADSHSVQIIIPQKQLGRKSDMYVFCCSYSHNVASKGKFIAFVSAQAESENPA  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+F +TYDRFEP N+PS DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   AELKPGIDLLGPVDELFIDTYDRFEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAED  444



>ref|NP_001140939.1| uncharacterized protein LOC100273017 [Zea mays]
 gb|ACF85003.1| unknown [Zea mays]
 tpg|DAA39802.1| TPA: hypothetical protein ZEAMMB73_457429 [Zea mays]
Length=446

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 405/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G + PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEETPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDM+PKF+MANG LVRVLIHT VTKY+ FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMVPKFMMANGTLVRVLIHTGVTKYMSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E+DP TH G +LT++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKENDPSTHKGYNLTKLTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YL EPA+DTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHRDDSYLTEPAIDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEFD+EGKV GVTSEGETAKCKKVVCDPSYLP KV+K+GKV RAIAI
Sbjct  245   YGGTYMLSKPECKVEFDDEGKVCGVTSEGETAKCKKVVCDPSYLPDKVKKIGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT +SHSVQIILPQKQLGR+SDMY+FCCSY+HNVA KGKFIAFVS +AETD+PE
Sbjct  305   MSHPIPNTAESHSVQIILPQKQLGRRSDMYVFCCSYSHNVASKGKFIAFVSAQAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLG VDE+F + YDR+EP N+ S DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   KELKPGIDLLGKVDELFIDIYDRYEPTNDSSADNCFISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  425   ITGKTVDLSVDLSAASAAED  444



>ref|XP_009116667.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2-like isoform X1 [Brassica rapa]
Length=445

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/441 (83%), Positives = 405/441 (92%), Gaps = 1/441 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KV+HMDRNDYYGGESTSL L QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVIHMDRNDYYGGESTSLYLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A+KS LMGIFEKRRA KFF YVQDY+E DPKTH+GMDLT++T KELI KFGLDDNT+DFI
Sbjct  125   AMKSNLMGIFEKRRAGKFFGYVQDYDEKDPKTHNGMDLTKLTTKELIAKFGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAIALHTNDEHLHQPALDTVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+C VEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KV K+G+VARAIAI
Sbjct  245   YGGTYMLNKPDCTVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK GIDLLGPVDEIFF+ YDR+EPVNEP+ DNCFISTSYD+TTHFE+TV DVL MYTL
Sbjct  365   TELKAGIDLLGPVDEIFFDMYDRYEPVNEPASDNCFISTSYDATTHFETTVADVLNMYTL  424

Query  314   ITGK-VLDLNVDLSAASAAEE  255
             ITGK  LDL+VDLSAASAAEE
Sbjct  425   ITGKQQLDLSVDLSAASAAEE  445



>ref|XP_004983945.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Setaria 
italica]
Length=447

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 404/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSV+GLKVLHMDRNDYYGGES+SLNL +LWKRF+G+D PP  
Sbjct  5     YDVIVLGTGLKECIISGLLSVEGLKVLHMDRNDYYGGESSSLNLTKLWKRFKGNDSPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY+E DPK+H+G+DLT+VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYDEEDPKSHEGLDLTKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAYGVTSEGETAKCKKVVCDPSYLPEKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EP+N P  D+CF++ SYD++THFE+TV DVL +Y  
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPINNPEEDSCFLTNSYDASTHFETTVKDVLSLYNK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASA E+
Sbjct  425   ITGKELDLSVDLNAASATEQ  444



>ref|XP_008237140.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Prunus mume]
Length=445

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 406/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSV+GLKVLHMDRNDYYGG STSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVEGLKVLHMDRNDYYGGASTSLNLNQLWKRFRGDDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG++R+YNVDMIPKF+MANG LVRVLIHTDVTKYL FKAVDGSFVYNK K++KVPATD+E
Sbjct  65    LGTNREYNVDMIPKFMMANGGLVRVLIHTDVTKYLNFKAVDGSFVYNKKKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQD+ E+DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDFEENDPKSHEGLDLNKVTAREVITKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL+EPA++ VK++KLY+ESLARF+GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHIDDSYLDEPAMEFVKKMKLYAESLARFEGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPEC+V+FD+ G   GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAI I
Sbjct  245   YGGTYMLNKPECQVKFDDNGNAIGVTSEGETAKCKKVVCDPSYLPDKVRKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHSVQ+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD P+
Sbjct  305   MSHPIPDTNDSHSVQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGP+DEIF++TYDR+ P N+   D+C+IS+SYD+TTHFESTV DVL MYT 
Sbjct  365   VELKPGIDLLGPLDEIFYDTYDRYVPTNDHQADSCYISSSYDATTHFESTVQDVLAMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             +TGK LDL+VDLSAASA  E
Sbjct  425   LTGKALDLSVDLSAASATAE  444



>ref|XP_002461825.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
 gb|EER98346.1| hypothetical protein SORBIDRAFT_02g008810 [Sorghum bicolor]
Length=446

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEQTPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDM+PKF+MANGALVRVLIHT VTKY+ FKAVDGS+V+NKGK+HKVP+ DME
Sbjct  65    IGASRDYNVDMVPKFMMANGALVRVLIHTGVTKYMSFKAVDGSYVFNKGKIHKVPSNDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF+YVQDY E D  TH G DLT++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLYVQDYKEDDRSTHKGYDLTKLTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YL EPA+DTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHRDDSYLTEPAIDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+KPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKV RAIAI
Sbjct  245   YGGTYMLSKPECKVEFDSEGKVCGVTSEGETAKCKKVVCDPSYLPNKVKKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT +SHSVQIILPQKQLGR+SDMY+FCCSY+HNVA KGK+IAFVS +AETD+PE
Sbjct  305   MSHPIPNTAESHSVQIILPQKQLGRRSDMYVFCCSYSHNVASKGKYIAFVSAQAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLG VDE+F +TYDR+EP N+ S DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  365   KELKPGIDLLGTVDELFIDTYDRYEPSNDSSADNCFISTSYDATTHFESTVMDVLSLYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAA++
Sbjct  425   ITGKTVDLSVDLSAASAADD  444



>ref|XP_004504841.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Cicer arietinum]
Length=445

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 402/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGG STSLNL QLWK++RG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDQNDYYGGASTSLNLTQLWKQYRGDDKPPEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
              GSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    FGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEANDPKSHEGLDLNQVTARQLISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA D V R+K Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHLDDSYLDKPAKDFVDRVKTYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP C+VEF ++GK  GVTSEGETAKCKKVVCDPSYLP KV KVGKVARA+ I
Sbjct  245   YGGTYMLNKPACRVEFGDDGKAIGVTSEGETAKCKKVVCDPSYLPDKVHKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV+TEAETD PE
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++ YDRFEP N+ + D CFISTSYD+TTHFE+TV DV+ MY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDIYDRFEPTNDHATDGCFISTSYDATTHFETTVKDVVQMYSK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASA  E
Sbjct  425   ITGKVLDLSVDLSAASATAE  444



>ref|XP_006399435.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
 gb|ESQ40888.1| hypothetical protein EUTSA_v10013547mg [Eutrema salsugineum]
Length=445

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD P  +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQEK  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDNYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCD SYLP KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSAGKAIGVTSAGETAKCKKVVCDSSYLPNKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAP GK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPNGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDTYVPTNNQEEDNCFISGTYDATTHFESTVADVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>ref|XP_006289683.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
 gb|EOA22581.1| hypothetical protein CARUB_v10003247mg [Capsella rubella]
Length=445

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/440 (83%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS  AETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGPVDEIF+ +YD + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPVDEIFYHSYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>ref|XP_010422972.1| PREDICTED: LOW QUALITY PROTEIN: guanosine nucleotide diphosphate 
dissociation inhibitor At5g09550-like [Camelina sativa]
Length=445

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/440 (83%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+ GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDDSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS  AETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI LLGPVDEIF+ +YD + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIXLLGPVDEIFYHSYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>gb|EMS53635.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=424

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/440 (83%), Positives = 397/440 (90%), Gaps = 21/440 (5%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLK                     LWK+FRG +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLK---------------------LWKKFRGEEKPPAH  43

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGSFV++KGK+HKVPATDME
Sbjct  44    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSFVFSKGKIHKVPATDME  103

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRAR FFIYVQDYN++DP+TH G+DLTR+T +ELI K GL D+T+DFI
Sbjct  104   ALKSPLMGIFEKRRARNFFIYVQDYNDADPRTHQGLDLTRMTTRELIAKHGLSDDTIDFI  163

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  164   GHALALHRDDRYLSEPAIDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  223

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAI
Sbjct  224   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLANKVRKIGKVARAIAI  283

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPN NDSHS+QIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  284   MSHPIPNANDSHSIQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  343

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEPSLDNCF+S+SYD+TTHFE+TV DVL MYTL
Sbjct  344   SELKPGIDLLGPVDELFFDMYDRYEPVNEPSLDNCFVSSSYDATTHFETTVTDVLNMYTL  403

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAEE
Sbjct  404   ITGKTVDLSVDLSAASAAEE  423



>ref|XP_010920623.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Elaeis guineensis]
Length=446

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/440 (84%), Positives = 403/440 (92%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKR +G+DKP   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRLKGNDKPEEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGALVRVLIHTGVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARK FIYVQDY ++DPK+H+G+DL +VT KEL  K+GL+DNTVDFI
Sbjct  125   ALKSTLMGLFEKRRARKLFIYVQDYEDNDPKSHEGLDLNKVTTKELFAKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL++PA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALHRDDSYLDDPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTSE ETAKCKKVVCDPSYLP KV+KVG+V RAI I
Sbjct  245   YGGTYMLNKPECKVEFDANGKAYGVTSESETAKCKKVVCDPSYLPDKVKKVGRVTRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMY+FCCSYTHNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPHTNDAHSVQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKYIAFVSTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDE FF+ YDR+EPVN+   DNCFISTSYD+TTHFESTV DVL MY  
Sbjct  365   VELKPGIDLLGPVDETFFDIYDRYEPVNKHDEDNCFISTSYDATTHFESTVQDVLSMYGR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDLSAASAA E
Sbjct  425   ITGKELDLTVDLSAASAASE  444



>emb|CDY21587.1| BnaC09g47050D [Brassica napus]
Length=445

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPEEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDGYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKTLDLSVDLSAASATAE  444



>ref|XP_010030006.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Eucalyptus grandis]
Length=457

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/449 (80%), Positives = 408/449 (91%), Gaps = 9/449 (2%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLH---------MDRNDYYGGESTSLNLVQLWKRF  1422
             YDVIVLGTGLKECILSGLLSVDGLKVL+         +D+NDYYGGESTSLNL QLWKRF
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLYGADGVNYTNVDKNDYYGGESTSLNLNQLWKRF  64

Query  1421  RGSDKPPAELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV  1242
             RG+D PP  LG S++YNVDMIPKF MANGALVRVLIHTDVTKYL FK VDGSFVYNKGK+
Sbjct  65    RGNDNPPESLGPSKEYNVDMIPKFTMANGALVRVLIHTDVTKYLSFKVVDGSFVYNKGKI  124

Query  1241  HKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFG  1062
             +KVPATD+EALKSPLMG+FEKRRARKFFIYVQD+ ESDPK+H+G+DL +VTA+E+I K+G
Sbjct  125   YKVPATDVEALKSPLMGLFEKRRARKFFIYVQDFEESDPKSHEGLDLNKVTAREVISKYG  184

Query  1061  LDDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELP  882
             L+D+T+DFIGHALALH DD Y+++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELP
Sbjct  185   LEDDTIDFIGHALALHIDDSYMDKPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELP  244

Query  881   QAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKV  702
             QAFARLSAVYGGTYMLNKP CKVEFD  GKV GV+SEGETAKCKKVVCDPSYLPGKV+KV
Sbjct  245   QAFARLSAVYGGTYMLNKPHCKVEFDASGKVIGVSSEGETAKCKKVVCDPSYLPGKVKKV  304

Query  701   GKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVS  522
             GKVARAI IMSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GK+IAFV+
Sbjct  305   GKVARAICIMSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVA  364

Query  521   TEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTV  342
              EAETD+P+ ELKPGI+LLGPVDE+FF+ YDR+ P N P +DNCFISTSYD++THFE+TV
Sbjct  365   AEAETDNPQQELKPGIELLGPVDEMFFDIYDRYVPTNNPEVDNCFISTSYDASTHFENTV  424

Query  341   DDVLGMYTLITGKVLDLNVDLSAASAAEE  255
              DVL MY+ ITGKVL+L+VDL+AASAA E
Sbjct  425   TDVLAMYSKITGKVLNLSVDLNAASAATE  453



>ref|XP_009131116.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHT+VTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGTLVQTLIHTNVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D V RIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP DEIF+ +YD + P N+   DNCFIS SYD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPTDEIFYHSYDTYVPTNQQEEDNCFISGSYDATTHFESTVSDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>ref|XP_010930328.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X2 [Elaeis guineensis]
Length=412

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/412 (87%), Positives = 394/412 (96%), Gaps = 0/412 (0%)
 Frame = -2

Query  1490  MDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVRVLIH  1311
             MDRNDYYGG+STSL+L+QLWKRF+ +D+ PA+LGSSR YNVDMIPKF+MANG LVR LIH
Sbjct  1     MDRNDYYGGDSTSLDLIQLWKRFQENDEAPADLGSSRAYNVDMIPKFMMANGTLVRALIH  60

Query  1310  TDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYNES  1131
             TDVTKYLYFKAVDGS+V+NKGK+HKVPATDMEAL+SPLMG+FEKRRARKFFIYVQDY+E+
Sbjct  61    TDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDYDEN  120

Query  1130  DPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYS  951
             DPKTH G+DLTRVT +ELI K+GLDDNTVDFIGHALALHRDDCYL+EPALDTVKR+KLY+
Sbjct  121   DPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDCYLDEPALDTVKRMKLYA  180

Query  950   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSE  771
             ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKV GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGVTSE  240

Query  770   GETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSD  591
             GETA+CKKVVCDPSYLP KV+KVGKVARAIAIMSHPIPNT++SHSVQ+ILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPHKVKKVGKVARAIAIMSHPIPNTDESHSVQVILPQKQLGRKSD  300

Query  590   MYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVN  411
             MYLFCCSY+HNVAPKGKFIAFVSTEAET+ PE ELKPGIDLLGPVD IFF+TYDR+EPVN
Sbjct  301   MYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDRYEPVN  360

Query  410   EPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
             EP LD+CFISTSYD+TTHFESTV DVL +YT ITGK +DL+VDLSAASAA+E
Sbjct  361   EPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGKTVDLSVDLSAASAAKE  412



>ref|NP_196517.3| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
 sp|Q9LXC0.1|GDI_ARATH RecName: Full=Guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550; Short=AtGDI [Arabidopsis thaliana]
 emb|CAB89375.1| GDP dissociation inhibitor [Arabidopsis thaliana]
 gb|AED91409.1| RAB GDP-dissociation inhibitor [Arabidopsis thaliana]
Length=445

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPEEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSEKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP DEIF+ +YD + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPTDEIFYHSYDTYVPTNIQEEDNCFISATYDATTHFESTVVDVLDMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>emb|CDY56553.1| BnaA03g55960D [Brassica napus]
Length=445

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/440 (82%), Positives = 398/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHT+VTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGAVREYNVDMIPKFIMANGTLVQTLIHTNVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D V RIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP DEIF+ +YD + P N+   DNCFIS SYD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPTDEIFYHSYDTYVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKTLDLSVDLSAASATAE  444



>ref|XP_009122523.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Brassica rapa]
Length=445

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA  I
Sbjct  245   YGGTYMLNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAGCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKTLDLSVDLSAASATAE  444



>ref|NP_001150143.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACG38018.1| rab GDP dissociation inhibitor alpha [Zea mays]
 gb|ACN33222.1| unknown [Zea mays]
 tpg|DAA45893.1| TPA: Rab GDP dissociation inhibitor alpha [Zea mays]
Length=447

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/440 (81%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVDGLKVLHMDRNDYYGGES+SLNL +LW RF+G+D PP  
Sbjct  5     YDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGESSSLNLTKLWNRFKGNDSPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLI T VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLNKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKK+VCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAYGVTSEGETAKCKKIVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EPVN P  D CF++ SYDSTTHFE+TV DVL +Y  
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASA E+
Sbjct  425   ITGKELDLSVDLNAASATEQ  444



>gb|EMT30538.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=447

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/439 (82%), Positives = 399/439 (91%), Gaps = 0/439 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSVDGLKVLHMDRNDYYGGESTSLNL ++WKRF+GSD  P  
Sbjct  5     YDVIVLGTGLKECILSGILSVDGLKVLHMDRNDYYGGESTSLNLAKIWKRFKGSDTTPDH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLI T VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E D K+H+G+DL +VT +ELI K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDAKSHEGLDLHKVTTRELISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKF+AFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFVAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDRFEPVN    DNCF++TSYD+TTHFE+TV DVL +Y+ 
Sbjct  365   IELKPGIDLLGPVEETFFDMYDRFEPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSK  424

Query  314   ITGKVLDLNVDLSAASAAE  258
             ITGK LDL+VDL+AASA E
Sbjct  425   ITGKELDLSVDLNAASAGE  443



>gb|EYU39113.1| hypothetical protein MIMGU_mgv1a006401mg [Erythranthe guttata]
Length=445

