BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46897_g1_i1 len=201 path=[1:0-200]

Length=201
                                                                      Score     E

ref|XP_007019305.1|  Uncharacterized protein TCM_035327               58.5    2e-08   
emb|CDP10982.1|  unnamed protein product                              57.4    6e-08   
emb|CAG27628.1|  hypothetical protein                                 53.5    3e-07   Populus deltoides x Populus maximowiczii
ref|XP_010041278.1|  PREDICTED: uncharacterized protein LOC104430214  55.5    3e-07   
ref|XP_002309917.1|  hypothetical protein POPTR_0007s04191g           55.1    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007048406.1|  Uncharacterized protein TCM_001500               55.1    4e-07   
ref|XP_008810898.1|  PREDICTED: uncharacterized protein LOC103722200  55.1    5e-07   
gb|EYU23743.1|  hypothetical protein MIMGU_mgv1a026174mg              55.1    5e-07   
ref|XP_011022935.1|  PREDICTED: uncharacterized protein LOC105124568  54.7    5e-07   
ref|XP_009586898.1|  PREDICTED: uncharacterized protein LOC104084686  55.1    7e-07   
ref|XP_002307472.2|  hypothetical protein POPTR_0005s20850g           53.5    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010921707.1|  PREDICTED: uncharacterized protein LOC105045215  53.5    1e-06   
ref|XP_009790690.1|  PREDICTED: uncharacterized protein LOC104238109  53.1    2e-06   
gb|EYU23744.1|  hypothetical protein MIMGU_mgv1a019112mg              52.8    2e-06   
ref|XP_011100146.1|  PREDICTED: uncharacterized protein LOC105178379  52.4    4e-06   
ref|XP_010911549.1|  PREDICTED: uncharacterized protein LOC105037605  52.4    4e-06   
gb|EYU23845.1|  hypothetical protein MIMGU_mgv1a009636mg              52.4    4e-06   
ref|XP_010030349.1|  PREDICTED: uncharacterized protein LOC104420153  51.6    5e-06   
ref|XP_010042509.1|  PREDICTED: uncharacterized protein LOC104431600  51.6    5e-06   
gb|KEH35396.1|  transmembrane protein, putative                       52.0    5e-06   
gb|AFK48911.1|  unknown                                               50.1    6e-06   
ref|XP_008813041.1|  PREDICTED: uncharacterized protein LOC103723786  51.6    8e-06   
ref|XP_010042860.1|  PREDICTED: uncharacterized protein LOC104432060  51.2    9e-06   
ref|XP_010041179.1|  PREDICTED: uncharacterized protein LOC104430114  50.8    1e-05   
ref|XP_010030341.1|  PREDICTED: uncharacterized protein LOC104420146  50.8    1e-05   
ref|XP_010089323.1|  hypothetical protein L484_021855                 50.1    2e-05   
ref|XP_002262838.1|  PREDICTED: uncharacterized protein LOC100255146  49.7    4e-05   Vitis vinifera
ref|XP_010105097.1|  hypothetical protein L484_000477                 49.7    4e-05   
ref|XP_002520252.1|  conserved hypothetical protein                   49.3    4e-05   Ricinus communis
