BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4705_g1_i1 len=483 path=[461:0-482]

Length=483
                                                                      Score     E

ref|XP_007146740.1|  hypothetical protein PHAVU_006G065700g           58.5    2e-07   
ref|XP_002299827.2|  hypothetical protein POPTR_0001s25590g           55.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003551300.1|  PREDICTED: transcription factor DIVARICATA-like  54.3    6e-06   
ref|XP_003538252.1|  PREDICTED: transcription factor DIVARICATA       53.9    8e-06   
gb|KHN30676.1|  Transcription factor MYB1R1                           53.9    8e-06   
ref|XP_011035198.1|  PREDICTED: transcription factor DIVARICATA       53.5    1e-05   
gb|KDP46533.1|  hypothetical protein JCGZ_08505                       52.8    2e-05   
gb|KHG02459.1|  Transcription factor MYB1R1                           52.8    2e-05   
ref|XP_002525595.1|  DNA binding protein, putative                    52.4    2e-05   Ricinus communis
ref|XP_002280403.1|  PREDICTED: transcription factor DIVARICATA       50.8    8e-05   Vitis vinifera
gb|KEH34188.1|  MYB transcription factor MYB51                        50.8    1e-04   
ref|XP_007016182.1|  DIV1A protein                                    50.4    1e-04   
ref|XP_004294268.1|  PREDICTED: transcription factor DIVARICATA-like  49.7    2e-04   
ref|XP_011019148.1|  PREDICTED: transcription factor DIVARICATA-like  49.7    2e-04   
ref|XP_011048394.1|  PREDICTED: protein RADIALIS-like 4               47.0    3e-04   
ref|XP_010033026.1|  PREDICTED: transcription factor DIVARICATA       48.9    4e-04   
ref|XP_002322964.2|  hypothetical protein POPTR_0016s11980g           48.5    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009794315.1|  PREDICTED: transcription factor DIVARICATA-like  48.5    5e-04   
ref|XP_011025809.1|  PREDICTED: protein RADIALIS-like 3               45.8    6e-04   
ref|XP_002313044.2|  hypothetical protein POPTR_0009s11990g           46.2    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002308211.1|  myb family transcription factor family protein   48.5    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006350823.1|  PREDICTED: transcription factor DIVARICATA-like  48.5    6e-04   
ref|XP_011094978.1|  PREDICTED: transcription factor DIVARICATA-like  48.5    6e-04   
ref|XP_004241178.1|  PREDICTED: transcription factor DIVARICATA       48.1    7e-04   
ref|XP_011003665.1|  PREDICTED: transcription factor DIVARICATA-like  48.1    7e-04   
ref|XP_009374277.1|  PREDICTED: transcription factor DIVARICATA-like  48.1    7e-04   
emb|CDP09156.1|  unnamed protein product                              47.8    8e-04   
gb|AFK49214.1|  unknown                                               45.1    8e-04   
ref|XP_004292033.1|  PREDICTED: protein RADIALIS-like 6-like          45.4    0.001   



>ref|XP_007146740.1| hypothetical protein PHAVU_006G065700g [Phaseolus vulgaris]
 gb|ESW18734.1| hypothetical protein PHAVU_006G065700g [Phaseolus vulgaris]
Length=314

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM IL P S Y+ +S+W  + + + TKWTPAENK FE ALA+YDKDTP
Sbjct  1    MKWEMEILPPASPYMYNSNWLMDDNRNNTKWTPAENKLFENALAVYDKDTP  51



>ref|XP_002299827.2| hypothetical protein POPTR_0001s25590g [Populus trichocarpa]
 gb|EEE84632.2| hypothetical protein POPTR_0001s25590g [Populus trichocarpa]
Length=306

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEMGILSP S   S++ W  E S + TKWTPAENKAFE ALA+YD+DTP
Sbjct  1    MKWEMGILSPASYLSSTN-WLLEESKN-TKWTPAENKAFENALAVYDEDTP  49



>ref|XP_003551300.1| PREDICTED: transcription factor DIVARICATA-like [Glycine max]
 gb|KHN06248.1| Transcription factor MYB1R1 [Glycine soja]
Length=321

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWF-HEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM IL P S Y+ +S+W   +   + TKWTPAENK FE ALA+YD+DTP
Sbjct  1    MKWEMEILPPASPYMYNSNWLLDDNRTNNTKWTPAENKLFENALAVYDRDTP  52



>ref|XP_003538252.1| PREDICTED: transcription factor DIVARICATA [Glycine max]
Length=323

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEG--SCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM IL P S Y  +S+W  +   + + TKWTPAENK FE ALA+YDKDTP
Sbjct  1    MKWEMEILPPASPYTYNSNWLLDDNRTNNNTKWTPAENKLFENALAVYDKDTP  53