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/440 (81%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL QLWKR RG D+PP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLTQLWKRLRGDDQPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKF+MANG LVRVLIH +VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFMMANGTLVRVLIHANVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFF++VQD+ ESDPKTH GM+L  +T KELI K+ L+D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFVFVQDFEESDPKTHAGMNLDTITGKELIAKYELEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH +D YL++PA+D VKR+KLY+ESLARFQ GSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHTNDSYLDQPAIDFVKRMKLYAESLARFQSGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+ VGKVARAI I
Sbjct  245   YGGTYMLNKPDCKVEFDENGKAIGVTSEGETAKCKKVVCDPSYLPDKVQPVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T +SHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GK+IAFV TEAETD+PE
Sbjct  305   MSHPIPDTKESHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPRGKYIAFVLTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG+DLLGPVDEIF+ETYDRF P N+  +D+C+ISTSYD+TTHFESTV DVL MYT 
Sbjct  365   VELKPGVDLLGPVDEIFYETYDRFVPTNDTDVDHCYISTSYDATTHFESTVTDVLAMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVL+L+VDLS ASA  E
Sbjct  425   ITGKVLNLSVDLSEASAGTE  444



>gb|KCW87999.1| hypothetical protein EUGRSUZ_A00408 [Eucalyptus grandis]
Length=417

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/440 (82%), Positives = 398/440 (90%), Gaps = 27/440 (6%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDV+VLGTGLKECILSGLLSV+GLKVLHMDRNDYYGGESTSLNLVQLWK+FR SDKPPA 
Sbjct  5     YDVVVLGTGLKECILSGLLSVNGLKVLHMDRNDYYGGESTSLNLVQLWKKFRNSDKPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVT+YLYFKAVDGS+V++KGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTRYLYFKAVDGSYVFSKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL++PLMG+F+KRRARKFFIYVQDY+E+DPKTH+GMDLT +T +ELI K+GLDDNT+DFI
Sbjct  125   ALQTPLMGMFQKRRARKFFIYVQDYDENDPKTHEGMDLTLLTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALHRDD YLNEPALDTVKR+K                           AFARLSAV
Sbjct  185   GHAMALHRDDRYLNEPALDTVKRMK---------------------------AFARLSAV  217

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF++EG+V GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAI+I
Sbjct  218   YGGTYMLNKPECKVEFNDEGQVIGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAISI  277

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIPNTNDSHSVQ+I+PQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS EAETD PE
Sbjct  278   MGHPIPNTNDSHSVQVIIPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPE  337

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG+DLLGPVDEIF++TYDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYTL
Sbjct  338   IELKPGLDLLGPVDEIFYDTYDRYEPVNEPSLDNCFISTSYDATTHFESTVMDVLNMYTL  397

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASAAEE
Sbjct  398   ITGKVLDLSVDLSAASAAEE  417



>gb|EMS53287.1| Rab GDP dissociation inhibitor alpha [Triticum urartu]
Length=447

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/439 (82%), Positives = 399/439 (91%), Gaps = 0/439 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSG+LSVDGLKVLHMDRNDYYGGESTSLNL ++WKRF+GSD  P  
Sbjct  5     YDVIVLGTGLKECILSGILSVDGLKVLHMDRNDYYGGESTSLNLAKIWKRFKGSDTTPDH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLI T VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E D K+H+G++L +VT +ELI K+GL+D+T+DFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDAKSHEGLNLHKVTTRELISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAFGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EPVN    DNCF++TSYD+TTHFE+TV DVL +Y+ 
Sbjct  365   IELKPGIDLLGPVEETFFDMYDRYEPVNAAEEDNCFLTTSYDATTHFETTVKDVLALYSK  424

Query  314   ITGKVLDLNVDLSAASAAE  258
             ITGK LDL+VDL+AASA E
Sbjct  425   ITGKELDLSVDLNAASAGE  443



>ref|XP_009125364.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brassica rapa]
Length=445

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGTLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D V RIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDGYLDQPAMDFVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVNRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVSDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKTLDLSVDLSAASATAE  444



>ref|XP_002871374.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47633.1| rab GDP-dissociation inhibitor [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/440 (82%), Positives = 399/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLG +DEIF+ +Y+ + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGSIDEIFYHSYETYVPTNNQEEDNCFISATYDATTHFESTVVDVLDMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>ref|XP_007159145.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
 gb|ESW31139.1| hypothetical protein PHAVU_002G212600g [Phaseolus vulgaris]
Length=445

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/432 (84%), Positives = 394/432 (91%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFR  DKP   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFREDDKPAEA  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF++ANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK+HKVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMLANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY E+D K+H+G+DL +VTA++LI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEENDTKSHEGLDLNQVTARQLISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA   V+R+K+Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAKGFVERVKVYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYL  KV KVGKV+RAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAIGVTSEGETAKCKKVVCDPSYLSDKVHKVGKVSRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP T+DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGKFIAFV+TEAETD PE
Sbjct  305   MSHPIPETHDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVTTEAETDQPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++ YDRFEP N+   D CFISTSYD TTHFE+TV DV+GMY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDMYDRFEPCNDHEADGCFISTSYDPTTHFETTVKDVVGMYSK  424

Query  314   ITGKVLDLNVDL  279
             ITGK+LDL VDL
Sbjct  425   ITGKILDLCVDL  436



>gb|EMT13930.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=424

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/440 (82%), Positives = 397/440 (90%), Gaps = 21/440 (5%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLK                     LWK+FRG +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLK---------------------LWKKFRGEEKPPAH  43

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDME
Sbjct  44    LGASRDYNVDMVPKFMMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDME  103

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRAR FFIYVQDYN++DP+TH G+DLTR+T +ELI K GL D+T+DFI
Sbjct  104   ALKSPLMGLFEKRRARNFFIYVQDYNDADPRTHQGLDLTRMTTRELIAKHGLSDDTIDFI  163

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  164   GHALALHRDDRYLSEPAIDTVKRMKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  223

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD EGKV GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAI
Sbjct  224   YGGTYMLNKPECKVEFDMEGKVCGVTSEGETAKCKKVVCDPSYLANKVRKIGKVARAIAI  283

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPN NDSHS+QIILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+
Sbjct  284   MSHPIPNANDSHSIQIILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQ  343

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             SELKPGIDLLGPVDE+FF+ YDR+EPVNEPSLDNCF+S+SYD+TTHFE+TV DVL MYTL
Sbjct  344   SELKPGIDLLGPVDELFFDMYDRYEPVNEPSLDNCFVSSSYDATTHFETTVTDVLNMYTL  403

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  404   ITGKTVDLSVDLSAASAAED  423



>ref|XP_002465085.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
 gb|EER92083.1| hypothetical protein SORBIDRAFT_01g031830 [Sorghum bicolor]
Length=447

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/433 (82%), Positives = 398/433 (92%), Gaps = 0/433 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVDGLKVLHMDRNDYYGGES+SLNL++LWKRF+G+D PP  
Sbjct  5     YDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGESSSLNLIKLWKRFKGNDSPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGISKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DLT+VT KE+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLTKVTTKEVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKK+VCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAYGVTSEGETAKCKKIVCDPSYLPEKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EP+N P  D+CF++ SYDSTTHFE+TV DVL +Y  
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPINNPEEDSCFLTNSYDSTTHFETTVKDVLALYNK  424

Query  314   ITGKVLDLNVDLS  276
             ITGK LDL+VDL+
Sbjct  425   ITGKELDLSVDLN  437



>ref|NP_001078054.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
 dbj|BAH19638.1| AT2G44100 [Arabidopsis thaliana]
 gb|AEC10375.1| guanosine nucleotide diphosphate dissociation inhibitor 1 [Arabidopsis 
thaliana]
Length=431

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/426 (84%), Positives = 399/426 (94%), Gaps = 0/426 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK+FRG +K PA 
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKKFRGEEKAPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+V+ +GKV KVPAT ME
Sbjct  65    LGSSRDYNVDMMPKFMMANGKLVRVLIHTDVTKYLSFKAVDGSYVFVQGKVQKVPATPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRA KFF YVQ+Y+E DPKTHDGMDL RVT K+LI KFGL ++T+DFI
Sbjct  125   ALKSPLMGIFEKRRAGKFFSYVQEYDEKDPKTHDGMDLRRVTTKDLIAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH +D +L++PA DTV R+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHAVALHCNDNHLHQPAYDTVMRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV+GVTSEGETAKCKKVVCDPSYL  KVRK+G+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVSGVTSEGETAKCKKVVCDPSYLTNKVRKIGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDS SVQ+ILPQKQLGRKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P+
Sbjct  305   MSHPIPNTNDSQSVQVILPQKQLGRKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PGIDLLGPVDE+FF+ YDR+EPVNEP+LDNCFISTSYD+TTHF++TV DVL MY L
Sbjct  365   TELQPGIDLLGPVDELFFDIYDRYEPVNEPTLDNCFISTSYDATTHFDTTVVDVLNMYKL  424

Query  314   ITGKVL  297
             ITGKV+
Sbjct  425   ITGKVM  430



>gb|KDP29973.1| hypothetical protein JCGZ_18740 [Jatropha curcas]
Length=446

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/432 (82%), Positives = 401/432 (93%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSDKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLNQLWKRFRGSDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKFI+ANG LVRVLIHTDVTKYL FKAVDGS+VYNKGK++KVPA D+E
Sbjct  65    LGTSKEYNVDMIPKFIIANGNLVRVLIHTDVTKYLNFKAVDGSYVYNKGKIYKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY ++DPK+H+G+DL +VTA+++I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDNDPKSHEGLDLNKVTARDIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PALD VKR+KLY+ESLARFQGGSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALHLDDNYLDQPALDFVKRMKLYAESLARFQGGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF  +GK  GVTSEGETAKCKKVVCDPSY+P KV+KVGKV RAI I
Sbjct  245   YGGTYMLNKPECKVEFGADGKAIGVTSEGETAKCKKVVCDPSYMPDKVKKVGKVTRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DSHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGK+IAFVSTEAETD PE
Sbjct  305   MSHPIPNTSDSHSVQLILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVSTEAETDTPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG+DLLGPVDEIF++ YDR+EP+N    DNCF+S SYD+T+HFE+TVDDV+ MY  
Sbjct  365   VELKPGLDLLGPVDEIFYDAYDRYEPINNSEDDNCFVSASYDATSHFETTVDDVIAMYCK  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKALDLSVDL  436



>ref|XP_010452948.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Camelina sativa]
Length=445

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 398/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG+STSLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGKSTSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRR RKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALQSPLMGLFEKRRVRKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+ GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDDSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+ ND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS  AETD+PE
Sbjct  305   MSHPIPDANDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAAAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGPVDEIF+ +YD + P N    DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPVDEIFYHSYDTYVPTNNQEEDNCFISATYDATTHFESTVMDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAA E
Sbjct  425   ITGKTLDLSVDLSAASAAAE  444



>gb|ACL54441.1| unknown [Zea mays]
Length=447

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/440 (81%), Positives = 398/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVDGLKVLHMDRNDYYGGES+SLNL +LW RF+ +D PP  
Sbjct  5     YDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGESSSLNLTKLWNRFKDNDSPPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLI T VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLNKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDSYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKK+VCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAYGVTSEGETAKCKKIVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EPVN P  D CF++ SYDSTTHFE+TV DVL +Y  
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPVNNPDDDCCFLTNSYDSTTHFETTVKDVLALYNK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDL+AASA E+
Sbjct  425   ITGKELDLSVDLNAASATEQ  444



>ref|XP_003608428.1| Rab-GDP dissociation inhibitor [Medicago truncatula]
 gb|AES90625.1| GDP dissociation inhibitor [Medicago truncatula]
Length=445

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/432 (83%), Positives = 398/432 (92%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGG STSLNL QL+KR+RG DKPP E
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDQNDYYGGASTSLNLTQLFKRYRGDDKPPEE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+TVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEANDPKSHEGLDLNQVTARQLISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA D V R+K Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHLDDSYLDKPAKDFVDRVKTYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTS+GETAKCKKVVCDPSYLP KV+ VGKVARAI I
Sbjct  245   YGGTYMLNKPECKVEFDGDGKAIGVTSDGETAKCKKVVCDPSYLPDKVQNVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV+TEAETD P+
Sbjct  305   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVTTEAETDQPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPVDEIF++ YDRFEP N+ + D CFISTSYD TTHFE+TV DV+ MY+ 
Sbjct  365   VELKPGIDLLGPVDEIFYDIYDRFEPTNDHATDGCFISTSYDPTTHFETTVKDVVQMYSK  424

Query  314   ITGKVLDLNVDL  279
             ITGKVLDL+VDL
Sbjct  425   ITGKVLDLSVDL  436



>gb|EEC81843.1| hypothetical protein OsI_25604 [Oryza sativa Indica Group]
Length=469

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/463 (78%), Positives = 406/463 (88%), Gaps = 23/463 (5%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDMIPKF+MANG LVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMIPKFMMANGTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF++VQDY E+DP TH G DL ++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH++D YL EPA+DTVKR+KLY+ES+ RFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKEDNYLTEPAIDTVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECK+EF++EGKV GVTSEGETAKCKKVVCDPSY+P KVRKVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKIEFNDEGKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDM-----------------------YLFCCSYT  564
             MSHPIPNT DSHSVQII+PQKQLGRKSDM                       Y+FCCSY+
Sbjct  305   MSHPIPNTADSHSVQIIIPQKQLGRKSDMQITLGLLVISIIVTKECSLVHARYVFCCSYS  364

Query  563   HNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFI  384
             HNVA KGKFIAFVS +AE+++P +ELKPGIDLLGPVDE+F +TYDRFEP N+PS DNCFI
Sbjct  365   HNVASKGKFIAFVSAQAESENPAAELKPGIDLLGPVDELFIDTYDRFEPTNDPSSDNCFI  424

Query  383   STSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
             STSYD+TTHFESTV DVL +YT ITGK +DL+VDLSAASAAE+
Sbjct  425   STSYDATTHFESTVMDVLSIYTKITGKTVDLSVDLSAASAAED  467



>ref|XP_006584963.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Glycine max]
Length=451

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/432 (83%), Positives = 396/432 (92%), Gaps = 0/432 (0%)
 Frame = -2

Query  1550  GLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYN  1371
             GLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFRG D P   LGSSR+YN
Sbjct  19    GLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLTQLWKRFRGDDTPAENLGSSREYN  78

Query  1370  VDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMG  1191
             VDMIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPATD+EALKSPLMG
Sbjct  79    VDMIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMG  138

Query  1190  IFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHR  1011
             +FEKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+TVDFIGHALALHR
Sbjct  139   LFEKRRARKFFIYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHR  198

Query  1010  DDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLN  831
             DD YL+EPA D V R+K+Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLN
Sbjct  199   DDNYLDEPAKDFVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLN  258

Query  830   KPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNT  651
             KPECKVEFDE GK  GVTSEGETAKCKK+VCDPSYL  KV+KVGKVARAI IMSHPIP+T
Sbjct  259   KPECKVEFDENGKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDT  318

Query  650   NDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGID  471
              DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVA KGK+IAFV+TEAETD+PE ELKPGID
Sbjct  319   KDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGID  378

Query  470   LLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDL  291
             LLGPVDEIF++TYDRFEP N+   D CFISTSYD+TTHFE+TV DV+ +Y+ ITGKVLDL
Sbjct  379   LLGPVDEIFYDTYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDL  438

Query  290   NVDLSAASAAEE  255
             +VDLSAASAA E
Sbjct  439   SVDLSAASAATE  450



>gb|KFK25257.1| hypothetical protein AALP_AA8G088700 [Arabis alpina]
Length=445

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/440 (82%), Positives = 397/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDIPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL SPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALTSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD+ GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDDSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N    DNCFIS +Y ++THFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDTYVPTNNQEEDNCFISGTYCASTHFESTVVDVLEMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASA  E
Sbjct  425   ITGKTLDLSVDLSAASATAE  444



>gb|KCW87997.1| hypothetical protein EUGRSUZ_A00406, partial [Eucalyptus grandis]
Length=475

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/399 (89%), Positives = 383/399 (96%), Gaps = 0/399 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYG ESTSLNL+QLWK+FR SDKPP  
Sbjct  77    YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGAESTSLNLIQLWKKFRNSDKPPPH  136

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDM+PKF+MANG LVRVLIHTDVTKYLYFKAVDG +V+NKGKVHKVPATDME
Sbjct  137   LGSSRDYNVDMVPKFMMANGTLVRVLIHTDVTKYLYFKAVDGGYVFNKGKVHKVPATDME  196

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  197   ALKSPLMGMFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTMDFI  256

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD +L+EPALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  257   GHALALHRDDRFLDEPALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  316

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEF+EEG+V GVTSEGETAKCKKVVCDPSYL  KVRK+GKV+RAI I
Sbjct  317   YGGTYMLNKPECKVEFNEEGQVIGVTSEGETAKCKKVVCDPSYLTNKVRKIGKVSRAICI  376

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTNDSHSVQ+I+PQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVS EAETD PE
Sbjct  377   MSHPIPNTNDSHSVQVIIPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSAEAETDQPE  436

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFIST  378
              ELKPG+DLLGPVDEIF++TYDR+EPVNEPSLDNCFIST
Sbjct  437   IELKPGVDLLGPVDEIFYDTYDRYEPVNEPSLDNCFIST  475