gb|AEX10882.1|  hypothetical protein 0_1077_01                        47.4    4e-05   
ref|XP_011075019.1|  PREDICTED: uncharacterized protein LOC105159603  49.3    5e-05   
gb|AEX10892.1|  hypothetical protein 0_1077_01                        47.0    5e-05   
gb|AEX10879.1|  hypothetical protein 0_1077_01                        47.0    5e-05   
gb|AFG64432.1|  hypothetical protein 2_2503_02                        46.6    5e-05   
ref|XP_004164698.1|  PREDICTED: uncharacterized protein LOC101229535  48.5    5e-05   
ref|XP_010999841.1|  PREDICTED: uncharacterized protein LOC105107569  48.9    6e-05   
ref|XP_010030348.1|  PREDICTED: uncharacterized protein LOC104420152  48.5    8e-05   
ref|XP_010680207.1|  PREDICTED: uncharacterized protein LOC104895408  48.5    9e-05   
gb|EYU18030.1|  hypothetical protein MIMGU_mgv1a017782mg              48.5    9e-05   
ref|XP_004237719.1|  PREDICTED: uncharacterized protein LOC101258062  48.5    1e-04   
ref|XP_010680472.1|  PREDICTED: uncharacterized protein LOC104895611  45.8    1e-04   
ref|XP_010270454.1|  PREDICTED: uncharacterized protein LOC104606785  47.4    2e-04   
gb|KHN25585.1|  hypothetical protein glysoja_050259                   47.4    2e-04   
ref|XP_003526666.1|  PREDICTED: uncharacterized protein LOC100798371  47.4    2e-04   
ref|XP_010030343.1|  PREDICTED: uncharacterized protein LOC104420148  47.4    2e-04   
ref|XP_011023091.1|  PREDICTED: uncharacterized protein LOC105124685  47.0    3e-04   
ref|XP_004498373.1|  PREDICTED: uncharacterized protein LOC101496539  47.0    3e-04   
gb|EYU20214.1|  hypothetical protein MIMGU_mgv1a0238521mg             47.0    3e-04   
ref|XP_007137514.1|  hypothetical protein PHAVU_009G133500g           47.0    3e-04   
gb|KGN47743.1|  hypothetical protein Csa_6G398200                     47.0    3e-04   
gb|EEE67910.1|  hypothetical protein OsJ_25760                        46.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABK26963.1|  unknown                                               46.2    5e-04   Picea sitchensis
ref|XP_010027648.1|  PREDICTED: uncharacterized protein LOC104418115  46.2    5e-04   
ref|NP_001143962.1|  uncharacterized protein LOC100276777             46.2    5e-04   Zea mays [maize]
gb|AFW74213.1|  hypothetical protein ZEAMMB73_246875                  46.2    6e-04   
ref|XP_010030350.1|  PREDICTED: uncharacterized protein LOC104420154  46.2    6e-04   
ref|XP_002278755.1|  PREDICTED: uncharacterized protein LOC100245483  45.8    7e-04   Vitis vinifera
ref|XP_010680474.1|  PREDICTED: uncharacterized protein LOC104895612  43.9    7e-04   
emb|CBI19944.3|  unnamed protein product                              45.8    8e-04   
gb|KDO83562.1|  hypothetical protein CISIN_1g019636mg                 45.8    8e-04   
ref|XP_007200390.1|  hypothetical protein PRUPE_ppa008434mg           45.4    9e-04   