>gb|KHN30676.1| Transcription factor MYB1R1 [Glycine soja]
Length=323

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEG--SCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM IL P S Y  +S+W  +   + + TKWTPAENK FE ALA+YDKDTP
Sbjct  1    MKWEMEILPPASPYTYNSNWLLDDNRTNNNTKWTPAENKLFENALAVYDKDTP  53



>ref|XP_011035198.1| PREDICTED: transcription factor DIVARICATA [Populus euphratica]
 ref|XP_011035199.1| PREDICTED: transcription factor DIVARICATA [Populus euphratica]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWE GILSP S   S++ W  E S + TKWTPAENKAFE ALA+YD+DTP
Sbjct  1    MKWETGILSPASYLSSTN-WLLEESKN-TKWTPAENKAFENALAVYDEDTP  49



>gb|KDP46533.1| hypothetical protein JCGZ_08505 [Jatropha curcas]
Length=307

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM +LSP S       W  E S S TKWTPAENK FE ALA+YDKDTP
Sbjct  1    MKWEMEVLSPTSYPN----WVMEESKS-TKWTPAENKIFENALAVYDKDTP  46



>gb|KHG02459.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=310

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM ILSP S   S + WF E S S TKWT AENK FE ALA+YDKDTP
Sbjct  1    MKWEMEILSPASYLSSRN-WFGEESKS-TKWTSAENKMFENALAVYDKDTP  49



>ref|XP_002525595.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF36713.1| DNA binding protein, putative [Ricinus communis]
Length=307

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKW++G+LSP S   S++ W  E S + TKWTPAENK FE ALA+YDKDTP
Sbjct  1    MKWDIGVLSPTSYLSSTN-WLIEESKN-TKWTPAENKMFENALAVYDKDTP  49



>ref|XP_002280403.1| PREDICTED: transcription factor DIVARICATA [Vitis vinifera]
 emb|CAN81229.1| hypothetical protein VITISV_033664 [Vitis vinifera]
Length=307

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM ILSP S   +S+    E   SR  WTP ENK FE ALA+YD+DTP
Sbjct  1    MKWEMEILSPASYLSNSNCLLEESKSSR--WTPEENKTFENALAVYDRDTP  49



>gb|KEH34188.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=322

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 14/64 (22%)
 Frame = +1

Query  331  MKWEMGILspdss--------ylssssWFHEGSCSR-----TKWTPAENKAFEKALALYD  471
            MKWEM ILSP+S           ++++WF E  CS      TKWTPAENK FE ALA+YD
Sbjct  1    MKWEMEILSPNSHPHAPFVQNSNNTNNWFLE-DCSNSINRSTKWTPAENKLFENALAVYD  59

Query  472  KDTP  483
            KDTP
Sbjct  60   KDTP  63



>ref|XP_007016182.1| DIV1A protein [Theobroma cacao]
 gb|EOY33801.1| DIV1A protein [Theobroma cacao]
Length=307

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWEM ILSP S   S++ WF E S S TKWTP ENK FE ALA++DKD P
Sbjct  1    MKWEMEILSPTSYISSTN-WFLEESKS-TKWTPEENKMFENALAVHDKDNP  49



>ref|XP_004294268.1| PREDICTED: transcription factor DIVARICATA-like [Fragaria vesca 
subsp. vesca]
Length=301

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MK EMGILSP S +  S+ W  E + S  KWTPAENK FE ALAL+DKDTP
Sbjct  1    MKLEMGILSPSSYFSDSN-WLPEETKS-AKWTPAENKMFENALALHDKDTP  49



>ref|XP_011019148.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=307

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            M  ++GIL P S   +S+  F EG    TKWTP ENK FE ALALYDKDTP
Sbjct  1    MNRDVGILYPASYLQNSNWLFQEGEG--TKWTPEENKQFENALALYDKDTP  49



>ref|XP_011048394.1| PREDICTED: protein RADIALIS-like 4 [Populus euphratica]
Length=100

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  391  FHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            +     SR+ WTP ENK FEKALAL+DKDTP
Sbjct  5    YQASRNSRSAWTPRENKLFEKALALFDKDTP  35



>ref|XP_010033026.1| PREDICTED: transcription factor DIVARICATA [Eucalyptus grandis]
 gb|KCW52561.1| hypothetical protein EUGRSUZ_J01940 [Eucalyptus grandis]
Length=302

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MKWE G+  P     SS++WF        KWTPAENK FEKALA++D+DTP
Sbjct  1    MKWETGV--PLPPCASSANWFFNEDGRTAKWTPAENKMFEKALAVHDQDTP  49