>ref|XP_010691404.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/440 (81%), Positives = 401/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGG STSLNL QLWKRFRG D PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGASTSLNLNQLWKRFRGDDTPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDMIPKF+MAN  LVR+LIHTDVTKYL FKAVDGSFVYNK K++KVPATD+E
Sbjct  65    LGPSKEYNVDMIPKFMMANEVLVRILIHTDVTKYLNFKAVDGSFVYNKSKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY +SDPK+H+G+DL ++TA++LI K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDSDPKSHEGLDLNKITARDLISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ +D YL++PA D VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALYLNDSYLDQPATDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+C V FD+ GKV GV+SEGETAKCKKVVCDPSYLP KV KVG+V RAI I
Sbjct  245   YGGTYMLNKPDCSVVFDDAGKVIGVSSEGETAKCKKVVCDPSYLPEKVHKVGRVTRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T +SHSVQ+ILPQKQLGRKSDMYLFCCSY+HNVA KGK+IAFV+TEAETD+PE
Sbjct  305   MSHPIPDTKESHSVQVILPQKQLGRKSDMYLFCCSYSHNVAAKGKYIAFVTTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDEIF++TYDR+EP N P  D+CFISTSYD+TTHFESTV DV+G+Y  
Sbjct  365   AELKPGIDLLGPVDEIFYDTYDRYEPTNSPETDSCFISTSYDATTHFESTVKDVIGLYNK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL VDL+AASAA E
Sbjct  425   ITGKELDLTVDLNAASAAPE  444



>ref|XP_006649851.1| PREDICTED: rab GDP dissociation inhibitor beta-like [Oryza brachyantha]
Length=447

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/439 (81%), Positives = 398/439 (91%), Gaps = 0/439 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL +LWKRF+G++  P  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTKLWKRFKGNENTPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+K ECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLSKAECKVEFDENGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+ P N    DNCF++ SYD+TTHFE+TV DVLG+Y+ 
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYVPANASEDDNCFVTNSYDATTHFETTVKDVLGLYSK  424

Query  314   ITGKVLDLNVDLSAASAAE  258
             ITGK LDL+VDL+AASA E
Sbjct  425   ITGKELDLSVDLNAASAGE  443



>gb|EMT13931.1| Rab GDP dissociation inhibitor alpha [Aegilops tauschii]
Length=541

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/417 (85%), Positives = 390/417 (94%), Gaps = 0/417 (0%)
 Frame = -2

Query  1505  LKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALV  1326
             L VLHMDRNDYYGG+STSLNL QLWK+FRG DKPPA LGSS+DYNVDM+PKF+MANG LV
Sbjct  123   LMVLHMDRNDYYGGDSTSLNLNQLWKKFRGEDKPPAHLGSSKDYNVDMVPKFMMANGTLV  182

Query  1325  RVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQ  1146
             R LIHT+VTKYL FKAVDGSFV++KGK+HKVPATDMEALKSPLMG+FEKRRAR FFIYVQ
Sbjct  183   RTLIHTNVTKYLSFKAVDGSFVFSKGKIHKVPATDMEALKSPLMGLFEKRRARNFFIYVQ  242

Query  1145  DYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKR  966
             +Y+E+DPKTH G+DLT +T KELI K+GL D+TVDFIGHALALHRDD +LNEPALDTVKR
Sbjct  243   NYDEADPKTHQGLDLTTLTTKELIAKYGLVDDTVDFIGHALALHRDDRHLNEPALDTVKR  302

Query  965   IKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVA  786
             +KLYSESLARFQGGSPYIYPLYGLGELPQ FARLSAVYGGTYML+KPECKVEFD EGK  
Sbjct  303   MKLYSESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLSKPECKVEFDMEGKAC  362

Query  785   GVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQL  606
             GVTSEGETAKCKKVVCDPSYL  KVRK+GKVARAIAIMSHPIPNTN+SHSVQIILPQKQL
Sbjct  363   GVTSEGETAKCKKVVCDPSYLTNKVRKIGKVARAIAIMSHPIPNTNESHSVQIILPQKQL  422

Query  605   GRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDR  426
             GR SDMY+FCCSYTHNVAPKGKFIAFVS EAE+D+ +SELKPGIDLLGPVDE+FF+ YDR
Sbjct  423   GRNSDMYVFCCSYTHNVAPKGKFIAFVSAEAESDNIQSELKPGIDLLGPVDELFFDMYDR  482

Query  425   FEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
             +EPVNEPSLDNCFISTSYD+TTHFE+TV DVL MYT+ITGK +DL+VDLSAASAAEE
Sbjct  483   YEPVNEPSLDNCFISTSYDATTHFETTVTDVLNMYTMITGKTIDLSVDLSAASAAEE  539


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLH  1491
             YDVIVLGTGLKECILSGLLSVDGLK + 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKSIQ  32



>ref|XP_011092452.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Sesamum indicum]
Length=445

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/440 (81%), Positives = 400/440 (91%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGESTSLNL QLWKR RG ++PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESTSLNLNQLWKRLRGDEQPPEY  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDMIPKF+MANG LVRVLIH +VTKYL FKAVDGSFVYNK K++KVPATD+E
Sbjct  65    LGSSREYNVDMIPKFMMANGTLVRVLIHANVTKYLNFKAVDGSFVYNKKKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+ EKRRARKFF++VQD++ES+PKTH GM++   T +ELI K+ LDD+T+DFI
Sbjct  125   ALKSPLMGLLEKRRARKFFLFVQDFDESNPKTHAGMNMDTTTGRELIAKYELDDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH +D YL++PALD VKR+KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALHTNDSYLDQPALDFVKRVKLYAESLARFQSGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFDE GK  GVTSEGETAK KK+VCDPSYLP KV+++GKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDENGKAIGVTSEGETAKGKKIVCDPSYLPDKVQQIGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TN+SHS Q+I+PQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV TEAETD+PE
Sbjct  305   MSHPIPDTNESHSAQVIIPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLTEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+DLLG VDEIF+ETY RF P N+ S DNCFISTSYD+TTHFESTV DVL MYT 
Sbjct  365   TELKPGVDLLGKVDEIFYETYHRFVPTNDGSADNCFISTSYDATTHFESTVMDVLSMYTN  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASA +E
Sbjct  425   ITGKVLDLSVDLSAASAGDE  444



>emb|CDX81131.1| BnaC03g03850D [Brassica napus]
Length=445

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/432 (82%), Positives = 393/432 (91%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGGLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D V RIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N+   DNCFIS SYD+TTHFESTV DVL MYT 
Sbjct  365   EELKPGIELLGPIDEIFYHSYDAYVPTNQQEEDNCFISGSYDATTHFESTVADVLEMYTK  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKTLDLSVDL  436



>emb|CDY44805.1| BnaC02g00820D [Brassica napus]
Length=629

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/436 (82%), Positives = 395/436 (91%), Gaps = 0/436 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLTQLWKRFRGSDTPQEN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+ R+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGAIREYNVDMIPKFIMANGTLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D V RIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAMDFVMRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ I
Sbjct  245   YGGTYMLNKPECKVEFDSSGKAVGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVNRAVCI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD PE
Sbjct  305   MSHPIPDTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDSPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGP+DEIF+ +YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT 
Sbjct  365   DELKPGIELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVADVLEMYTK  424

Query  314   ITGKVLDLNVDLSAAS  267
             ITGK LDL+VDLSAAS
Sbjct  425   ITGKTLDLSVDLSAAS  440



>ref|XP_003558226.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Brachypodium distachyon]
Length=447

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/433 (82%), Positives = 394/433 (91%), Gaps = 0/433 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL ++WKRF+GS+  P  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTKIWKRFKGSESTPDH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLI T VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIRTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDE GK  GVTSEGETAKCKKVVCDPSYL  KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKPECKVEFDESGKAFGVTSEGETAKCKKVVCDPSYLTDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAETD PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAETDKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EPVN P  DNCF++ SYD+TTHFE+TV DVL +Y+ 
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPVNTPEEDNCFLTNSYDATTHFETTVKDVLALYSK  424

Query  314   ITGKVLDLNVDLS  276
             ITGK LDL+VDL+
Sbjct  425   ITGKDLDLSVDLN  437



>emb|CDO97391.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/432 (81%), Positives = 395/432 (91%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGGES+SLNL QLWKRFRG ++PP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGESSSLNLNQLWKRFRGDEQPPEK  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+S++YNVDMIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  65    LGTSKEYNVDMIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRR RKFFI+VQD+ ES+PKTH+GMDL ++TA+ELI K+ L+D+T+DFI
Sbjct  125   ALKSSLMGLFEKRRLRKFFIFVQDFEESNPKTHEGMDLNKITARELISKYELEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL  DD YL++PA+  VKR+KLY+ESLARFQ GSPYIYP+YGLGELPQAFARLSAV
Sbjct  185   GHALALQIDDAYLDQPAMAFVKRVKLYAESLARFQAGSPYIYPMYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP+CKVEFD  GK  GVTSEGETAKCKKVVCDPSYL  KV+KVGKVARAI I
Sbjct  245   YGGTYMLNKPQCKVEFDANGKAYGVTSEGETAKCKKVVCDPSYLSEKVKKVGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP GK+IAFV+TEAETD P+
Sbjct  305   MSHPIPDTNDSHSCQVILPQKQLGRKSDMYLFCCSYAHNVAPNGKYIAFVATEAETDDPQ  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+DLLGPVDEIF+ETYDRFEP N P  D CFIS+SYD TTHFESTV DV+ MY+ 
Sbjct  365   AELKPGVDLLGPVDEIFYETYDRFEPTNCPDADGCFISSSYDGTTHFESTVVDVISMYSK  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKALDLSVDL  436



>ref|XP_010107286.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXC14619.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=463

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/440 (81%), Positives = 396/440 (90%), Gaps = 7/440 (2%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSV+GLKVLHMDRN+YYGGESTSLNL QLWKRFR  D PP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVNGLKVLHMDRNEYYGGESTSLNLHQLWKRFRDGDMPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDMIPKF+MANGALVRVLIHTDVTKYL FKAVDG+FVYNKGK+HKVPA D+E
Sbjct  65    LGSSKEYNVDMIPKFMMANGALVRVLIHTDVTKYLNFKAVDGNFVYNKGKIHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY +SDPK+H+G+DL +VTA++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYEDSDPKSHEGLDLNKVTARDLISKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKL-------YSESLARFQGGSPYIYPLYGLGELPQA  876
             GHALAL+RDD YL+EPALD VKR+KL       Y+ESLARFQGGSPYIYP YGLGELPQ 
Sbjct  185   GHALALYRDDAYLDEPALDFVKRVKLGLSFEKLYAESLARFQGGSPYIYPHYGLGELPQG  244

Query  875   FARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGK  696
             FARLSAVYGGTYML KPECKVEFDE G+  GVTSEGETA+CKKVVCDPSYLP KV+KVGK
Sbjct  245   FARLSAVYGGTYMLGKPECKVEFDENGRAFGVTSEGETARCKKVVCDPSYLPDKVKKVGK  304

Query  695   VARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTE  516
             VARAI IMS PIP+TNDSHS Q+ILPQKQLGRKSD YLFCCSY+HN+APKGK+IAFV TE
Sbjct  305   VARAICIMSQPIPHTNDSHSAQVILPQKQLGRKSDTYLFCCSYSHNIAPKGKYIAFVLTE  364

Query  515   AETDHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDD  336
             AETD P+ ELKPGIDLLGPVDEIFF+ YDRFEP N+   DNCFISTSYD+TTHFE+TV D
Sbjct  365   AETDDPKVELKPGIDLLGPVDEIFFDMYDRFEPTNQNDADNCFISTSYDATTHFETTVQD  424

Query  335   VLGMYTLITGKVLDLNVDLS  276
             V+ MY+ ITGK+L + ++L 
Sbjct  425   VIAMYSKITGKMLIIAINLQ  444



>ref|XP_010547647.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 [Tarenaya hassleriana]
Length=445

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/432 (82%), Positives = 395/432 (91%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRGSD P   
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGSDTPQDN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDMIPKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGASREYNVDMIPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VK+IKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDEYLDQPAIDFVKKIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTS GETAKCKKVVCDPSYL  KV+K GKV+RAI I
Sbjct  245   YGGTYMLNKPECKVEFDSDGKAVGVTSAGETAKCKKVVCDPSYLSDKVQKGGKVSRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+D+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE
Sbjct  305   MSHPIPDTSDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG+DLLGPVDEIF+++YD + P N+   D+CFIS +YD++THFESTV DVL MYT 
Sbjct  365   EELKPGVDLLGPVDEIFYDSYDIYLPSNDAEKDHCFISATYDASTHFESTVVDVLQMYTK  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKTLDLSVDL  436



>ref|XP_010520728.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550-like [Tarenaya hassleriana]
Length=445

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/432 (82%), Positives = 393/432 (91%), Gaps = 0/432 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG D PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKRFRGDDAPPDN  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSR+YNVDM PKFIMANG LV+ LIHTDVTKYL FKAVDGSFVY KGK++KVPATD+E
Sbjct  65    LGSSREYNVDMTPKFIMANGLLVQTLIHTDVTKYLNFKAVDGSFVYKKGKIYKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY+E DPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  125   ALKSTLMGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLNKVTAREIISKYGLEDDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD YL++PA+D VK+IKLY+ESLARF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHNDDDYLDQPAIDFVKKIKLYAESLARFHGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFD +GK  GVTS GETAKCKKVVCDPSYLP KV+K GKVA AI I
Sbjct  245   YGGTYMLNKPECKVEFDSDGKAVGVTSSGETAKCKKVVCDPSYLPDKVQKGGKVAGAIGI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+D+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD PE
Sbjct  305   MSHPIPDTSDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPG+DLLGPVDEIF+++YD + P N+P  D+CFIS +YD++THFESTV DVL MYT 
Sbjct  365   AELKPGVDLLGPVDEIFYDSYDTYLPSNDPEKDHCFISATYDASTHFESTVMDVLQMYTK  424

Query  314   ITGKVLDLNVDL  279
             ITGK LDL+VDL
Sbjct  425   ITGKTLDLSVDL  436



>ref|NP_001049717.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|ABF95264.1| Rab GDP dissociation inhibitor alpha, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11631.1| Os03g0277000 [Oryza sativa Japonica Group]
 gb|EAY89454.1| hypothetical protein OsI_10987 [Oryza sativa Indica Group]
 gb|EAZ26447.1| hypothetical protein OsJ_10334 [Oryza sativa Japonica Group]
 dbj|BAG94640.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/433 (81%), Positives = 391/433 (90%), Gaps = 0/433 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVDGLKVLHMDRNDYYGGESTSLNL +LWKRF+G++  P  
Sbjct  5     YDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGESTSLNLTKLWKRFKGNETAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDM+PKF+MANGALVRVLIHT VTKYL FKAVDGSFVYN GK+HKVPATD+E
Sbjct  65    LGVSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFKAVDGSFVYNNGKIHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRARKFFIYVQDY E DPK+H+G+DL +VT +E+I K+GL+D+TVDFI
Sbjct  125   ALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGLDLHKVTTREVISKYGLEDDTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YL+EPA+DTVKR+KLY+ESLARFQGGSPYIYPLYGL ELPQAFARLSAV
Sbjct  185   GHALALHRDDNYLDEPAIDTVKRMKLYAESLARFQGGSPYIYPLYGLAELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNK ECKVEFDE GK  GVTSEGETAKCKKVVCDPSYLP KV+KVG+VARAI I
Sbjct  245   YGGTYMLNKAECKVEFDENGKAYGVTSEGETAKCKKVVCDPSYLPDKVKKVGRVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             M HPIP+T DSHSVQIILP+KQL RKSDMY+FCCSY HNVAPKGKFIAFVSTEAE D PE
Sbjct  305   MKHPIPDTKDSHSVQIILPKKQLKRKSDMYVFCCSYAHNVAPKGKFIAFVSTEAEADKPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGIDLLGPV+E FF+ YDR+EP N    DNCF++ SYD+TTHFE+TV DVL +Y+ 
Sbjct  365   IELKPGIDLLGPVEETFFDIYDRYEPTNTADEDNCFVTNSYDATTHFETTVKDVLALYSK  424

Query  314   ITGKVLDLNVDLS  276
             ITGK LDL+VDL+
Sbjct  425   ITGKELDLSVDLN  437



>gb|KHG21656.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=426

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/425 (82%), Positives = 394/425 (93%), Gaps = 3/425 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWK F+G DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLTQLWKHFKGEDKPPEQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM   F+MANG+LVR+LIHTDVTKYL FKAVDGSFVYNK K++KVPATD+E
Sbjct  65    LGASRDYNVDM---FMMANGSLVRILIHTDVTKYLNFKAVDGSFVYNKSKIYKVPATDVE  121

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G+DLT+VTAKELI K+GL+D+T+DFI
Sbjct  122   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLTKVTAKELISKYGLEDDTIDFI  181

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+  D YL++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  182   GHALALYSSDNYLDQPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  241

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECK+E+ ++GKV GVTSEGETAKCKKVVCDPSYLP KV+KVGKVARA+ I
Sbjct  242   YGGTYMLNKPECKIEYGDDGKVIGVTSEGETAKCKKVVCDPSYLPDKVKKVGKVARAVCI  301

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+I+PQKQLGRKSDMYLFCCSY HNVAPKGKFIAFVSTEAETD P+
Sbjct  302   MSHPIPDTNDSHSAQVIVPQKQLGRKSDMYLFCCSYAHNVAPKGKFIAFVSTEAETDDPK  361

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+PGI LLGPVDEIF++ YDR+EP N+ + DNCFIS SYD TTHFE+TV+DV+ MYT 
Sbjct  362   VELEPGIKLLGPVDEIFYDNYDRYEPTNDHTADNCFISASYDPTTHFETTVNDVIQMYTK  421