>ref|XP_007019305.1| Uncharacterized protein TCM_035327 [Theobroma cacao]
 gb|EOY16530.1| Uncharacterized protein TCM_035327 [Theobroma cacao]
Length=332

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            LILFGL   T IYF+CK YH ENIDKS+LSDH+E      +P +  + +VQLE +HV
Sbjct  278  LILFGLVIQTVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--AKDVQLEQYHV  332



>emb|CDP10982.1| unnamed protein product [Coffea canephora]
Length=332

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +LILFGL   T IYFICK YH ENIDKSSL+DH+E      +P +  S +VQLE F V
Sbjct  277  MLILFGLIVQTIIYFICKSYHHENIDKSSLADHLEVYLGEYVPLK--SKDVQLEHFDV  332



>emb|CAG27628.1| hypothetical protein [Populus deltoides x Populus maximowiczii]
Length=138

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +2

Query  14   FGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            FGL   T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE F V
Sbjct  87   FGLVIQTVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQFDV  138



>ref|XP_010041278.1| PREDICTED: uncharacterized protein LOC104430214 [Eucalyptus grandis]
Length=311

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +L++FGL   T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE + V
Sbjct  256  MLMVFGLVVQTVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQYDV  311



>ref|XP_002309917.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa]
 gb|EEE90367.1| hypothetical protein POPTR_0007s04191g [Populus trichocarpa]
Length=334

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 8/55 (15%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESF  151
            +ILFGL   T +YF+CK YH ENIDKSSLSDH+E      +P +  S +VQ+E F
Sbjct  280  VILFGLVIQTVLYFVCKSYHHENIDKSSLSDHLEVYLGEYIPLK--SKDVQMEQF  332



>ref|XP_007048406.1| Uncharacterized protein TCM_001500 [Theobroma cacao]
 gb|EOX92563.1| Uncharacterized protein TCM_001500 [Theobroma cacao]
Length=346

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +ILFGL   T IYF+CK YH ENIDKSSL+DH+E      +P +  + +VQLE FHV
Sbjct  292  VILFGLVAQTVIYFVCKSYHHENIDKSSLADHLEVYLGEYVPLK--AKDVQLEQFHV  346



>ref|XP_008810898.1| PREDICTED: uncharacterized protein LOC103722200 [Phoenix dactylifera]
Length=334

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 39/57 (68%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +ILF L   T +YF+CK YH E+IDKSSL+DH+E      +P +  + +VQLE FHV
Sbjct  280  VILFALVAQTVVYFVCKSYHHESIDKSSLADHLEVYLGDYMPLK--ARDVQLEQFHV  334



>gb|EYU23743.1| hypothetical protein MIMGU_mgv1a026174mg [Erythranthe guttata]
Length=334

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            I +LFGL T T IYF+CK YH ENIDKSSL+DH+       +P +  S +VQLE F V
Sbjct  279  IWMLFGLITQTIIYFVCKSYHHENIDKSSLADHLGGYLGEYVPLK--SKDVQLEQFEV  334



>ref|XP_011022935.1| PREDICTED: uncharacterized protein LOC105124568 [Populus euphratica]
Length=334

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 8/55 (15%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESF  151
            +ILFGL   T +YF+CK YH ENIDKSSLSDH+E      +P +  S +VQ+E F
Sbjct  280  VILFGLVIQTVLYFVCKSYHHENIDKSSLSDHLEVYLGEYIPLK--SKDVQMEHF  332



>ref|XP_009586898.1| PREDICTED: uncharacterized protein LOC104084686 [Nicotiana tomentosiformis]
Length=483

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L+LFGL   T IYF+CK YH ENIDKS+LSDH+E+      P +  S +VQ+E + V
Sbjct  429  LVLFGLVIQTIIYFVCKSYHHENIDKSALSDHLEVYLGEYEPLK--SKDVQMEGYEV  483



>ref|XP_002307472.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa]
 gb|EEE94468.2| hypothetical protein POPTR_0005s20850g [Populus trichocarpa]
Length=331

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +2

Query  14   FGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            FGL   T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE F V
Sbjct  280  FGLVIQTVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQFDV  331



>ref|XP_010921707.1| PREDICTED: uncharacterized protein LOC105045215 [Elaeis guineensis]
Length=334

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            ++ILF L   T +YF+CK YH E+IDKSSL+DH+E      +P +  + +VQLE FHV
Sbjct  279  MVILFALVAQTVVYFVCKSYHHESIDKSSLADHLEVYLGEYVPLK--AKDVQLEQFHV  334



>ref|XP_009790690.1| PREDICTED: uncharacterized protein LOC104238109 [Nicotiana sylvestris]
Length=341

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L+L GL   T IYF+CK YH ENIDKS+LSDH+E+      P +  S +VQ+E + V
Sbjct  287  LVLLGLVIQTIIYFVCKSYHHENIDKSALSDHLEVYLGEYEPLK--SKDVQMEGYEV  341



>gb|EYU23744.1| hypothetical protein MIMGU_mgv1a019112mg [Erythranthe guttata]
Length=325