>ref|XP_002322964.2| hypothetical protein POPTR_0016s11980g [Populus trichocarpa]
 gb|EEF04725.2| hypothetical protein POPTR_0016s11980g [Populus trichocarpa]
Length=307

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            M   +G+LSP S   +S+ +FHE     TKWTP ENK FE ALALYDKDTP
Sbjct  1    MNRGIGMLSPASYLQNSNWFFHESRG--TKWTPEENKQFENALALYDKDTP  49



>ref|XP_009794315.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
 ref|XP_009794316.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=312

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +1

Query  388  WFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            WF +   S TKWTPAENKAFE ALAL+DKDTP
Sbjct  15   WFLDEERS-TKWTPAENKAFENALALFDKDTP  45



>ref|XP_011025809.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
 ref|XP_011016702.1| PREDICTED: protein RADIALIS-like 3 [Populus euphratica]
Length=78

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  403  SCSRTKWTPAENKAFEKALALYDKDTP  483
            S S T WTP +NK FEKALALYDKDTP
Sbjct  3    SNSLTSWTPKQNKLFEKALALYDKDTP  29



>ref|XP_002313044.2| hypothetical protein POPTR_0009s11990g [Populus trichocarpa]
 gb|EEE86999.2| hypothetical protein POPTR_0009s11990g [Populus trichocarpa]
Length=113

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +1

Query  391  FHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            +     SR+ WTP ENK FEKALAL+DKDTP
Sbjct  5    YQASRNSRSAWTPRENKLFEKALALFDKDTP  35



>ref|XP_002308211.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE91734.1| myb family transcription factor family protein [Populus trichocarpa]
Length=307

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            M   +GIL P S   +S+  F EG    TKWTP ENK FE ALALYDKDTP
Sbjct  1    MNRGIGILYPASYLQNSNWLFQEGEG--TKWTPEENKQFENALALYDKDTP  49



>ref|XP_006350823.1| PREDICTED: transcription factor DIVARICATA-like [Solanum tuberosum]
Length=307

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +1

Query  388  WFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            WF +   S TKWTPAENKAFE ALAL+DKDTP
Sbjct  15   WFLDEDKS-TKWTPAENKAFEDALALFDKDTP  45



>ref|XP_011094978.1| PREDICTED: transcription factor DIVARICATA-like [Sesamum indicum]
Length=308

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            M  EMG++SP S    SS  F E +   TKWTP ENK FE ALAL+DKDTP
Sbjct  1    MNREMGLVSPASYLSDSSWLFQEDTV--TKWTPEENKRFENALALFDKDTP  49



>ref|XP_004241178.1| PREDICTED: transcription factor DIVARICATA [Solanum lycopersicum]
Length=307

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +1

Query  388  WFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            WF +   S TKWTPAENKAFE ALAL+DKDTP
Sbjct  15   WFLDEGKS-TKWTPAENKAFEDALALFDKDTP  45



>ref|XP_011003665.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=307

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            M   +GILSP S   +S+ +FHE     TKWTP ENK FE ALAL+DKDTP
Sbjct  1    MNRGIGILSPASYLQNSNWFFHESGG--TKWTPEENKQFENALALHDKDTP  49



>ref|XP_009374277.1| PREDICTED: transcription factor DIVARICATA-like [Pyrus x bretschneideri]
Length=306

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +1

Query  331  MKWEMGILspdssylssssWFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            MK+EM ILSP S + +S+    E   +R  WTPAENK FE ALA+YDKD P
Sbjct  1    MKFEMEILSPSSYFATSNRLIEESKSAR--WTPAENKMFENALAVYDKDAP  49



>emb|CDP09156.1| unnamed protein product [Coffea canephora]
Length=286

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +1

Query  388  WFHEGSCSRTKWTPAENKAFEKALALYDKDTP  483
            W  E S S TKWTPAENKAFE ALA++DKDTP
Sbjct  15   WLVEESKS-TKWTPAENKAFENALAVFDKDTP  45



>gb|AFK49214.1| unknown [Lotus japonicus]
Length=70

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -2

Query  482  GVSLSYKARAFSNALFSAGVHFVLLQLPS*NQLEL  378
            GVSLSY ARAFSN+LFSAGVH V L L S +QL L
Sbjct  33   GVSLSYTARAFSNSLFSAGVHLVFL-LSSRSQLVL  66



>ref|XP_004292033.1| PREDICTED: protein RADIALIS-like 6-like [Fragaria vesca subsp. 
vesca]
Length=101

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  409  SRTKWTPAENKAFEKALALYDKDTP  483
            S ++WTP +NK FE+ALALYDKDTP
Sbjct  11   SNSRWTPKQNKVFERALALYDKDTP  35



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517724476692