Query  314   ITGKV  300
             ITGK+
Sbjct  422   ITGKI  426



>ref|XP_010930327.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
2 isoform X1 [Elaeis guineensis]
Length=444

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/398 (87%), Positives = 379/398 (95%), Gaps = 0/398 (0%)
 Frame = -2

Query  1490  MDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVRVLIH  1311
             MDRNDYYGG+STSL+L+QLWKRF+ +D+ PA+LGSSR YNVDMIPKF+MANG LVR LIH
Sbjct  1     MDRNDYYGGDSTSLDLIQLWKRFQENDEAPADLGSSRAYNVDMIPKFMMANGTLVRALIH  60

Query  1310  TDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYNES  1131
             TDVTKYLYFKAVDGS+V+NKGK+HKVPATDMEAL+SPLMG+FEKRRARKFFIYVQDY+E+
Sbjct  61    TDVTKYLYFKAVDGSYVFNKGKIHKVPATDMEALRSPLMGLFEKRRARKFFIYVQDYDEN  120

Query  1130  DPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYS  951
             DPKTH G+DLTRVT +ELI K+GLDDNTVDFIGHALALHRDDCYL+EPALDTVKR+KLY+
Sbjct  121   DPKTHGGLDLTRVTTRELISKYGLDDNTVDFIGHALALHRDDCYLDEPALDTVKRMKLYA  180

Query  950   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSE  771
             ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKV GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGVTSE  240

Query  770   GETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSD  591
             GETA+CKKVVCDPSYLP KV+KVGKVARAIAIMSHPIPNT++SHSVQ+ILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPHKVKKVGKVARAIAIMSHPIPNTDESHSVQVILPQKQLGRKSD  300

Query  590   MYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVN  411
             MYLFCCSY+HNVAPKGKFIAFVSTEAET+ PE ELKPGIDLLGPVD IFF+TYDR+EPVN
Sbjct  301   MYLFCCSYSHNVAPKGKFIAFVSTEAETNQPELELKPGIDLLGPVDAIFFDTYDRYEPVN  360

Query  410   EPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVL  297
             EP LD+CFISTSYD+TTHFESTV DVL +YT ITGK  
Sbjct  361   EPLLDSCFISTSYDATTHFESTVMDVLAIYTKITGKTF  398



>gb|EEE59061.1| hypothetical protein OsJ_10849 [Oryza sativa Japonica Group]
Length=431

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/440 (79%), Positives = 392/440 (89%), Gaps = 15/440 (3%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG+STSLNL QLWKRF+G   PPA+
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGDSTSLNLNQLWKRFKGEGTPPAQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             +G+SRDYNVDMIPKF+MANG LVRVLIHT VTKYL FKAVDGS+V+NKGK+HKVP+TDME
Sbjct  65    IGASRDYNVDMIPKFMMANGTLVRVLIHTGVTKYLSFKAVDGSYVFNKGKIHKVPSTDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF++VQDY E+DP TH G DL ++T KELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGLFEKRRAGKFFLFVQDYKENDPSTHKGYDLNKMTTKELISKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+ALH++D YL EPA+DTVKR+KLY+ES+ RFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHAVALHKEDNYLTEPAIDTVKRMKLYAESVGRFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECK+EF++EGKV GVTSEGETAKCKKVVCDPSY+P KVRKVGKV RAIAI
Sbjct  245   YGGTYMLNKPECKIEFNDEGKVCGVTSEGETAKCKKVVCDPSYIPDKVRKVGKVFRAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DSHSVQII+PQKQLGRKSDM               +FIAFVS +AE+++P 
Sbjct  305   MSHPIPNTADSHSVQIIIPQKQLGRKSDM---------------QFIAFVSAQAESENPA  349

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLGPVDE+F +TYDRFEP N+PS DNCFISTSYD+TTHFESTV DVL +YT 
Sbjct  350   AELKPGIDLLGPVDELFIDTYDRFEPTNDPSSDNCFISTSYDATTHFESTVMDVLSIYTK  409

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK +DL+VDLSAASAAE+
Sbjct  410   ITGKTVDLSVDLSAASAAED  429



>ref|XP_010277492.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X2 [Nelumbo nucifera]
Length=426

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/415 (82%), Positives = 384/415 (93%), Gaps = 0/415 (0%)
 Frame = -2

Query  1523  LLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIM  1344
             L S D  KVLHMDRNDYYGGESTSLNL+QLWKRFRG+DKPP  LGSSR+YNVDMIPKF+M
Sbjct  3     LYSDDMEKVLHMDRNDYYGGESTSLNLIQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMM  62

Query  1343  ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARK  1164
             ANGALVRVLIHTDVTKYL FKAVDGSFVYNKG++HKVPATD+EALKS LMG+FEKRRARK
Sbjct  63    ANGALVRVLIHTDVTKYLNFKAVDGSFVYNKGQIHKVPATDVEALKSQLMGLFEKRRARK  122

Query  1163  FFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPA  984
             FFIYVQDY E+DPK+H+G+DL +VTA+++I K+GL+DNTVDFIGHALALH DD YL+EPA
Sbjct  123   FFIYVQDYEENDPKSHEGLDLNKVTARDVISKYGLEDNTVDFIGHALALHIDDKYLDEPA  182

Query  983   LDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFD  804
             +D VKRI+LY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFD
Sbjct  183   MDFVKRIRLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFD  242

Query  803   EEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQII  624
             E GK  GVTSEGETA+CKKVVCDPSYLP KV+KVG+VARAI IMSHPIPNT+DSHSVQ+I
Sbjct  243   ENGKAFGVTSEGETARCKKVVCDPSYLPDKVQKVGRVARAICIMSHPIPNTSDSHSVQVI  302

Query  623   LPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIF  444
             LPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV  EAET+ PE ELKPGI+LLGPV+E+F
Sbjct  303   LPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMF  362

Query  443   FETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDL  279
             F+ YDR+EP+N+  +DNC+ISTSYD+TTHFESTV DV+ MY+ ITGK LDL+VDL
Sbjct  363   FDIYDRYEPINKQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  417



>gb|KCW56943.1| hypothetical protein EUGRSUZ_I02620 [Eucalyptus grandis]
Length=427

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 388/440 (88%), Gaps = 21/440 (5%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLK                     LWKRFRG+D PP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLK---------------------LWKRFRGNDNPPES  43

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG S++YNVDMIPKF MANGALVRVLIHTDVTKYL FK VDGSFVYNKGK++KVPATD+E
Sbjct  44    LGPSKEYNVDMIPKFTMANGALVRVLIHTDVTKYLSFKVVDGSFVYNKGKIYKVPATDVE  103

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQD+ ESDPK+H+G+DL +VTA+E+I K+GL+D+T+DFI
Sbjct  104   ALKSPLMGLFEKRRARKFFIYVQDFEESDPKSHEGLDLNKVTAREVISKYGLEDDTIDFI  163

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALH DD Y+++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  164   GHALALHIDDSYMDKPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAV  223

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP CKVEFD  GKV GV+SEGETAKCKKVVCDPSYLPGKV+KVGKVARAI I
Sbjct  224   YGGTYMLNKPHCKVEFDASGKVIGVSSEGETAKCKKVVCDPSYLPGKVKKVGKVARAICI  283

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+TNDSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GK+IAFV+ EAETD+P+
Sbjct  284   MSHPIPDTNDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQ  343

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPGI+LLGPVDE+FF+ YDR+ P N P +DNCFISTSYD++THFE+TV DVL MY+ 
Sbjct  344   QELKPGIELLGPVDEMFFDIYDRYVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSK  403

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVL+L+VDL+AASAA E
Sbjct  404   ITGKVLNLSVDLNAASAATE  423



>ref|XP_001773747.1| predicted protein [Physcomitrella patens]
 gb|EDQ61364.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/440 (80%), Positives = 395/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG + SLNL QLW++FRG++KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGAAASLNLNQLWQKFRGNEKPPAS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANGALVRVLIHTDVTKYL FKAVDGS+VY +GKV+KVPA D+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGALVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQ+Y+E D KTH+GMDL  VT KE+  KFGLD NTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQNYDEEDAKTHEGMDLRTVTTKEVFEKFGLDANTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD +L+EPALD VKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHSLALHRDDRFLSEPALDFVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDE G+V GVTSEGETAK KKVVCDPSYLP KV+KVGKV RAI  
Sbjct  245   YGGTYMLAKPECKVEFDEMGQVMGVTSEGETAKAKKVVCDPSYLPNKVKKVGKVVRAICF  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DS SVQIILPQKQLGR+SDMY+FCCS++HNVAPKGK+IAFVS E ET++PE
Sbjct  305   MSHPIPNTGDSDSVQIILPQKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PG+ LLG +DE   + YD +EPVN+ SLDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   AELQPGLALLGQIDEKIIDMYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKNLDLSVDLSAASAAEE  444



>ref|XP_001766609.1| predicted protein [Physcomitrella patens]
 gb|EDQ68674.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/440 (80%), Positives = 394/440 (90%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG + SLNL QLW++FRG +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGAAASLNLNQLWQKFRGDEKPPAS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANGALVRVLIHTDVTKYL FKAVDGS+VY +GKV+KVPA D+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGALVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQ+Y+E D KTH+GMDL  VT KE+  KFGLD NTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQNYDEEDAKTHEGMDLRTVTTKEVFEKFGLDANTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD +L+EPALD VKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHSLALHRDDRFLSEPALDFVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDE G+V GVTSEGETAK KKVVCDPSYLP KV+KVGKV RAI  
Sbjct  245   YGGTYMLAKPECKVEFDEMGQVMGVTSEGETAKAKKVVCDPSYLPNKVKKVGKVVRAICF  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT DS SVQIILPQKQLGR+SDMY+FCCS++HNVAPKGK+IAFVS E ET++PE
Sbjct  305   MSHPIPNTGDSDSVQIILPQKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PG+ LLG +DE   + YD +EPVN+ SLDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   AELQPGLSLLGQIDEKIIDMYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTR  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKNLDLSVDLSAASAAEE  444



>gb|KDO49754.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=370

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/370 (92%), Positives = 362/370 (98%), Gaps = 0/370 (0%)
 Frame = -2

Query  1364  MIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  1185
             MIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF
Sbjct  1     MIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  60

Query  1184  EKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDD  1005
             EKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFIGHALALHRDD
Sbjct  61    EKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDD  120

Query  1004  CYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  825
              YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   RYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  824   ECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTND  645
             ECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAIMSHPIPNTND
Sbjct  181   ECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTND  240

Query  644   SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLL  465
             SHSVQ+ILPQKQLGR+SDMYLFCCSY+HNVAPKGKFIAFVSTEAETDHP++ELKPGIDLL
Sbjct  241   SHSVQVILPQKQLGRRSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDHPQTELKPGIDLL  300

Query  464   GPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNV  285
             GPVDEIF++ YDR+EPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+ITGKVLDL+V
Sbjct  301   GPVDEIFYDIYDRYEPVNEPSLDNCFISTSYDATTHFESTVTDVLNMYTMITGKVLDLSV  360

Query  284   DLSAASAAEE  255
             DLSAASAAEE
Sbjct  361   DLSAASAAEE  370



>ref|XP_001768163.1| predicted protein [Physcomitrella patens]
 gb|EDQ67036.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/440 (80%), Positives = 393/440 (89%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG S SLNL QLWK+FRG +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGASASLNLNQLWKKFRGDEKPPAF  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+VYN+GKV+KVP+ D+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGTLVRVLIHTDVTKYLLFKAVDGSYVYNQGKVYKVPSNDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQ+Y E+D KTH+GMDL  V  KEL  KFGLD NT+DF+
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQNYEEADAKTHEGMDLRAVPTKELFEKFGLDANTIDFV  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD +L EPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHSLALHRDDRFLTEPALDTVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDE G+V GVTSEGET K KKVVCDPSYLP KV+KVGKV RAI  
Sbjct  245   YGGTYMLAKPECKVEFDEMGQVVGVTSEGETVKAKKVVCDPSYLPNKVKKVGKVVRAICF  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNT+DS SVQIILPQKQLGR+SDMY+FCCS++HNVAPKGK+IAFVS E ET++PE
Sbjct  305   MSHPIPNTSDSDSVQIILPQKQLGRRSDMYVFCCSHSHNVAPKGKYIAFVSAEVETENPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PG+ LLG +DE   + YD +EPVN+ SLDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   AELEPGLALLGKIDEKIIDMYDMYEPVNDSSLDNCFISKSYDPTTHFETTVQDVLSMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKNLDLSVDLSAASAAEE  444



>ref|XP_010277493.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
 ref|XP_010277494.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X3 [Nelumbo nucifera]
Length=413

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/404 (83%), Positives = 377/404 (93%), Gaps = 0/404 (0%)
 Frame = -2

Query  1490  MDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVRVLIH  1311
             MDRNDYYGGESTSLNL+QLWKRFRG+DKPP  LGSSR+YNVDMIPKF+MANGALVRVLIH
Sbjct  1     MDRNDYYGGESTSLNLIQLWKRFRGNDKPPEHLGSSREYNVDMIPKFMMANGALVRVLIH  60

Query  1310  TDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYNES  1131
             TDVTKYL FKAVDGSFVYNKG++HKVPATD+EALKS LMG+FEKRRARKFFIYVQDY E+
Sbjct  61    TDVTKYLNFKAVDGSFVYNKGQIHKVPATDVEALKSQLMGLFEKRRARKFFIYVQDYEEN  120

Query  1130  DPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYS  951
             DPK+H+G+DL +VTA+++I K+GL+DNTVDFIGHALALH DD YL+EPA+D VKRI+LY+
Sbjct  121   DPKSHEGLDLNKVTARDVISKYGLEDNTVDFIGHALALHIDDKYLDEPAMDFVKRIRLYA  180

Query  950   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSE  771
             ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDE GK  GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDENGKAFGVTSE  240

Query  770   GETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSD  591
             GETA+CKKVVCDPSYLP KV+KVG+VARAI IMSHPIPNT+DSHSVQ+ILPQKQLGRKSD
Sbjct  241   GETARCKKVVCDPSYLPDKVQKVGRVARAICIMSHPIPNTSDSHSVQVILPQKQLGRKSD  300

Query  590   MYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVN  411
             MYLFCCSY HNVAPKGK+IAFV  EAET+ PE ELKPGI+LLGPV+E+FF+ YDR+EP+N
Sbjct  301   MYLFCCSYAHNVAPKGKYIAFVLAEAETNEPEVELKPGIELLGPVEEMFFDIYDRYEPIN  360

Query  410   EPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDL  279
             +  +DNC+ISTSYD+TTHFESTV DV+ MY+ ITGK LDL+VDL
Sbjct  361   KQDVDNCYISTSYDATTHFESTVKDVISMYSRITGKDLDLSVDL  404



>ref|XP_006584964.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X3 [Glycine max]
Length=413

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/412 (82%), Positives = 376/412 (91%), Gaps = 0/412 (0%)
 Frame = -2

Query  1490  MDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVRVLIH  1311
             MDRNDYYGG STSLNL QLWKRFRG D P   LGSSR+YNVDMIPKF+MANGALVRVLIH
Sbjct  1     MDRNDYYGGASTSLNLTQLWKRFRGDDTPAENLGSSREYNVDMIPKFMMANGALVRVLIH  60

Query  1310  TDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYNES  1131
             T+VTKYL FKAVDGSFVYNKGK++KVPATD+EALKSPLMG+FEKRRARKFFIYVQDY  +
Sbjct  61    TNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQDYETN  120

Query  1130  DPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYS  951
             DPK+H+G+DL +VTA++LI K+GL+D+TVDFIGHALALHRDD YL+EPA D V R+K+Y+
Sbjct  121   DPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDDNYLDEPAKDFVDRVKIYA  180

Query  950   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSE  771
             ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDE GK  GVTSE
Sbjct  181   ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDENGKAIGVTSE  240

Query  770   GETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSD  591
             GETAKCKK+VCDPSYL  KV+KVGKVARAI IMSHPIP+T DSHS Q+ILPQKQLGRKSD
Sbjct  241   GETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKDSHSAQVILPQKQLGRKSD  300

Query  590   MYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFETYDRFEPVN  411
             MYLFCCSY HNVA KGK+IAFV+TEAETD+PE ELKPGIDLLGPVDEIF++TYDRFEP N
Sbjct  301   MYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLLGPVDEIFYDTYDRFEPCN  360

Query  410   EPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
             +   D CFISTSYD+TTHFE+TV DV+ +Y+ ITGKVLDL+VDLSAASAA E
Sbjct  361   DHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSVDLSAASAATE  412



>ref|XP_001755959.1| predicted protein [Physcomitrella patens]
 gb|EDQ79244.1| predicted protein [Physcomitrella patens]
Length=444