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            I +LFGL   T IYF+CK YH ENIDKSSL+DH+       +P +  S +VQLE F V
Sbjct  270  ITMLFGLIMQTIIYFVCKSYHHENIDKSSLADHLGGYLGEYVPLK--SKDVQLEHFQV  325



>ref|XP_011100146.1| PREDICTED: uncharacterized protein LOC105178379 [Sesamum indicum]
Length=331

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 8/56 (14%)
 Frame = +2

Query  8    ILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +LFGL   T +YF+CK YH ENIDKSSL+DH+       +P +  S +VQLE F V
Sbjct  278  MLFGLIIQTIVYFVCKSYHHENIDKSSLADHLGGYLGEYVPLK--SKDVQLEQFEV  331



>ref|XP_010911549.1| PREDICTED: uncharacterized protein LOC105037605 [Elaeis guineensis]
Length=334

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            ++ILF L   T +YF+CK YH E+IDKSSL+DH+E      +P +  + +VQL   HV
Sbjct  279  LVILFALVAQTLVYFVCKSYHHESIDKSSLADHLEVYLGDYVPLK--AEDVQLGQLHV  334



>gb|EYU23845.1| hypothetical protein MIMGU_mgv1a009636mg [Erythranthe guttata]
Length=336

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 8/59 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE--------LPWRICSFEVQLESFHV  157
            ++LFGL   T IYF+CK YH++NIDKS+LSDH+E        L       +VQLE + V
Sbjct  278  VVLFGLVVQTVIYFVCKSYHRQNIDKSALSDHLEAYSGGYVRLKASPAEKDVQLEEYRV  336



>ref|XP_010030349.1| PREDICTED: uncharacterized protein LOC104420153 [Eucalyptus grandis]
Length=259

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = +2

Query  8    ILFGLTT*TNIYFICK*YHQENIDKSSLSDHIELPWRICSFE----VQLESFHV  157
            +LF L   T IYF+CK YH ENID S LSDH+E     C  E     Q+E FHV
Sbjct  206  VLFDLVMQTVIYFVCKSYHHENIDSSCLSDHLEFCRGDCPSEGQKAAQVEQFHV  259



>ref|XP_010042509.1| PREDICTED: uncharacterized protein LOC104431600 [Eucalyptus grandis]
Length=300

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 33/56 (59%), Gaps = 4/56 (7%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIELPWRICSFE----VQLESFHV  157
            +L+LF L   T IYF+CK YH ENID S LSDH+E     C  E     Q+E F V
Sbjct  245  MLVLFDLVVQTVIYFVCKSYHHENIDSSCLSDHLEFCRGYCHSEGQKAAQVEQFQV  300



>gb|KEH35396.1| transmembrane protein, putative [Medicago truncatula]
Length=332

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L LFGL   T +YF+CK YH ++IDKS+LSDH+E+      P +    +VQLE++HV
Sbjct  278  LFLFGLVIQTVLYFVCKSYHHQSIDKSALSDHLEVYHGEYEPLK--DKDVQLENYHV  332



>gb|AFK48911.1| unknown [Lotus japonicus]
Length=152

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            LILFG    + +YF+CK YH +NIDKS+LSDH+E+      P +  + +VQLE + V
Sbjct  98   LILFGHVIHSVLYFVCKSYHHQNIDKSALSDHLEVYHGEYEPLK--AKDVQLEHYQV  152



>ref|XP_008813041.1| PREDICTED: uncharacterized protein LOC103723786 [Phoenix dactylifera]
Length=328

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++LF L   T +YF+CK YH E+IDKSSL+DH+E      +P +    +VQLE FHV
Sbjct  273  LVLLFALVAQTVVYFVCKSYHHESIDKSSLADHLEVYLGEYVPLK--PRDVQLEQFHV  328



>ref|XP_010042860.1| PREDICTED: uncharacterized protein LOC104432060 [Eucalyptus grandis]
Length=332

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +L++FGL   T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE + +
Sbjct  277  MLMVFGLVVQTVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQYDI  332



>ref|XP_010041179.1| PREDICTED: uncharacterized protein LOC104430114 [Eucalyptus grandis]
Length=336

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++LF L   T IYF+CK YH ENIDKSSLS+H+E      +P +  S  VQLE  HV
Sbjct  281  MMVLFDLVVQTVIYFVCKSYHHENIDKSSLSEHLEVYLGDYVPLKANS--VQLEQLHV  336



>ref|XP_010030341.1| PREDICTED: uncharacterized protein LOC104420146 [Eucalyptus grandis]
Length=336

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++LF L   T IYF+CK YH ENIDKSSLS+H+E      +P +  S  VQLE  HV
Sbjct  281  MMVLFDLVVQTVIYFVCKSYHHENIDKSSLSEHLEVYLGDYVPLKANS--VQLEQLHV  336



>ref|XP_010089323.1| hypothetical protein L484_021855 [Morus notabilis]
 gb|EXB37648.1| hypothetical protein L484_021855 [Morus notabilis]
Length=327

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 4/55 (7%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIELPW----RICSFEVQLESFHV  157
            LIL  L   T +YF+CK YH ENIDKS+LSDH+E+       + + +VQLE +HV
Sbjct  273  LILSALVIQTVLYFVCKSYHHENIDKSALSDHLEVYLGEYVPLTAKDVQLEQYHV  327



>ref|XP_002262838.1| PREDICTED: uncharacterized protein LOC100255146 [Vitis vinifera]
Length=332

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (69%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKSSLSDH+E      +P +  S +VQLE F V
Sbjct  287  TVIYFVCKSYHHENIDKSSLSDHLEVYLGEYVPLK--SKDVQLEQFDV  332



>ref|XP_010105097.1| hypothetical protein L484_000477 [Morus notabilis]
 gb|EXC49700.1| hypothetical protein L484_000477 [Morus notabilis]
Length=334

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL  109
            +ILFGL   T IYFICK YH ENIDKSSLS+H+E+
Sbjct  278  VILFGLVIQTIIYFICKSYHHENIDKSSLSEHLEV  312



>ref|XP_002520252.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42038.1| conserved hypothetical protein [Ricinus communis]
Length=332

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE F V
Sbjct  287  TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQFEV  332



>gb|AEX10882.1| hypothetical protein 0_1077_01 [Pinus taeda]
Length=129

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 8/51 (16%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLE  145
            L GL T + +YF+CK YH E+IDKSSLSDH+E      LP  + S  +QLE
Sbjct  75   LMGLLTQSVLYFVCKSYHHESIDKSSLSDHLEAYLGDYLP--LISSNIQLE  123



>ref|XP_011075019.1| PREDICTED: uncharacterized protein LOC105159603 [Sesamum indicum]
Length=330

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  14   FGLTT*TNIYFICK*YHQENIDKSSLSDHIEL  109
            FGL   T IYF+CK YH ENIDKS+LSDH+E+
Sbjct  280  FGLVVQTVIYFVCKSYHHENIDKSALSDHLEV  311



>gb|AEX10892.1| hypothetical protein 0_1077_01 [Pinus radiata]
Length=129

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 8/51 (16%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLE  145
            L GL T + +YF+CK YH E+IDKSSLSDH+E      LP  + S  +QLE
Sbjct  75   LMGLLTQSVLYFVCKSYHHESIDKSSLSDHLETYLGDYLP--LISSNIQLE  123



>gb|AEX10879.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10880.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10881.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10883.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10884.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10885.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10886.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10887.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10888.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10889.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10890.1| hypothetical protein 0_1077_01 [Pinus taeda]
 gb|AEX10891.1| hypothetical protein 0_1077_01 [Pinus taeda]
Length=129