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/440 (79%), Positives = 393/440 (89%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVD LKVLHMDRNDYYGG + SLNL QLWK+F+G +KPPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDRLKVLHMDRNDYYGGAAASLNLNQLWKKFKGDEKPPAF  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSS++YNVDM+PKF+MANG LVRVLIHTDVTKYL FKAVDGS+VY +GKV+KVP+ D+E
Sbjct  65    LGSSKEYNVDMVPKFMMANGTLVRVLIHTDVTKYLLFKAVDGSYVYKQGKVYKVPSNDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFI+VQ+Y+E+D KTHDGM+L  VT KEL  KFGLD NT+DFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIFVQNYDEADAKTHDGMNLQTVTTKELFEKFGLDANTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALHRDD +L+EPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHSLALHRDDRFLSEPALDTVKRVKLYAESMARFQGGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFDE G+V GVTSEGET K KKVVCDPSYLP KV+KVGKV RAI  
Sbjct  245   YGGTYMLAKPECKVEFDEMGQVMGVTSEGETVKAKKVVCDPSYLPNKVKKVGKVVRAICF  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIPNTN+S SVQIILPQKQLGR+SDMY+FCCS++HN+A K K+IAFVS E ETD PE
Sbjct  305   MSHPIPNTNNSDSVQIILPQKQLGRRSDMYVFCCSHSHNIAAKDKYIAFVSAEVETDTPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL+PG+ LLG +DE   + YD +EPVN+PSLDNCFIS SYD TTHFE+TV DVL MYT 
Sbjct  365   AELEPGLALLGHIDEKIIDMYDMYEPVNDPSLDNCFISKSYDPTTHFETTVQDVLSMYTK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK LDL+VDLSAASAAEE
Sbjct  425   ITGKNLDLSVDLSAASAAEE  444



>gb|EPS65861.1| hypothetical protein M569_08910, partial [Genlisea aurea]
Length=449

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/440 (79%), Positives = 393/440 (89%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMD+NDYYGG+S SL+L QLWKRFRG D+PP +
Sbjct  9     YDVIVLGTGLKECILSGLLSVDGLKVLHMDKNDYYGGDSCSLSLNQLWKRFRGDDQPPEQ  68

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SR+YNVDM+PKF+MANGALVRVLIH +VTKYL FKAVDGSFVYNKGK++KVPATD+E
Sbjct  69    LGASREYNVDMVPKFMMANGALVRVLIHANVTKYLNFKAVDGSFVYNKGKIYKVPATDVE  128

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRR R FFI+VQD+ E+DP TH GMDL  +TAK+LI K+ L+D+T+DFI
Sbjct  129   ALKSSLMGLFEKRRVRNFFIFVQDFEENDPNTHKGMDLQTLTAKQLIAKYELEDDTIDFI  188

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ D  YL +PA+D VKR+KLY+ESLARFQ GSPYIYPLYGLGELPQAFARLSAV
Sbjct  189   GHALALYSDGSYLEQPAIDFVKRMKLYAESLARFQAGSPYIYPLYGLGELPQAFARLSAV  248

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNK ECKVEFD +GK  GVTSEGETAKCKK+VCDPSYLP KV+KVGKV RA+ I
Sbjct  249   YGGTYMLNKTECKVEFDGDGKAIGVTSEGETAKCKKLVCDPSYLPDKVKKVGKVVRAMCI  308

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP T+DSHS Q+ILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFV TE E+D+PE
Sbjct  309   MSHPIPETSDSHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVLTEGESDNPE  368

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              ELKPG++LLG VDEIF+E+YDRF P N+   DNCFIS SYD++THFESTV DVL +YT 
Sbjct  369   EELKPGVELLGGVDEIFYESYDRFVPTNDSVADNCFISKSYDASTHFESTVLDVLELYTK  428

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGKVLDL+VDLSAASA  +
Sbjct  429   ITGKVLDLSVDLSAASAGSD  448



>gb|KDP29761.1| hypothetical protein JCGZ_18696 [Jatropha curcas]
Length=422

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/432 (79%), Positives = 381/432 (88%), Gaps = 27/432 (6%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL QLWKRFRG DKPP  
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLNQLWKRFRGGDKPPES  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDMIPKF+MANGALVR+LIHTDVTKYL FKAVDGSFVYNKGK+HKVPA D+E
Sbjct  65    LGASRDYNVDMIPKFMMANGALVRILIHTDVTKYLNFKAVDGSFVYNKGKIHKVPANDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+G+DLT+V A+++I K+GL+DNTVDFI
Sbjct  125   ALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEGLDLTKVKARDVISKYGLEDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ +D +L+EPALD V R+KLY+ESLARF+GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALYVEDSFLDEPALDFVNRMKLYAESLARFRGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KPECKVEFD +GK  GVTSEGETAKCKKVVCDPSYLP KV+K+GKVARAI I
Sbjct  245   YGGTYMLCKPECKVEFDADGKAYGVTSEGETAKCKKVVCDPSYLPEKVKKIGKVARAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             MSHPIP+T+DSHSVQ+ILPQKQL RKSDMYLFCCSYTHNVAPKGK+IAFV+TEAETD PE
Sbjct  305   MSHPIPHTSDSHSVQVILPQKQLKRKSDMYLFCCSYTHNVAPKGKYIAFVTTEAETDDPE  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELKPGIDLLG                           +SYD+TTHFE+TV+DV+ MY+ 
Sbjct  365   TELKPGIDLLG---------------------------SSYDATTHFETTVEDVIAMYSK  397

Query  314   ITGKVLDLNVDL  279
             ITGK LDL VDL
Sbjct  398   ITGKKLDLKVDL  409



>gb|AFK40299.1| unknown [Lotus japonicus]
Length=370

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/370 (91%), Positives = 352/370 (95%), Gaps = 0/370 (0%)
 Frame = -2

Query  1364  MIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  1185
             M PKFIMANG LVRVLIHTDVTKYLYFKAVDGSFV+NKGKVHKVP+ DMEALKSPLMGIF
Sbjct  1     MNPKFIMANGNLVRVLIHTDVTKYLYFKAVDGSFVFNKGKVHKVPSNDMEALKSPLMGIF  60

Query  1184  EKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDD  1005
             EKRRARKFFIYVQDY+E DPKTHDGMDLTRVT KELI KFGLDDNT+DFIGH+LALHRD+
Sbjct  61    EKRRARKFFIYVQDYDEKDPKTHDGMDLTRVTTKELIAKFGLDDNTIDFIGHSLALHRDE  120

Query  1004  CYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  825
              YL+EPAL+TVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQ FARLSAVYGGTYMLNKP
Sbjct  121   RYLHEPALETVKRMKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKP  180

Query  824   ECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTND  645
             ECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVGKVARAI IMSHPIPNTND
Sbjct  181   ECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPSKVRKVGKVARAICIMSHPIPNTND  240

Query  644   SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLL  465
             S SVQ+ILPQKQLGRKSDMYLFCCSY+HNVAPKGKFIAFVSTEAETD P  ELKPGIDLL
Sbjct  241   SPSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKFIAFVSTEAETDQPAIELKPGIDLL  300

Query  464   GPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNV  285
             GPVDEIFF+ YDRFEPVNEPSLDNCFISTSYD+TTHFESTV DVL MYT+ITGKVLDL+V
Sbjct  301   GPVDEIFFDMYDRFEPVNEPSLDNCFISTSYDATTHFESTVVDVLNMYTMITGKVLDLSV  360

Query  284   DLSAASAAEE  255
             DLSAASAAEE
Sbjct  361   DLSAASAAEE  370



>gb|KHG17909.1| Rab GDP dissociation inhibitor alpha [Gossypium arboreum]
Length=532

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/406 (80%), Positives = 369/406 (91%), Gaps = 7/406 (2%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWK F+G+DKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLMQLWKHFKGNDKPPEQ  64

Query  1394  LGSSRDYNVDMIPK-------FIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHK  1236
             LG+SR+YNVDMIPK       F+MANG+LVR+LIHT VTKYL FKAVDGS+VY K K++K
Sbjct  65    LGTSREYNVDMIPKACKFNLFFMMANGSLVRILIHTGVTKYLNFKAVDGSYVYKKKKIYK  124

Query  1235  VPATDMEALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLD  1056
             VPATD+EALKSPLMG+FEKRRARKFFIYVQDY+E+DPK+H+ +DL +VTAKELI K+GL+
Sbjct  125   VPATDVEALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEKLDLNKVTAKELISKYGLE  184

Query  1055  DNTVDFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQA  876
             D+T+DFIGHALALH +D YL +PAL+ VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQA
Sbjct  185   DDTIDFIGHALALHNEDSYLAQPALNFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQA  244

Query  875   FARLSAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGK  696
             FARLSAVYGGTYMLNKPECKVEFD +GKV GVTSEGETAKC KVVCDPSYL  KV+KVGK
Sbjct  245   FARLSAVYGGTYMLNKPECKVEFDGDGKVIGVTSEGETAKCNKVVCDPSYLSDKVKKVGK  304

Query  695   VARAIAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTE  516
             VARA+ +MSHPIP+TNDSHS Q+ILPQKQLGRKSDMY+FCCSY HNVAPKGK+IAFVS E
Sbjct  305   VARAVCVMSHPIPDTNDSHSAQVILPQKQLGRKSDMYVFCCSYAHNVAPKGKYIAFVSAE  364

Query  515   AETDHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFIST  378
             AETD+PE ELKPG+DLLG VDEIF++TYDR+ P N+   DNCFIS 
Sbjct  365   AETDNPEQELKPGVDLLGSVDEIFYDTYDRYVPTNDHQADNCFISA  410


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  377  SYDSTTHFESTVDDVLGMYTLITGKVLDLNVDLSAASAAEE  255
            SYDSTTHFE+TV DV+ MYT ITGKVLDL+VDLSAASAAEE
Sbjct  492  SYDSTTHFETTVIDVMEMYTKITGKVLDLSVDLSAASAAEE  532



>emb|CDX71860.1| BnaC08g30140D [Brassica napus]
Length=409

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/441 (75%), Positives = 367/441 (83%), Gaps = 37/441 (8%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             Y+VIVLGTGLKECILSGLLSVDG+KVLHMDR+DYYGGESTSLNL QLWK+FRG +K P  
Sbjct  5     YEVIVLGTGLKECILSGLLSVDGVKVLHMDRSDYYGGESTSLNLNQLWKKFRGEEKAPEH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVDM+PKF+M NG LVR LIHTDVTKYL FKAVDGS+V+ KGKV KVP T ME
Sbjct  65    LGASRDYNVDMMPKFMMGNGKLVRTLIHTDVTKYLSFKAVDGSYVFVKGKVQKVPVTPME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIG-KFGLDDNTVDF  1038
             A+KS LMGIFEKRRA KFF Y                L    A  L G KFGLDDNT++F
Sbjct  125   AMKSNLMGIFEKRRAGKFFGY----------------LALRVANHLDGWKFGLDDNTIEF  168

Query  1037  IGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSA  858
             IGHA+ALH +D +L++PALDTV R+KLY+ESLARFQG SPYIYPLYGLGELPQAFARLSA
Sbjct  169   IGHAIALHTNDQHLHQPALDTVMRMKLYAESLARFQGSSPYIYPLYGLGELPQAFARLSA  228

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLNKP+C VEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KV K+G+VARAIA
Sbjct  229   VYGGTYMLNKPDCTVEFDEEGKVTGVTSEGETAKCKKVVCDPSYLPNKVNKIGRVARAIA  288

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIPNTNDSHSVQ+I+PQKQL RKSDMY+FCCSY+HNVAPKGKFIAFVST+AETD+P
Sbjct  289   IMSHPIPNTNDSHSVQVIIPQKQLARKSDMYVFCCSYSHNVAPKGKFIAFVSTDAETDNP  348

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             ++ELK GIDLLGPVDEIFF+                     YD+TTHFE+TV DVL MYT
Sbjct  349   QTELKAGIDLLGPVDEIFFDI--------------------YDATTHFETTVADVLNMYT  388

Query  317   LITGKVLDLNVDLSAASAAEE  255
             LITGK LDL+VDLSAASAAEE
Sbjct  389   LITGKQLDLSVDLSAASAAEE  409



>ref|XP_004962066.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X2 [Setaria italica]
Length=374

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/350 (87%), Positives = 331/350 (95%), Gaps = 0/350 (0%)
 Frame = -2

Query  1349  IMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRA  1170
             +MANG LVR LIHTDVTKYL FKAVDGS+V++KGK+HKVPATDMEALKSPLMG+FEKRRA
Sbjct  1     MMANGTLVRTLIHTDVTKYLSFKAVDGSYVFSKGKIHKVPATDMEALKSPLMGLFEKRRA  60

Query  1169  RKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNE  990
             R FF+YVQ+YNE+DP TH G+DLTR+T +ELI K GL D+TVDFIGHALALHRDDCYLNE
Sbjct  61    RNFFVYVQNYNEADPVTHQGLDLTRITTRELISKHGLSDDTVDFIGHALALHRDDCYLNE  120

Query  989   PALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVE  810
             PALDTVKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVE
Sbjct  121   PALDTVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVE  180

Query  809   FDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQ  630
             FD EGKV GVTSEGETAKCKKVVCDPSYLP KVRK+GKVARAIAIMSHPIPNTNDSHSVQ
Sbjct  181   FDMEGKVCGVTSEGETAKCKKVVCDPSYLPNKVRKIGKVARAIAIMSHPIPNTNDSHSVQ  240

Query  629   IILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDE  450
             IILPQKQLGRKSDMY+FCCSYTHNVAPKGKFIAFVS EAETD+P+SEL+PGIDLLG VDE
Sbjct  241   IILPQKQLGRKSDMYVFCCSYTHNVAPKGKFIAFVSAEAETDNPQSELRPGIDLLGQVDE  300

Query  449   IFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKV  300
             +FF+ YDR+EPVNEPSLDNCF+STSYD+TTHFE+TV DVL MYT ITGKV
Sbjct  301   LFFDMYDRYEPVNEPSLDNCFVSTSYDATTHFETTVTDVLSMYTAITGKV  350



>ref|XP_010030005.1| PREDICTED: guanosine nucleotide diphosphate dissociation inhibitor 
At5g09550 isoform X1 [Eucalyptus grandis]
Length=374

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/370 (82%), Positives = 343/370 (93%), Gaps = 0/370 (0%)
 Frame = -2

Query  1364  MIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  1185
             MIPKF MANGALVRVLIHTDVTKYL FK VDGSFVYNKGK++KVPATD+EALKSPLMG+F
Sbjct  1     MIPKFTMANGALVRVLIHTDVTKYLSFKVVDGSFVYNKGKIYKVPATDVEALKSPLMGLF  60

Query  1184  EKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDD  1005
             EKRRARKFFIYVQD+ ESDPK+H+G+DL +VTA+E+I K+GL+D+T+DFIGHALALH DD
Sbjct  61    EKRRARKFFIYVQDFEESDPKSHEGLDLNKVTAREVISKYGLEDDTIDFIGHALALHIDD  120

Query  1004  CYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  825
              Y+++PALD VKR+KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   SYMDKPALDFVKRMKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  824   ECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTND  645
              CKVEFD  GKV GV+SEGETAKCKKVVCDPSYLPGKV+KVGKVARAI IMSHPIP+TND
Sbjct  181   HCKVEFDASGKVIGVSSEGETAKCKKVVCDPSYLPGKVKKVGKVARAICIMSHPIPDTND  240

Query  644   SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLL  465
             SHS Q+ILPQKQLGRKSDMYLFCCSY HNVAP+GK+IAFV+ EAETD+P+ ELKPGI+LL
Sbjct  241   SHSAQVILPQKQLGRKSDMYLFCCSYAHNVAPQGKYIAFVAAEAETDNPQQELKPGIELL  300

Query  464   GPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNV  285
             GPVDE+FF+ YDR+ P N P +DNCFISTSYD++THFE+TV DVL MY+ ITGKVL+L+V
Sbjct  301   GPVDEMFFDIYDRYVPTNNPEVDNCFISTSYDASTHFENTVTDVLAMYSKITGKVLNLSV  360

Query  284   DLSAASAAEE  255
             DL+AASAA E
Sbjct  361   DLNAASAATE  370



>ref|XP_006584965.1| PREDICTED: rab GDP dissociation inhibitor alpha-like isoform 
X4 [Glycine max]
Length=371

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/370 (82%), Positives = 341/370 (92%), Gaps = 0/370 (0%)
 Frame = -2

Query  1364  MIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIF  1185
             MIPKF+MANGALVRVLIHT+VTKYL FKAVDGSFVYNKGK++KVPATD+EALKSPLMG+F
Sbjct  1     MIPKFMMANGALVRVLIHTNVTKYLNFKAVDGSFVYNKGKIYKVPATDVEALKSPLMGLF  60

Query  1184  EKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDD  1005
             EKRRARKFFIYVQDY  +DPK+H+G+DL +VTA++LI K+GL+D+TVDFIGHALALHRDD
Sbjct  61    EKRRARKFFIYVQDYETNDPKSHEGLDLNQVTARQLISKYGLEDDTVDFIGHALALHRDD  120

Query  1004  CYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  825
              YL+EPA D V R+K+Y+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP
Sbjct  121   NYLDEPAKDFVDRVKIYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKP  180

Query  824   ECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTND  645
             ECKVEFDE GK  GVTSEGETAKCKK+VCDPSYL  KV+KVGKVARAI IMSHPIP+T D
Sbjct  181   ECKVEFDENGKAIGVTSEGETAKCKKIVCDPSYLSDKVQKVGKVARAICIMSHPIPDTKD  240

Query  644   SHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLL  465
             SHS Q+ILPQKQLGRKSDMYLFCCSY HNVA KGK+IAFV+TEAETD+PE ELKPGIDLL
Sbjct  241   SHSAQVILPQKQLGRKSDMYLFCCSYAHNVAAKGKYIAFVTTEAETDNPEVELKPGIDLL  300

Query  464   GPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNV  285
             GPVDEIF++TYDRFEP N+   D CFISTSYD+TTHFE+TV DV+ +Y+ ITGKVLDL+V
Sbjct  301   GPVDEIFYDTYDRFEPCNDHEADGCFISTSYDATTHFETTVKDVVELYSKITGKVLDLSV  360