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 8/51 (16%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLE  145
            L GL T + +YF+CK YH E+IDKSSLSDH+E      LP  + S  +QLE
Sbjct  75   LMGLLTQSVLYFVCKSYHHESIDKSSLSDHLEAYLGDYLP--LISSNIQLE  123



>gb|AFG64432.1| hypothetical protein 2_2503_02, partial [Pinus taeda]
Length=69

 Score = 46.6 bits (109),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 8/54 (15%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFH  154
            L GL T +  YF+CK YH E+IDKSSLSDH+E+      P +  S  +Q+E  H
Sbjct  15   LMGLLTQSVFYFVCKSYHHESIDKSSLSDHLEVYLGDYEPLK--SSNIQMEYLH  66



>ref|XP_004164698.1| PREDICTED: uncharacterized protein LOC101229535 [Cucumis sativus]
Length=242

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 9/53 (17%)
 Frame = +2

Query  20   LTT*TNIYFICK*YHQENIDKSSLSDHIE-------LPWRICSFEVQLESFHV  157
            L T T +YF+CK YH ENIDKS+LSDH+E       +P R    +VQLE F V
Sbjct  192  LVTETVLYFVCKSYHHENIDKSALSDHLEVYLLGEYVPLR--PRDVQLEKFQV  242



>ref|XP_010999841.1| PREDICTED: uncharacterized protein LOC105107569 [Populus euphratica]
Length=331

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKS+LSDH+E      +P +  S +VQLE F V
Sbjct  286  TVIYFVCKSYHHENIDKSALSDHLEVYLGEYVPLK--SKDVQLEQFDV  331



>ref|XP_010030348.1| PREDICTED: uncharacterized protein LOC104420152 [Eucalyptus grandis]
Length=335

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 4/56 (7%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIELPWRICSFE----VQLESFHV  157
            +L+LF L   T IYF+CK YH+ENID S LSDH+E     C  E    +QLE   V
Sbjct  280  MLVLFDLVVQTVIYFVCKSYHRENIDSSCLSDHLEGCLVDCPSEGQKAIQLEQLQV  335



>ref|XP_010680207.1| PREDICTED: uncharacterized protein LOC104895408 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKSSL+DH+E      +P  + S  +QLE +HV
Sbjct  294  TVIYFVCKSYHHENIDKSSLADHLEGYLGEYIP--LNSKNIQLEEYHV  339



>gb|EYU18030.1| hypothetical protein MIMGU_mgv1a017782mg [Erythranthe guttata]
Length=335

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 8/56 (14%)
 Frame = +2

Query  8    ILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            ILF L   T +YF+CK YH ENIDKSSL+DH+       +P +    +VQLE F V
Sbjct  282  ILFQLIMETMVYFVCKSYHHENIDKSSLADHLGGYLEEFIPLQFK--DVQLEQFEV  335



>ref|XP_004237719.1| PREDICTED: uncharacterized protein LOC101258062 [Solanum lycopersicum]
Length=344

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKS+LSDH+E+      P +  S +VQ+ES+ V
Sbjct  299  TIIYFVCKSYHHENIDKSALSDHLEVYLGEYEPLK--SQDVQMESYQV  344



>ref|XP_010680472.1| PREDICTED: uncharacterized protein LOC104895611 [Beta vulgaris 
subsp. vulgaris]
Length=134

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE  106
            ++ILFGL   T  Y +CK YH E+IDKSSL DH++
Sbjct  79   LIILFGLVVQTVFYLVCKSYHHESIDKSSLGDHLD  113



>ref|XP_010270454.1| PREDICTED: uncharacterized protein LOC104606785 [Nelumbo nucifera]
Length=329

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIELPWR----ICSFEVQLESFHV  157
            +++L  L   T IYF+CK YH ENIDKS L+DH+E+       +   ++QLE+++V
Sbjct  274  VMMLLALVVQTVIYFVCKSYHHENIDKSCLADHLEVYLGEYVPLHGKDIQLENYYV  329



>gb|KHN25585.1| hypothetical protein glysoja_050259 [Glycine soja]
Length=326

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L LF L   T +YF+CK YH +NIDKS+LSDH+E+      P +  + +VQ+E  HV
Sbjct  272  LYLFQLVIQTVLYFVCKSYHHQNIDKSALSDHLEVYHGEYEPLK--AKDVQMEECHV  326



>ref|XP_003526666.1| PREDICTED: uncharacterized protein LOC100798371 [Glycine max]
Length=333

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L LF L   T +YF+CK YH +NIDKS+LSDH+E+      P +  + +VQ+E  HV
Sbjct  279  LYLFQLVIQTVLYFVCKSYHHQNIDKSALSDHLEVYHGEYEPLK--AKDVQMEECHV  333



>ref|XP_010030343.1| PREDICTED: uncharacterized protein LOC104420148 [Eucalyptus grandis]
Length=351

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE  106
            +L+LF L   T IYF+CK YH ENID S LSDH+E
Sbjct  309  MLVLFDLVVQTVIYFVCKSYHHENIDSSFLSDHLE  343



>ref|XP_011023091.1| PREDICTED: uncharacterized protein LOC105124685 [Populus euphratica]
Length=334

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL  109
            ++LF L   T +YF+CK YH ENI+KSSLSDH+E+
Sbjct  280  VMLFDLVIQTVLYFVCKSYHHENINKSSLSDHLEV  314



>ref|XP_004498373.1| PREDICTED: uncharacterized protein LOC101496539 [Cicer arietinum]
Length=333

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL  109
            L GL   T +YF+CK YH ENIDKS+L+DH+E+
Sbjct  281  LIGLVLQTVLYFVCKSYHHENIDKSALADHLEV  313



>gb|EYU20214.1| hypothetical protein MIMGU_mgv1a0238521mg, partial [Erythranthe 
guttata]
Length=328

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHI  103
            I ILF L   T IYF+CK YH ENIDKSSL+DH+
Sbjct  280  ICILFQLIMETIIYFVCKSYHHENIDKSSLADHL  313



>ref|XP_007137514.1| hypothetical protein PHAVU_009G133500g [Phaseolus vulgaris]
 gb|ESW09508.1| hypothetical protein PHAVU_009G133500g [Phaseolus vulgaris]
Length=332

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFHV  157
            L LF L   T +YF+CK YH +NIDKS LSDH+E+      P ++   +VQ+E  HV
Sbjct  278  LYLFQLVIQTVLYFVCKSYHHQNIDKSVLSDHLEVYHGEYEPLKVK--DVQMEECHV  332



>gb|KGN47743.1| hypothetical protein Csa_6G398200 [Cucumis sativus]
Length=338

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 9/53 (17%)
 Frame = +2

Query  20   LTT*TNIYFICK*YHQENIDKSSLSDHIE-------LPWRICSFEVQLESFHV  157
            L T T +YF+CK YH ENIDKS+LSDH+E       +P R    +VQLE F V
Sbjct  288  LVTETVLYFVCKSYHHENIDKSALSDHLEVYLLGEYVPLR--PRDVQLEKFQV  338



>gb|EEE67910.1| hypothetical protein OsJ_25760 [Oryza sativa Japonica Group]
Length=315

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++  L   T +Y +CK YH E+IDKS+LSDH+E      +P +  + +VQ+E F++
Sbjct  261  VVMLALVVQTVVYLVCKSYHHESIDKSNLSDHLEVYLGEYVPLK--ASDVQMEQFNL  315



>gb|ABK26963.1| unknown [Picea sitchensis]
Length=344

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 8/54 (15%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIEL------PWRICSFEVQLESFH  154
            L GL T +  YF+CK YH E+IDKSSLSDH+E+      P +  S  +Q+E+ H
Sbjct  290  LMGLLTQSVFYFVCKSYHHESIDKSSLSDHLEVYLGDYEPLK--SSNIQMENLH  341