Query  284   DLSAASAAEE  255
             DLSAASAA E
Sbjct  361   DLSAASAATE  370



>gb|KDO49752.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=342

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/329 (92%), Positives = 323/329 (98%), Gaps = 0/329 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG+++PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KVRKVG+VARAIAI
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDM  588
             MSHPIPNTNDSHSVQ+ILPQKQLGR+SD+
Sbjct  305   MSHPIPNTNDSHSVQVILPQKQLGRRSDI  333



>ref|XP_002955697.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
 gb|EFJ43337.1| hypothetical protein VOLCADRAFT_83359 [Volvox carteri f. nagariensis]
Length=443

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/440 (69%), Positives = 350/440 (80%), Gaps = 3/440 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVD  KVLH+DRN+YYGGES SL+L+QL++RFRG DKPP +
Sbjct  5     YDVIVLGTGLKECIISGLLSVDKKKVLHVDRNNYYGGESASLSLIQLYERFRGGDKPPEK  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKF+MANG LVRVL+HTDV KYL FKAVDGS+V  KGKVHKVPA D E
Sbjct  65    LGPSRDYNVDMVPKFMMANGKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKVHKVPANDTE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL S LMG+FEKRRAR FF+YVQDY ESDPKTH G+DL R+T  EL  ++ L ++T DFI
Sbjct  125   ALSSQLMGLFEKRRARNFFLYVQDYEESDPKTHKGLDLKRMTMSELYKQYDLSEDTQDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHAL LHRDD YL +PAL TV RIKLY ESL R++G  SPY+YP YGLGELPQAFARLSA
Sbjct  185   GHALGLHRDDAYLTQPALATVLRIKLYHESLFRYEGLKSPYLYPRYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLN+P  +V + E G   G+ +  + A+ K VV DPSY PGK R V KV RAIA
Sbjct  245   VYGGTYMLNQPSMEVLY-ENGVAVGIKNGDDVARAKLVVGDPSYFPGKTRVVSKVVRAIA  303

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIPNT+ +HSVQIILPQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +P
Sbjct  304   IMSHPIPNTDSAHSVQIILPQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNP  363

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E +L PG+ LLGPVDE F E  +  EP+ + + D C+IS  YD+TTHFE+TV+DVL MY 
Sbjct  364   EVDLAPGLALLGPVDEKFVEVREVCEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYR  423

Query  317   LITGKVLDLNV-DLSAASAA  261
              ITG+ LDL   DLS    A
Sbjct  424   RITGRDLDLTAKDLSQVENA  443



>ref|XP_005847470.1| hypothetical protein CHLNCDRAFT_35621 [Chlorella variabilis]
 gb|EFN55368.1| hypothetical protein CHLNCDRAFT_35621 [Chlorella variabilis]
Length=445

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/429 (68%), Positives = 349/429 (81%), Gaps = 1/429 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTGLKECI+SGLLSVDGLKVLH+DRN+YYGG+S SLNL QL++RFR   KPPAE
Sbjct  5     YDAIVLGTGLKECIISGLLSVDGLKVLHIDRNNYYGGQSASLNLNQLFERFRPGQKPPAE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVD++PKFIMANG LVRVL+HTDVTKYL FKAVDGS+V NK +V KVPATD E
Sbjct  65    LGPSRDYNVDLVPKFIMANGNLVRVLVHTDVTKYLEFKAVDGSYVLNKAQVQKVPATDWE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRRA KFF + Q Y+E +P+T    DL+R+T  EL  +FGLD  T+DFI
Sbjct  125   ALKSPLMGLFEKRRAAKFFSFCQQYDERNPQTWRNWDLSRMTMHELYAQFGLDAMTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHA+ALH++D Y+ +PA+ TV++IKLY +S+ R++G  SPYIYPLYGLGELPQAFARLSA
Sbjct  185   GHAIALHQNDAYMMQPAMGTVQKIKLYYDSMMRYEGLTSPYIYPLYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYML KP+ +V +DE G   GV+SEGETA+ K VV DP+Y P KVRK  +V RA+ 
Sbjct  245   VYGGTYMLAKPDVEVVYDEAGAAVGVSSEGETARAKFVVGDPTYFPDKVRKSARVVRAMC  304

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             I+SHPIP+TNDSHSVQIILPQKQL R+ D+Y+FCCSY+HNVAP+ K+IAFVST  ET  P
Sbjct  305   ILSHPIPSTNDSHSVQIILPQKQLNRRHDIYVFCCSYSHNVAPRDKWIAFVSTTVETSDP  364

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
              SEL PG+ LLG +DE F E  D FEP+ + S D  FIS  YD+T+HFE+ + DVL +Y 
Sbjct  365   ASELAPGLQLLGRIDEKFVEVVDVFEPLGDGSADKAFISKGYDATSHFETEIHDVLDLYQ  424

Query  317   LITGKVLDL  291
              ITGK LDL
Sbjct  425   RITGKPLDL  433



>gb|AAB09058.1| GDP dissociation inhibitor protein GDIV1p [Volvox carteri f. 
nagariensis]
Length=443

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/440 (68%), Positives = 349/440 (79%), Gaps = 3/440 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVD  KVLH+DRN+YYGGES SL+L+QL++RFRG DKPP +
Sbjct  5     YDVIVLGTGLKECIISGLLSVDKKKVLHVDRNNYYGGESASLSLIQLYERFRGGDKPPEK  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKF+MANG LVRVL+HTDV KYL FKAVDGS+V  KGKVHKVPA   E
Sbjct  65    LGPSRDYNVDMVPKFMMANGKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKVHKVPANRSE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL S LMG+FEKRRAR FF+YVQDY ESDPKTH G+DL R+T  EL  ++ L ++T DFI
Sbjct  125   ALSSQLMGLFEKRRARNFFLYVQDYEESDPKTHKGLDLKRMTMSELYKQYDLSEDTQDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHAL LHRDD YL +PAL TV RIKLY ESL R++G  SPY+YP YGLGELPQAFARLSA
Sbjct  185   GHALGLHRDDAYLTQPALATVLRIKLYHESLFRYEGLKSPYLYPRYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLN+P  +V + E G   G+ +  + A+ K VV DPSY PGK R V KV RAIA
Sbjct  245   VYGGTYMLNQPSMEVLY-ENGVAVGIKNGDDVARAKLVVGDPSYFPGKTRVVSKVVRAIA  303

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIPNT+ +HSVQIILPQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +P
Sbjct  304   IMSHPIPNTDSAHSVQIILPQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETPNP  363

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E +L PG+ LLGPVDE F E  +  EP+ + + D C+IS  YD+TTHFE+TV+DVL MY 
Sbjct  364   EVDLAPGLALLGPVDEKFVEVREVCEPLEDGARDKCYISKGYDATTHFETTVEDVLDMYR  423

Query  317   LITGKVLDLNV-DLSAASAA  261
              ITG+ LDL   DLS    A
Sbjct  424   RITGRDLDLTAKDLSQVENA  443



>emb|CDY65664.1| BnaC09g54770D [Brassica napus]
Length=410

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 335/400 (84%), Gaps = 23/400 (6%)
 Frame = -2

Query  1502  KVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAELGSSRDYNVDMIPKFIMANGALVR  1323
             +VLHMDRND YGGES+SLNL QLWKRFRGSD P   LG+ R+YNVDMIPKFIMANG L+ 
Sbjct  17    QVLHMDRNDSYGGESSSLNLTQLWKRFRGSDTPQENLGAIREYNVDMIPKFIMANGLLL-  75

Query  1322  VLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQD  1143
                               SFVYNKGK++KVPATD+EALKSPLMG+FEKRRARKFFIYVQD
Sbjct  76    ------------------SFVYNKGKIYKVPATDVEALKSPLMGLFEKRRARKFFIYVQD  117

Query  1142  YNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDCYLNEPALDTVKRI  963
             Y+E D K+H+G+DL++VTA+E+I K+GL+D+T+DFIGHALALH DD YL++PA+D VKRI
Sbjct  118   YDEKDSKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALALHNDDDYLDQPAIDFVKRI  177

Query  962   KLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVAG  783
             KLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFD  GK  G
Sbjct  178   KLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDGSGKAIG  237

Query  782   VTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDSHSVQIILPQKQLG  603
             VTS GETAKCKKVVCDPSYL  KV+KVGKV RA+ IMSHPIP+TN++HSVQIILPQKQLG
Sbjct  238   VTSAGETAKCKKVVCDPSYLSDKVKKVGKVTRAVCIMSHPIPDTNEAHSVQIILPQKQLG  297

Query  602   RKSDMYLFCC----SYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLGPVDEIFFET  435
             RKSD+    C    S  HNVAPKGK+IAFVS EAETD+PE ELK GI+LLGP+DEIF+ +
Sbjct  298   RKSDINHSDCVGTYSVAHNVAPKGKYIAFVSAEAETDNPEEELKAGIELLGPIDEIFYHS  357

Query  434   YDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT+
Sbjct  358   YDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTI  397



>ref|XP_005647685.1| rab GDP dissociation inhibitor protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23141.1| rab GDP dissociation inhibitor protein [Coccomyxa subellipsoidea 
C-169]
Length=442

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/438 (67%), Positives = 351/438 (80%), Gaps = 3/438 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTGLKEC+LSGLLSVDGLKVLH+DRN+YYGGES SL+L QL++RFR   +PP  
Sbjct  5     YDAIVLGTGLKECVLSGLLSVDGLKVLHIDRNNYYGGESASLSLQQLFERFRPGQQPPKS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKFIM +G LVRVL+HTDVTKYL FK VDGSFV NKG+V KVPATD E
Sbjct  65    LGPSRDYNVDMVPKFIMNSGELVRVLVHTDVTKYLEFKGVDGSFVQNKGRVEKVPATDYE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPL+G+FEKRR R F ++VQ+Y+ES+PKT  G DL R+    L  ++GLD  TVDFI
Sbjct  125   ALRSPLLGLFEKRRLRNFLLFVQEYDESNPKTQKGYDLRRMPMAALYKEYGLDPMTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHA+ALHRDD Y+ EPAL TVK+I+LY +SL RF+G  SPYIYPLYGLGELPQAFARLSA
Sbjct  185   GHAIALHRDDAYMGEPALATVKKIRLYYDSLMRFEGTSSPYIYPLYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYML+KP+ +V + E G   GVT++GETAK K VV DPSY P KV K  +V RA  
Sbjct  245   VYGGTYMLSKPDAQVAY-ENGVAVGVTADGETAKAKLVVGDPSYFPDKVSKTSRVVRAAC  303

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             I+SHPIPNTN+S S QIILPQKQ+ R+SD+Y+F CS +HNV PK K++AFVST  ET +P
Sbjct  304   ILSHPIPNTNNSASAQIILPQKQVNRRSDIYVFSCSASHNVVPKDKWLAFVSTTVETSNP  363

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E+EL PG+ LLGP DE F +  D +EP+     D CFIS  YD+T+HFE+TV+D+L MYT
Sbjct  364   EAELAPGLALLGPFDEKFVDVVDVYEPLESGQRDKCFISKGYDATSHFETTVEDILEMYT  423

Query  317   LITGKVLDLNV-DLSAAS  267
              ITGKVLDL+  D+S A+
Sbjct  424   RITGKVLDLSSKDVSQAA  441



>gb|KDD75407.1| Rab GDP dissociation inhibitor [Helicosporidium sp. ATCC 50920]
Length=446

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/430 (66%), Positives = 345/430 (80%), Gaps = 1/430 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTGLKECILSGLLSVDGLKVLHMDRN+YYGG+S SLNL QL++RFR   KPP E
Sbjct  5     YDAIVLGTGLKECILSGLLSVDGLKVLHMDRNNYYGGQSASLNLNQLYERFRPGQKPPPE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG+SRDYNVD++PKFIMA G LV+VL+HT+VTKYL FKAVDGS+VYNKG+V KVPATD E
Sbjct  65    LGASRDYNVDLVPKFIMAGGLLVKVLVHTEVTKYLEFKAVDGSYVYNKGRVEKVPATDWE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPL+G+FEKRR  KF  YVQ +  +D  +    DL R+   +L  +FGLD  ++DF+
Sbjct  125   ALRSPLLGLFEKRRVAKFLTYVQRWRAADRSSWQECDLQRMPMADLYKQFGLDAMSIDFL  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHALALHRDD Y+ +PA +TV++IKLY ES+ R++G  SPYIYPLYGLGELPQAFARLSA
Sbjct  185   GHALALHRDDDYMRQPAAETVEKIKLYYESMVRYEGMTSPYIYPLYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYML KP+ +VE+DE GK  GV SEG+TAK   VV DPSY PGKV K  +V RA+ 
Sbjct  245   VYGGTYMLAKPDVQVEYDEAGKAVGVVSEGQTAKASFVVGDPSYFPGKVSKASRVVRALC  304

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             ++SHPIP TND+ S QII+PQKQ+GR+SD+Y+FCCSYTH+VAPK +++AFVST  ET  P
Sbjct  305   LLSHPIPATNDAPSAQIIVPQKQVGRRSDIYIFCCSYTHSVAPKNRWLAFVSTTVETADP  364

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             ++EL PG+ LLG +DE+F E  D +EP      D CFIS  YD+T+HFE+ + DVL +YT
Sbjct  365   KAELAPGLGLLGRIDEMFVEVADVYEPDESGQRDKCFISRGYDATSHFETEIQDVLDIYT  424

Query  317   LITGKVLDLN  288
              ITGK LDL+
Sbjct  425   RITGKSLDLS  434



>ref|XP_002501191.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62449.1| predicted protein [Micromonas sp. RCC299]
Length=445

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/440 (65%), Positives = 346/440 (79%), Gaps = 0/440 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD I+LGTGLKEC+L+GLLSVDG K+LHMDRN YYGGES SLNL QL+++F+   + P  
Sbjct  5     YDAIILGTGLKECLLAGLLSVDGKKILHMDRNSYYGGESASLNLKQLYEKFKPGQELPPH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
              G  +D+N DM+PKF+M NG LVRVL+HT V KYL FKAVDGS+V   GK +KVPA D +
Sbjct  65    YGRWQDWNFDMVPKFMMGNGLLVRVLVHTGVHKYLEFKAVDGSYVVKGGKTYKVPANDKD  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+S LMG+FEK RAR FFI+VQDY + DP+TH G DL  +T++EL  ++GLD NTVDFI
Sbjct  125   ALRSSLMGMFEKYRARSFFIFVQDYEKDDPRTHKGYDLDVITSRELFKEYGLDPNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL  DD ++++PA   V  +KLYSESLARF+  SPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALQTDDSFMDQPARKMVMAVKLYSESLARFETNSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML KP+ +V +DE GK  GV+SEGETAK K VV DPSY PGKVR+VG+V RAI I
Sbjct  245   YGGTYMLAKPDAEVVYDEAGKACGVSSEGETAKAKYVVGDPSYFPGKVRRVGQVVRAICI  304

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             +SHPIPN  DSHSVQII+PQKQ GR+SDMY+F CS+ HNV  KGK++AFVST  ET +P 
Sbjct  305   LSHPIPNVGDSHSVQIIIPQKQTGRQSDMYVFGCSFAHNVCAKGKYLAFVSTAVETANPT  364

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +EL PG+ LLG +DE F +  D  EPVN+ S D C+IS  YD+TTHF+STV+DVL MY  
Sbjct  365   AELIPGLQLLGAIDEYFVQVSDVMEPVNDGSEDGCYISKGYDATTHFQSTVEDVLEMYKK  424

Query  314   ITGKVLDLNVDLSAASAAEE  255
             ITGK ++L+ D  AA+A +E
Sbjct  425   ITGKDVNLDADDPAATAGQE  444



>gb|KFM24244.1| putative secretory pathway GDP dissociation inhibitor 1 [Auxenochlorella 
protothecoides]
Length=448

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/431 (66%), Positives = 344/431 (80%), Gaps = 2/431 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTGLKECI+SGLLSVDG KVLH+DRN+YYGG+S SLNL QL++RFR   KP  E
Sbjct  5     YDAIVLGTGLKECIISGLLSVDGYKVLHIDRNNYYGGQSASLNLNQLFERFRPGQKPQTE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRD+NVD++PKFIMANG LV+VLIHTDVTKYL FKAVDGSFV NK +V KVPA+D E
Sbjct  65    LGPSRDFNVDLVPKFIMANGNLVKVLIHTDVTKYLEFKAVDGSFVLNKNRVEKVPASDWE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPL+G+FEKRRA KF  YVQ Y+ +DP+T+ G DL RVT  EL  ++GLD  TVDF+
Sbjct  125   ALKSPLLGLFEKRRAAKFLGYVQQYDPADPQTYKGQDLRRVTMAELYSQYGLDAMTVDFM  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHALALH DD Y+  PAL+TV +IKLY +S+ R++G  SPYIYPLYGLGELPQAFARLSA
Sbjct  185   GHALALHSDDSYMRRPALETVLKIKLYYDSMMRYEGLKSPYIYPLYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFD-EEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAI  681
             VYGGTYML K + +V +D + G+  GV SEG+TA  K VV D SY P KV++  +V RA+
Sbjct  245   VYGGTYMLAKADAEVVYDADSGRAMGVKSEGQTATAKFVVGDASYFPSKVQRTSRVVRAL  304

Query  680   AIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDH  501
              ++SHPIP+T DSHSVQ+ILPQKQ+GR+SD+Y+FCCSY+H+VAPK K++AFVST  ET  
Sbjct  305   CVLSHPIPSTGDSHSVQLILPQKQVGRRSDIYVFCCSYSHHVAPKDKWLAFVSTTVETTD  364

Query  500   PESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMY  321
             P +EL  G+ LLG +DE F E  D FEP+     D CFIS  YD+T+HFE+ ++DVL MY
Sbjct  365   PTAELAAGLQLLGKIDEKFVEVVDVFEPLESGQRDGCFISRGYDATSHFETEIEDVLDMY  424

Query  320   TLITGKVLDLN  288
               ITGKVLDL+
Sbjct  425   LRITGKVLDLS  435



>ref|XP_001694920.1| rab GDP dissociation inhibitor protein [Chlamydomonas reinhardtii]
 gb|EDP02072.1| rab GDP dissociation inhibitor protein [Chlamydomonas reinhardtii]
Length=442

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/429 (69%), Positives = 346/429 (81%), Gaps = 2/429 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECI+SGLLSVD  KVLH+DRN+YYGGES SLNL+QL++RFR    PP  
Sbjct  5     YDVIVLGTGLKECIISGLLSVDKKKVLHVDRNNYYGGESASLNLIQLFERFRAGAAPPPS  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVDM+PKF++ANG LVRVL+HTDV KYL FKAVDGS+V  KGK+HKVPA D E
Sbjct  65    LGPSRDYNVDMVPKFMLANGKLVRVLLHTDVVKYLEFKAVDGSYVLQKGKIHKVPANDSE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL+SPLMG+FEKRRAR FF+YVQDY+ESDPKTH G+DL R+T  EL   + L ++T DFI
Sbjct  125   ALRSPLMGLFEKRRARNFFLYVQDYDESDPKTHKGLDLNRMTMAELYKHYDLTEDTQDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQG-GSPYIYPLYGLGELPQAFARLSA  858
             GHALALHRDD YL + A+ TV RIKLY ESL R++G  SPY+YP YGLGELPQAFARLSA
Sbjct  185   GHALALHRDDAYLTQSAMPTVLRIKLYHESLFRYEGLNSPYLYPRYGLGELPQAFARLSA  244

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             VYGGTYMLN+P  +V + E G   G+ +  + A+ K VV DPSY P KVR VGKV RAIA
Sbjct  245   VYGGTYMLNQPAVEVLY-ENGVAVGIKNGADVARAKLVVGDPSYFPDKVRVVGKVVRAIA  303

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IM+HPIPNT+++HSVQIILPQKQ GRKSDMY+FCCSY HNVA K K++AFVST  ET +P
Sbjct  304   IMNHPIPNTDNAHSVQIILPQKQTGRKSDMYVFCCSYAHNVAAKDKWLAFVSTTMETANP  363

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E+EL  G+ LLGPV+E + E  D  EP+++ + D  FIS  YD+TTHFE+TVDDVL MY 
Sbjct  364   EAELSAGMALLGPVEEKYIEVRDICEPLDDGTKDQAFISKGYDATTHFETTVDDVLDMYR  423

Query  317   LITGKVLDL  291
              ITG+ LDL
Sbjct  424   RITGRDLDL  432



>ref|XP_010101319.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
 gb|EXB88266.1| Rab GDP dissociation inhibitor alpha [Morus notabilis]
Length=334

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/309 (88%), Positives = 296/309 (96%), Gaps = 0/309 (0%)
 Frame = -2

Query  1181  KRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALALHRDDC  1002
             KRRARKFFIYVQDY+E+DPKTHDG DLTRVT +EL+ K+GLDD T+DFIGHA+ALHRDD 
Sbjct  26    KRRARKFFIYVQDYDENDPKTHDGFDLTRVTTRELVSKYGLDDKTLDFIGHAIALHRDDR  85

Query  1001  YLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPE  822
             YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAVYGGT MLNKPE
Sbjct  86    YLNEPALDTVKRMKLYAESVARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTCMLNKPE  145

Query  821   CKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIPNTNDS  642
             CKVEF+EEGKV GVTSEGETA+CKKVVCDPSYLP KVRKVGKVARAIAIMSHPIPNTNDS
Sbjct  146   CKVEFNEEGKVIGVTSEGETARCKKVVCDPSYLPNKVRKVGKVARAIAIMSHPIPNTNDS  205

Query  641   HSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPGIDLLG  462
             HSVQ+ILPQKQLGR SDMYLFCCSY+HNVAPKGKFIAFVSTEAETD+PE+ELKPG DLLG
Sbjct  206   HSVQVILPQKQLGRISDMYLFCCSYSHNVAPKGKFIAFVSTEAETDNPETELKPGTDLLG  265

Query  461   PVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVLDLNVD  282
             PVDEIF++ YDR+EPVNEP+LDNCFISTSYD+TTHFESTV DVL MYTLITGKV+DL+VD
Sbjct  266   PVDEIFYDMYDRYEPVNEPTLDNCFISTSYDATTHFESTVIDVLNMYTLITGKVVDLSVD  325

Query  281   LSAASAAEE  255
             LSAASAAEE
Sbjct  326   LSAASAAEE  334



>ref|XP_003064630.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51535.1| predicted protein [Micromonas pusilla CCMP1545]
Length=447

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/443 (64%), Positives = 337/443 (76%), Gaps = 3/443 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD I+LGTGLKEC+L+GLLSV+G+K+LHMDRN YYGGES SLNL QLW++FR  +  P  
Sbjct  5     YDAIILGTGLKECLLAGLLSVEGMKILHMDRNSYYGGESASLNLRQLWEKFRPGEPEPTH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
              G  +D+  DM+PKF+M NG LVR L+HT V  YL FKAVDGS+V   GK +KVPATDM+
Sbjct  65    YGRWQDWAFDMVPKFMMGNGLLVRTLVHTSVHNYLQFKAVDGSYVVKGGKTYKVPATDMD  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKS LMG+FEKRRAR FF+YVQDY+E+ P T  G +L  +T++EL  KFGL D TV+FI
Sbjct  125   ALKSSLMGMFEKRRARSFFMYVQDYDETKPDTTKGHNLNVMTSRELFAKFGLQDGTVEFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL+ DD YL+ PAL  VK +KLY ESLARF  GSPYIYPLYGLGELPQ FARLSAV
Sbjct  185   GHALALNVDDAYLDRPALKMVKAVKLYEESLARFNTGSPYIYPLYGLGELPQGFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVA-GVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             YGGTYML KP+ +V +D E K A GVTSEGE+A+ K VV DPSY PGK R++G+V RAI 
Sbjct  245   YGGTYMLAKPDVEVTYDPETKRATGVTSEGESARAKFVVGDPSYFPGKTRRIGRVVRAIC  304

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             I+SHPIPN  D+HSVQIILPQ Q GR+SDMY+F CS+ HNV  KGK++AFVST  ET +P
Sbjct  305   ILSHPIPNCGDAHSVQIILPQAQTGRQSDMYVFGCSWAHNVCAKGKYLAFVSTTVETANP  364

Query  497   ESELKPGIDLLG--PVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGM  324
               E++PG+ LLG  P    F    D   P+ +   D CFIS  YD+TTHFESTV DVL M
Sbjct  365   HLEIEPGLALLGASPFVLFFINVTDVMTPIADGKEDGCFISAGYDATTHFESTVLDVLDM  424

Query  323   YTLITGKVLDLNVDLSAASAAEE  255
             YT ITGK LDL+    AA+AAE 
Sbjct  425   YTRITGKTLDLSEKDPAAAAAER  447



>gb|KDO49753.1| hypothetical protein CISIN_1g013352mg [Citrus sinensis]
Length=328

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/288 (93%), Positives = 282/288 (98%), Gaps = 0/288 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGES+SLNL+QLWKRFRG+++PPA 
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAH  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPKFI+ANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME
Sbjct  65    LGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDY+E+DPKTH+GMDLTRVT +ELI K+GLDDNT+DFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALALHRDD YLNEPALDTVKR+KLY+ES+ARFQGGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKV  711
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYLP KV
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKV  292



>gb|EYU36628.1| hypothetical protein MIMGU_mgv1a0068451mg, partial [Erythranthe 
guttata]
Length=291

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/287 (92%), Positives = 277/287 (97%), Gaps = 0/287 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNL+QLWKRFRGSDKPP +
Sbjct  5     YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLIQLWKRFRGSDKPPPQ  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGSSRDYNVDMIPK+IMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGK+HKVPATDME
Sbjct  65    LGSSRDYNVDMIPKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKIHKVPATDME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTH+GM+LT VT ++LI K+GLDDNTVDFI
Sbjct  125   ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHEGMNLTTVTTRQLIAKYGLDDNTVDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHALAL RDD YL+EPALDTVKR+KLY+ESLARF GGSPYIYPLYGLGELPQAFARLSAV
Sbjct  185   GHALALQRDDRYLDEPALDTVKRMKLYAESLARFAGGSPYIYPLYGLGELPQAFARLSAV  244

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGK  714
             YGGTYMLNKPECKVEFDEEGKV GVTSEGETAKCKKVVCDPSYL  K
Sbjct  245   YGGTYMLNKPECKVEFDEEGKVCGVTSEGETAKCKKVVCDPSYLSNK  291



>ref|XP_002599716.1| hypothetical protein BRAFLDRAFT_131482 [Branchiostoma floridae]
 emb|CAB46230.1| rab GDP-dissociation inhibitor [Branchiostoma floridae]
 gb|EEN55728.1| hypothetical protein BRAFLDRAFT_131482 [Branchiostoma floridae]
Length=446

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/432 (61%), Positives = 333/432 (77%), Gaps = 5/432 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLN-LVQLWKRFRGSDKPPA  1398
             YDVIVLGTGLKECILSGLLSV G KVLHMDRN YYGGES S+  L +L+++F G   PP 
Sbjct  5     YDVIVLGTGLKECILSGLLSVSGKKVLHMDRNKYYGGESASITPLEELYEKF-GLGSPPE  63

Query  1397  ELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKG--KVHKVPAT  1224
              +G  RD+NVD+IPKF+MANG LV++LIH+ VT+YL FK+ +GS+VY  G  K+HKVP T
Sbjct  64    SMGRGRDWNVDLIPKFLMANGMLVKLLIHSGVTRYLEFKSCEGSYVYKSGGNKIHKVPVT  123

Query  1223  DMEALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTV  1044
             + EAL + LMG+FEKRR RKF ++V D +ES+PKTH  +D+ + T +E+   FGLD+NT 
Sbjct  124   EKEALSTSLMGMFEKRRYRKFLMWVNDIDESNPKTHGDIDIGKATMQEVYTHFGLDENTA  183

Query  1043  DFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARL  864
             DF GHALAL RDD Y  +  +DT++RIKLYSESLAR+ G +PY+YPLYGLGELPQ FARL
Sbjct  184   DFTGHALALWRDDNYKQQSCIDTIRRIKLYSESLARY-GKTPYLYPLYGLGELPQGFARL  242

Query  863   SAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARA  684
             SA+YGGTYML+KPECK+ FDE GKV GV S+GETAKC  VVCDP Y   KV+KVG+V R 
Sbjct  243   SAIYGGTYMLDKPECKIHFDENGKVTGVESDGETAKCSAVVCDPGYAGDKVKKVGQVVRC  302

Query  683   IAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD  504
             I I+SHP+PNT DS S Q+I+PQ Q+ RKSD+Y+ C S+ HNVA KGKF+A  ST  ETD
Sbjct  303   ICILSHPVPNTKDSLSCQLIIPQNQVDRKSDIYVCCVSHAHNVASKGKFLAICSTTVETD  362

Query  503   HPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGM  324
             +PE+ELKP ++LLGP+D+ F    D +EP+ + +    F+S++YD+TTHFE+T  D+L +
Sbjct  363   NPEAELKPALNLLGPIDQKFVSVSDLYEPIEDGTNSKLFVSSTYDATTHFETTCLDILDI  422

Query  323   YTLITGKVLDLN  288
             Y   TG+  D  
Sbjct  423   YKRYTGEEFDFT  434



>dbj|BAB97381.1| rab GDP-dissociation inhibitor [Branchiostoma belcheri]
Length=444

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/430 (62%), Positives = 328/430 (76%), Gaps = 3/430 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLN-LVQLWKRFRGSDKPPA  1398
             YDVIVLGTGLKECILSGLLSV G KVLHMDRN YYGGES S+  L +L+++F G   PP 
Sbjct  5     YDVIVLGTGLKECILSGLLSVSGKKVLHMDRNKYYGGESASITPLEELYEKF-GLGSPPE  63

Query  1397  ELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDM  1218
              +G  RD+NVD+IPKF+MANG LV++LIHT VT+YL FK+ +GS+VY  GKVHKVP T+ 
Sbjct  64    TMGRGRDWNVDLIPKFLMANGMLVKLLIHTGVTRYLEFKSCEGSYVYKAGKVHKVPVTEK  123

Query  1217  EALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDF  1038
             EAL + LMG+FEKRR RKF I+V D +ES+P+TH  +D+ + T +E+   FGLD NT DF
Sbjct  124   EALSTSLMGMFEKRRYRKFLIWVNDLDESNPETHKPIDIEKATMQEVYTNFGLDKNTADF  183

Query  1037  IGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSA  858
              GHALAL RDD Y  +  +DT++RIKLYSESLAR+ G +PY+YPLYGLGELPQ FARLSA
Sbjct  184   TGHALALWRDDNYKEQSCVDTIRRIKLYSESLARY-GKTPYLYPLYGLGELPQGFARLSA  242

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             +YGGTYML+K  C ++FDEEGKV GV S GE AKC  VVCDPSY   KV+KVG+V R I 
Sbjct  243   IYGGTYMLDKEGCTIKFDEEGKVIGVESAGEVAKCSAVVCDPSYAADKVKKVGQVVRCIC  302

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             I+SHP+PNT DS S Q+I+PQ Q+ RKSD+Y+ C SY HNVA KGKF+A  ST  ETD+P
Sbjct  303   ILSHPVPNTKDSLSCQLIIPQNQVDRKSDIYVCCVSYAHNVASKGKFLAICSTTVETDNP  362

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E+ELKP + LLGP+D+ F    D FEP+++      F+ST+YD+TTHFE+T  D+L +Y 
Sbjct  363   EAELKPALRLLGPIDQKFVSVSDLFEPIDDGPNSKLFVSTTYDATTHFETTCLDILDIYK  422

Query  317   LITGKVLDLN  288
                G+  D  
Sbjct  423   RYYGEAFDFT  432



>ref|XP_647506.1| Rab GDP dissociation inhibitor alpha [Dictyostelium discoideum 
AX4]
 gb|EAL73470.1| Rab GDP dissociation inhibitor alpha [Dictyostelium discoideum 
AX4]
Length=454

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 335/445 (75%), Gaps = 3/445 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDK-PPA  1398
             YDVIVLGTGLKECI+SGLLSVDG KVLHMDRN YYGGES SLN+ QLW++  G +K  P 
Sbjct  5     YDVIVLGTGLKECIISGLLSVDGKKVLHMDRNGYYGGESASLNMNQLWEKSHGKEKKAPE  64

Query  1397  ELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDM  1218
              LGSSRDYNVD+IPKFI+++G LV++L+HTDVT+YL FK VDGS+VY+ GK++KVP+TD 
Sbjct  65    TLGSSRDYNVDLIPKFILSSGLLVKMLLHTDVTRYLDFKVVDGSYVYSSGKINKVPSTDT  124

Query  1217  EALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDF  1038
             EAL S L+G+ +K   RKFFI+VQ+Y E++P THDG++L   T   L  K+GL +N VDF
Sbjct  125   EALTSSLVGLLDKLPLRKFFIFVQNYEENNPATHDGLNLKITTMDALFKKYGLRENIVDF  184

Query  1037  IGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSA  858
             IGHALAL+ DD YL +PA DT+ R+KLY++SLAR+   SPYIYPLYGLGELPQAFARLSA
Sbjct  185   IGHALALYLDDSYLQQPAHDTIMRMKLYADSLARY-SKSPYIYPLYGLGELPQAFARLSA  243

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             +YGGTYMLNKP   + FDEE K+  VTSEGET  C K+VCDPSY P KV+K GK+ R+I 
Sbjct  244   IYGGTYMLNKPIENIVFDEEKKIIKVTSEGETVTCDKIVCDPSYFPNKVQKKGKIIRSIC  303

Query  677   IMSHPIPNTNDS-HSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDH  501
             I++ PIP+ +    S+QII+PQKQ+ R+SDMY+   S  H V PKGK+IA VS   ET+ 
Sbjct  304   ILNGPIPSADKKFESLQIIIPQKQVKRQSDMYVGVMSSAHCVCPKGKYIAIVSATVETNE  363

Query  500   PESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMY  321
             PE EL P   LLGP+ E F    D  EP+ + + DN FIS SYD+T+HFE+T +DV+ MY
Sbjct  364   PEKELAPAYALLGPIQEKFVYISDFIEPIADGTADNVFISKSYDATSHFETTCEDVMDMY  423

Query  320   TLITGKVLDLNVDLSAASAAEE*GT  246
               ITGK L L V  +     EE G 
Sbjct  424   KRITGKDLVLTVHPNILKQQEEAGN  448



>emb|CDX69899.1| BnaA10g22480D [Brassica napus]
Length=315

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/314 (80%), Positives = 284/314 (90%), Gaps = 0/314 (0%)
 Frame = -2

Query  1196  MGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFIGHALAL  1017
             MG+FEKRRARKFFIYVQDY+E DPK+H+G+DL++VTA+E+I K+GL+D+T+DFIGHALAL
Sbjct  1     MGLFEKRRARKFFIYVQDYDEKDPKSHEGLDLSKVTAREIISKYGLEDDTIDFIGHALAL  60