>ref|XP_010027648.1| PREDICTED: uncharacterized protein LOC104418115 [Eucalyptus grandis]
Length=336

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKSSLS+H+E      +P +  S  VQLE  HV
Sbjct  291  TVIYFVCKSYHHENIDKSSLSEHLEVYLGDYVPLKANS--VQLEQLHV  336



>ref|NP_001143962.1| uncharacterized protein LOC100276777 [Zea mays]
 gb|ACG36757.1| hypothetical protein [Zea mays]
Length=335

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++  L T T +Y +CK YH E++DK+++SDH+E      +P +  + +VQ+E F V
Sbjct  281  VVMLALVTQTVVYLVCKSYHHESLDKANISDHLEVYLGDYVPLK--ASDVQMEQFQV  335



>gb|AFW74213.1| hypothetical protein ZEAMMB73_246875 [Zea mays]
Length=421

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 37/57 (65%), Gaps = 8/57 (14%)
 Frame = +2

Query  5    LILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            +++  L T T +Y +CK YH E++DK+++SDH+E      +P +  + +VQ+E F V
Sbjct  367  VVMLALVTQTVVYLVCKSYHHESLDKANISDHLEVYLGDYVPLK--ASDVQMEQFQV  421



>ref|XP_010030350.1| PREDICTED: uncharacterized protein LOC104420154 [Eucalyptus grandis]
Length=335

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE  106
            +L+LF +   T IYF+CK YH ENID S LSDH++
Sbjct  280  MLVLFDMVVQTVIYFVCKSYHGENIDSSCLSDHLD  314



>ref|XP_002278755.1| PREDICTED: uncharacterized protein LOC100245483 [Vitis vinifera]
Length=334

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE  106
            +L+LFG    T IY +CK YH ENIDK +LSDH+E
Sbjct  277  MLVLFGHALHTIIYLVCKSYHNENIDKLALSDHLE  311



>ref|XP_010680474.1| PREDICTED: uncharacterized protein LOC104895612 [Beta vulgaris 
subsp. vulgaris]
Length=121

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 8/55 (15%)
 Frame = +2

Query  11   LFGLTT*TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            LFGL   T  Y +CK YH E+IDK++L+DH++      +P +  S  +QLE  HV
Sbjct  69   LFGLVVQTVFYLVCKSYHHESIDKTTLADHLDVYLGEYVPLKDES--IQLERLHV  121



>emb|CBI19944.3| unnamed protein product [Vitis vinifera]
Length=376

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    ILILFGLTT*TNIYFICK*YHQENIDKSSLSDHIE  106
            +L+LFG    T IY +CK YH ENIDK +LSDH+E
Sbjct  297  MLVLFGHALHTIIYLVCKSYHNENIDKLALSDHLE  331



>gb|KDO83562.1| hypothetical protein CISIN_1g019636mg [Citrus sinensis]
Length=338

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T IYF+CK YH ENIDKS LSDH+E      +P +  S ++QLE + V
Sbjct  293  TVIYFVCKSYHHENIDKSELSDHLEVYLGEYVPLK--SKDIQLEHYEV  338



>ref|XP_007200390.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica]
 gb|EMJ01589.1| hypothetical protein PRUPE_ppa008434mg [Prunus persica]
Length=332

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 8/48 (17%)
 Frame = +2

Query  32   TNIYFICK*YHQENIDKSSLSDHIE------LPWRICSFEVQLESFHV  157
            T +YF+CK YH ENIDKS+LSDH+E      +P  + + +VQLE  +V
Sbjct  287  TVLYFVCKSYHHENIDKSALSDHLEVYLGDYVP--LTAKDVQLEQVNV  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517546862952