Query  1016  HRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYM  837
             H DD YL++PA+D VKRIKLY+ESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYM
Sbjct  61    HNDDDYLDQPAIDFVKRIKLYAESLARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYM  120

Query  836   LNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAIMSHPIP  657
             LNKPECKVEFD  GK  GVTS GETAKCKKVVCDPSYL  KV+KVGKVARA+ IMSHPIP
Sbjct  121   LNKPECKVEFDGSGKAIGVTSAGETAKCKKVVCDPSYLSDKVKKVGKVARAVCIMSHPIP  180

Query  656   NTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPESELKPG  477
             +TND+HSVQIILPQKQLGRKSDMYLFCCSY HNVAPKGK+IAFVS EAETD+PE ELKPG
Sbjct  181   DTNDAHSVQIILPQKQLGRKSDMYLFCCSYAHNVAPKGKYIAFVSAEAETDNPEEELKPG  240

Query  476   IDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTLITGKVL  297
             I+LLGP+DEIF+ +YD + P N+   DNCFIS +YD+TTHFESTV DVL MYT ITGK L
Sbjct  241   IELLGPIDEIFYHSYDTYVPTNKQEEDNCFISGTYDATTHFESTVVDVLEMYTKITGKTL  300

Query  296   DLNVDLSAASAAEE  255
             DL+VDLSAASA  E
Sbjct  301   DLSVDLSAASATAE  314



>ref|XP_002739493.1| PREDICTED: rab GDP dissociation inhibitor beta-like [Saccoglossus 
kowalevskii]
Length=444

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/432 (62%), Positives = 335/432 (78%), Gaps = 4/432 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLN-LVQLWKRF-RGSDKPP  1401
             YDVIVLGTGLKEC+LSGLLSV+G KVLHMDRN YYGGES SL  L +L+++F   ++  P
Sbjct  5     YDVIVLGTGLKECVLSGLLSVNGRKVLHMDRNKYYGGESASLTPLSELYEKFGLKAEDVP  64

Query  1400  AELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKG-KVHKVPAT  1224
                G  RD+NVD+IPKF+MANG LV++LIH+ VTKYL FK +DGS+VY KG K++KVPA 
Sbjct  65    ESFGRQRDWNVDLIPKFLMANGQLVKLLIHSGVTKYLEFKTLDGSYVYKKGDKIYKVPAD  124

Query  1223  DMEALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTV  1044
             + EAL + LMGIFEKRR RKF IYV D++ +DPKT+ G+D    T+++L  K GLDDNT 
Sbjct  125   EKEALSTSLMGIFEKRRYRKFLIYVNDFDINDPKTYHGIDPKTATSQDLYHKHGLDDNTA  184

Query  1043  DFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARL  864
             DF GHALALHRDD Y  E  LDT++RIKLYS SL+R+ G SPY+YPLYGLGELPQ FARL
Sbjct  185   DFTGHALALHRDDSYKQENVLDTIERIKLYSSSLSRY-GKSPYLYPLYGLGELPQGFARL  243

Query  863   SAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARA  684
             SA+YGGTYML+KP   + +D+ G+V GVTS GETAKCK VVCDP+Y+  KV+KV +V RA
Sbjct  244   SAIYGGTYMLDKPIEAIVYDDNGEVCGVTSGGETAKCKTVVCDPTYVKDKVKKVAQVVRA  303

Query  683   IAIMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETD  504
             I IM+HPIP TND+ S QII+PQ Q+GRKSD+Y+ C S TH VA KG +IA VST  ETD
Sbjct  304   ICIMNHPIPRTNDNSSCQIIIPQNQVGRKSDIYVSCVSSTHCVAVKGFYIAMVSTTVETD  363

Query  503   HPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGM  324
             +PE+EL+PG+DLLGP+ + F    D   P+++      F++TSYD+TTHFE+T  D+L +
Sbjct  364   NPEAELQPGLDLLGPLKQKFVSVSDILVPIDDGKKSKVFVTTSYDATTHFETTCSDILDV  423

Query  323   YTLITGKVLDLN  288
             +T +TG+  D +
Sbjct  424   WTRMTGEEFDFS  435



>gb|EXX67654.1| Gdi1p [Rhizophagus irregularis DAOM 197198w]
Length=442

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/428 (60%), Positives = 326/428 (76%), Gaps = 1/428 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YDVIVLGTGL ECILSGLLSV+G KVLH+DRNDYYGGES SLNL QL+++FR   +PP+E
Sbjct  5     YDVIVLGTGLTECILSGLLSVEGKKVLHIDRNDYYGGESASLNLTQLYRKFRSGGEPPSE  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG  RDYN+D+IPKF+MANG LVR+L HTDVTKYL FK + GSFVY  GK+ KVPA++ME
Sbjct  65    LGKDRDYNIDLIPKFMMANGELVRILTHTDVTKYLEFKQIAGSFVYRDGKISKVPASEME  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             A++SPLMG+FEKRRA+KFF Y+Q++ E DP TH G+D+  +    +  KFGL+  T DFI
Sbjct  125   AVRSPLMGLFEKRRAKKFFEYMQNWREDDPSTHQGLDINNIPMSAVYEKFGLEPGTQDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GHA+AL+ DD YL  PA ++  RI LY  S+AR+ G SPYIYPLYGLGELPQ FARLSA+
Sbjct  185   GHAMALYLDDSYLTRPARESYNRIILYITSVARY-GKSPYIYPLYGLGELPQGFARLSAI  243

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYML+K   ++ +D  GKV GV S  ETA  K+V+ DPSY P KVRK+GKV RAI +
Sbjct  244   YGGTYMLDKRVDEIVYDANGKVCGVRSGDETAATKQVIGDPSYFPDKVRKIGKVVRAICL  303

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             ++HPIPNT+D+ S+Q+++PQ Q+GRK D+Y+   S THNV  K  ++A VST  E+D+PE
Sbjct  304   LNHPIPNTDDADSIQLVIPQNQVGRKHDIYIASVSGTHNVCAKNYYLAIVSTIVESDNPE  363

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +E+KPG+DLLGP  E      D  EP+ + S D  FIS SYD+T+HF +  +DV  +Y  
Sbjct  364   AEIKPGLDLLGPCVEKVINVTDLEEPIEDGSKDQVFISRSYDATSHFGTVCEDVKSIYKR  423

Query  314   ITGKVLDL  291
             ITG+ L L
Sbjct  424   ITGQDLIL  431



>ref|XP_003286368.1| Rab GDP dissociation inhibitor alpha [Dictyostelium purpureum]
 gb|EGC37087.1| Rab GDP dissociation inhibitor alpha [Dictyostelium purpureum]
Length=452

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 334/447 (75%), Gaps = 6/447 (1%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSD---KP  1404
             YDVIVLGTGLKECI+SGLLSV+G KVLHMDRN YYGGES SLNL QLW++FRG     KP
Sbjct  5     YDVIVLGTGLKECIISGLLSVEGKKVLHMDRNGYYGGESASLNLNQLWEKFRGEQNNGKP  64

Query  1403  PAELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPAT  1224
             PAELG+SRDYNVD+IPKFI+++G LV++L+HTDVT+YL FK VDGS+VY  GK+ KVP+T
Sbjct  65    PAELGASRDYNVDLIPKFILSSGLLVKMLLHTDVTRYLDFKVVDGSYVYQGGKIQKVPST  124

Query  1223  DMEALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTV  1044
             D EAL S L+G+ EK   RKFFIYVQ+Y E+ P+TH+G+ L  ++  +L  KFG+ DN +
Sbjct  125   DKEALSSSLVGLLEKLPLRKFFIYVQNYEENKPETHEGLKLKEMSMSDLFKKFGIKDNLI  184

Query  1043  DFIGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARL  864
             DFIGHA+AL+ DD YLN+PA  TV R+KLY++SLAR+   SPYIYP+YGLGELPQAFARL
Sbjct  185   DFIGHAIALYLDDSYLNQPAFGTVMRMKLYADSLARY-SKSPYIYPMYGLGELPQAFARL  243

Query  863   SAVYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARA  684
             SA+YGGTYMLNKP   + F E+GK+  VTSEGET  C ++VCDPSY P KV+K GK+ R+
Sbjct  244   SAIYGGTYMLNKPIENIVFGEDGKIR-VTSEGETVTCDQIVCDPSYFPDKVQKKGKIIRS  302

Query  683   IAIMSHPIPNTNDS-HSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAET  507
             I +++ P+   +    S+QII+PQKQ+ R+SD+Y+   S  H V PKGKFIA VST  ET
Sbjct  303   ICVLNAPVNGADKKFESLQIIIPQKQVKRESDIYVGVISAPHMVCPKGKFIAIVSTTVET  362

Query  506   DHPESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLG  327
               PE EL P   LLG + E F    D +EP+ +   D  FIS SYD+T+HFE+T +DV+ 
Sbjct  363   ADPEKELAPAYALLGQIQEKFVSISDFYEPIGDGVQDKIFISKSYDATSHFETTCEDVMD  422

Query  326   MYTLITGKVLDLNVDLSAASAAEE*GT  246
             +Y  ITGK L L V  +     +E G 
Sbjct  423   IYKRITGKDLVLTVHPNILKQQQEQGV  449



>dbj|GAM18823.1| hypothetical protein SAMD00019534_019980 [Acytostelium subglobosum 
LB1]
Length=445

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/428 (61%), Positives = 329/428 (77%), Gaps = 2/428 (0%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTG KEC+LSGLLSV+G +VLHMDRN YYGGES SLNL Q++++FR   KP   
Sbjct  5     YDCIVLGTGFKECVLSGLLSVEGKRVLHMDRNSYYGGESASLNLQQMYEKFRNGAKPSET  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LGS RDYN+D++PKFI+A+G LV++L+HTDVT+YL FK VDGSFVY   K+HKVPATD E
Sbjct  65    LGSYRDYNIDLVPKFILASGLLVKMLLHTDVTRYLDFKVVDGSFVYKTPKIHKVPATDSE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             AL SPLMG FEK   +KFF+YVQ++ E  P TH+ +DL ++T K+L  KFGL ++T+DFI
Sbjct  125   ALSSPLMGFFEKFSCKKFFVYVQNFEEDKPATHENLDLKKMTMKQLFAKFGLKEDTIDFI  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALH +D YL +PALDTV +IKLY++SLAR+   SPYIYPLYGLGELPQAFARLSA+
Sbjct  185   GHSLALHLNDEYLEKPALDTVLKIKLYADSLARY-SHSPYIYPLYGLGELPQAFARLSAI  243

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             YGGTYMLNKP  KV   E+GK+  V S+GETA C  V+ DPSY P KV+  GK+ R+I I
Sbjct  244   YGGTYMLNKPIDKVYRGEDGKMR-VESQGETATCDYVIADPSYFPDKVKVTGKIIRSICI  302

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             ++ PIPNTN+S SVQII+PQKQ+GRK+D+Y+   S+ HNV  KGK+IA  ST  ET+ PE
Sbjct  303   LNAPIPNTNNSESVQIIIPQKQVGRKNDIYVGEISFAHNVCAKGKYIAICSTTVETNDPE  362

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
              EL+P   LLGP+ E F    + +EP+ +   DN ++S SYD+T+HFE+T  D++ +Y  
Sbjct  363   KELEPAYKLLGPIVEKFITVSNYYEPIADGCNDNIYLSESYDATSHFETTCQDIMDIYKR  422

Query  314   ITGKVLDL  291
             +  K L L
Sbjct  423   VLKKDLVL  430



>ref|XP_006373016.1| hypothetical protein POPTR_0017s07190g [Populus trichocarpa]
 gb|ERP50813.1| hypothetical protein POPTR_0017s07190g [Populus trichocarpa]
Length=385

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/453 (62%), Positives = 323/453 (71%), Gaps = 85/453 (19%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLL-SVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPA  1398
             YDVIVLGTGLKECILSGL   VDGLKVLHMDRNDYY GESTSLNL QLWK F+GS++PP 
Sbjct  5     YDVIVLGTGLKECILSGLFFVVDGLKVLHMDRNDYYEGESTSLNLNQLWKCFKGSNQPPE  64

Query  1397  ELGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDM  1218
              LG+S++YN+DMIPKFI+AN  LVR+LIHT VTK L FK+VDG+FVYNKGK+HKVPATD+
Sbjct  65    SLGASKEYNIDMIPKFIIANDGLVRILIHTYVTKCLNFKSVDGTFVYNKGKIHKVPATDI  124

Query  1217  EALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDF  1038
             EALK PLMG+FEK RARKFFIYVQDY ++DPK+++G+DLT+VTA+               
Sbjct  125   EALKLPLMGLFEKCRARKFFIYVQDYEDNDPKSYEGLDLTKVTAR---------------  169

Query  1037  IGHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSA  858
                            EPALD VKR+KLY+ES ARFQGGSPYIYPLYGL     +FARLSA
Sbjct  170   ---------------EPALDFVKRVKLYAESFARFQGGSPYIYPLYGL-----SFARLSA  209

Query  857   VYGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIA  678
             +YGGTY+LNKPE K+EFD+  KV GV SEGET +CKKVVC+ SYLP K  KVG VA AI 
Sbjct  210   IYGGTYILNKPEYKIEFDKNRKVIGVISEGETTRCKKVVCNSSYLPNK--KVGMVAHAIC  267

Query  677   IMSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHP  498
             IMSHPIP+T+DSHS Q+ILPQK        YLFCCSY HNVAPK K+I FVSTE E D+P
Sbjct  268   IMSHPIPDTSDSHSAQVILPQK--------YLFCCSYAHNVAPKRKYITFVSTETEIDNP  319

Query  497   ESELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYT  318
             E+ELK GIDLL                           S SYD+TTHFE+TV DV+ MY+
Sbjct  320   ETELKLGIDLL---------------------------SLSYDTTTHFETTVQDVIAMYS  352

Query  317   LITGK------------VLDLNVDLSAASAAEE  255
              ITGK              DL+VDLS  SA  E
Sbjct  353   KITGKQSTYNLVFVLIQTFDLSVDLSVVSATAE  385



>ref|XP_004339226.1| GDPassociated inhibitor, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17213.1| GDPassociated inhibitor, putative [Acanthamoeba castellanii str. 
Neff]
Length=416

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/435 (60%), Positives = 325/435 (75%), Gaps = 24/435 (6%)
 Frame = -2

Query  1574  YDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESTSLNLVQLWKRFRGSDKPPAE  1395
             YD IVLGTGLKEC+LSG+LSV GLKVLHMDRN YYGG+  SLNL QL+++F+G+  PPA 
Sbjct  5     YDCIVLGTGLKECVLSGMLSVGGLKVLHMDRNGYYGGDCASLNLTQLYEKFKGNAAPPAT  64

Query  1394  LGSSRDYNVDMIPKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDME  1215
             LG SRDYNVD+IPKFIMA+G LV++LIHTDVT+YL FK+VDGS+V  +GKVHKVPATD+E
Sbjct  65    LGQSRDYNVDLIPKFIMASGILVKMLIHTDVTRYLEFKSVDGSYVVVQGKVHKVPATDVE  124

Query  1214  ALKSPLMGIFEKRRARKFFIYVQDYNESDPKTHDGMDLTRVTAKELIGKFGLDDNTVDFI  1035
             ALKSPLMG+FEKRR +KFF+YVQ+Y+E++ KTH G DL R+T KEL   +GL ++T+DF+
Sbjct  125   ALKSPLMGMFEKRRCKKFFMYVQEYDENNSKTHQGYDLRRMTMKELFEAYGLGEDTIDFV  184

Query  1034  GHALALHRDDCYLNEPALDTVKRIKLYSESLARFQGGSPYIYPLYGLGELPQAFARLSAV  855
             GH+LALH +D Y                         SPYIYPLYGLGELPQAFARLSA+
Sbjct  185   GHSLALHVNDEYTK-----------------------SPYIYPLYGLGELPQAFARLSAI  221

Query  854   YGGTYMLNKPECKVEFDEEGKVAGVTSEGETAKCKKVVCDPSYLPGKVRKVGKVARAIAI  675
             +GGTYMLNKP  +V   E GKV G+ SEGE A+CK V+ DPSY PGKVR+VG V R I  
Sbjct  222   HGGTYMLNKPVEEV-IMEGGKVVGIKSEGEVARCKFVIGDPSYFPGKVRQVGHVVRTICF  280

Query  674   MSHPIPNTNDSHSVQIILPQKQLGRKSDMYLFCCSYTHNVAPKGKFIAFVSTEAETDHPE  495
             + HPIPNTN+S S QIILPQKQ+GRKSD+Y+   S +HNV  KGKF+A  ST  ET++PE
Sbjct  281   LDHPIPNTNNSESCQIILPQKQIGRKSDIYISVVSSSHNVCAKGKFVAIASTTVETNNPE  340

Query  494   SELKPGIDLLGPVDEIFFETYDRFEPVNEPSLDNCFISTSYDSTTHFESTVDDVLGMYTL  315
             +ELK   DL+GP+ E F        P ++ + D  F+STSYD+T+HFE+T  D+L +Y  
Sbjct  341   AELKAAFDLMGPIIEKFTSVSPMLVPTDDGTSDKIFVSTSYDATSHFETTCIDILDLYKR  400

Query  314   ITGKVLDLNVDLSAA  270
             +TGK  DL+    AA
Sbjct  401   VTGKDADLSPPPKAA  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5588171237268