BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46829_g1_i1 len=311 path=[1:0-310]

Length=311
                                                                      Score     E

ref|XP_010647451.1|  PREDICTED: uncharacterized protein LOC104878577  63.2    2e-09   
emb|CAN81016.1|  hypothetical protein VITISV_025518                   63.9    3e-09   Vitis vinifera
emb|CAN68682.1|  hypothetical protein VITISV_024814                   62.8    6e-09   Vitis vinifera
emb|CAN74229.1|  hypothetical protein VITISV_000584                   62.4    9e-09   Vitis vinifera
emb|CAN65820.1|  hypothetical protein VITISV_042324                   62.4    9e-09   Vitis vinifera
ref|XP_009787908.1|  PREDICTED: uncharacterized protein LOC104235787  59.3    2e-08   
emb|CAA36615.1|  unnamed protein product                              61.2    2e-08   Solanum tuberosum [potatoes]
ref|XP_009801985.1|  PREDICTED: uncharacterized protein LOC104247620  61.2    2e-08   
emb|CAN75466.1|  hypothetical protein VITISV_025054                   61.2    2e-08   Vitis vinifera
emb|CAN82851.1|  hypothetical protein VITISV_027998                   61.2    3e-08   Vitis vinifera
ref|XP_009768866.1|  PREDICTED: uncharacterized protein LOC104219827  57.4    3e-08   
emb|CAN64580.1|  hypothetical protein VITISV_002159                   60.5    5e-08   Vitis vinifera
emb|CAN73624.1|  hypothetical protein VITISV_042460                   60.1    6e-08   Vitis vinifera
ref|XP_004243080.1|  PREDICTED: uncharacterized protein LOC101259058  59.7    7e-08   
gb|ABD32757.1|  Integrase, catalytic region                           59.7    8e-08   Medicago truncatula
emb|CAN68148.1|  hypothetical protein VITISV_035665                   59.7    9e-08   Vitis vinifera
emb|CAN82268.1|  hypothetical protein VITISV_009286                   59.3    9e-08   Vitis vinifera
ref|XP_008779879.1|  PREDICTED: uncharacterized protein LOC103699645  58.9    1e-07   
emb|CAN66087.1|  hypothetical protein VITISV_044185                   58.9    1e-07   Vitis vinifera
emb|CAN60373.1|  hypothetical protein VITISV_034932                   58.5    2e-07   Vitis vinifera
ref|XP_009368236.1|  PREDICTED: uncharacterized protein LOC103957758  58.5    2e-07   
emb|CBI34284.3|  unnamed protein product                              55.8    2e-07   
gb|ACB45089.1|  putative polyprotein                                  58.5    2e-07   Solanum habrochaites
ref|XP_010662484.1|  PREDICTED: uncharacterized protein LOC104882143  58.2    2e-07   
emb|CAN61004.1|  hypothetical protein VITISV_015023                   58.2    2e-07   Vitis vinifera
gb|KHN44567.1|  hypothetical protein glysoja_042716                   54.7    2e-07   
emb|CAN62623.1|  hypothetical protein VITISV_001656                   58.2    3e-07   Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                   58.2    3e-07   Vitis vinifera
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  58.2    3e-07   
ref|XP_010321261.1|  PREDICTED: uncharacterized protein LOC104647531  57.0    5e-07   
ref|XP_009780762.1|  PREDICTED: uncharacterized protein LOC104229761  56.6    5e-07   
emb|CAN69715.1|  hypothetical protein VITISV_011263                   57.0    6e-07   Vitis vinifera
emb|CAN60374.1|  hypothetical protein VITISV_001215                   57.0    6e-07   Vitis vinifera
emb|CAN67245.1|  hypothetical protein VITISV_008680                   57.0    7e-07   Vitis vinifera
dbj|BAF02002.1|  hypothetical protein                                 55.1    7e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76494.1|  hypothetical protein VITISV_024984                   56.6    8e-07   Vitis vinifera
emb|CAN71595.1|  hypothetical protein VITISV_010143                   56.6    1e-06   Vitis vinifera
ref|XP_010651623.1|  PREDICTED: uncharacterized protein LOC104879...  55.5    1e-06   
ref|XP_008245294.1|  PREDICTED: uncharacterized protein LOC103343416  55.8    1e-06   
emb|CAN67064.1|  hypothetical protein VITISV_017541                   55.8    1e-06   Vitis vinifera
emb|CAN60902.1|  hypothetical protein VITISV_023048                   55.5    2e-06   Vitis vinifera
emb|CAN73437.1|  hypothetical protein VITISV_031733                   55.8    2e-06   Vitis vinifera
ref|XP_009768559.1|  PREDICTED: uncharacterized protein LOC104219561  54.3    2e-06   
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein           55.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10837.1|  retroelement pol polyprotein-like                    55.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...  55.5    2e-06   
emb|CAN73099.1|  hypothetical protein VITISV_042888                   54.3    2e-06   Vitis vinifera
gb|ABD32755.1|  gag-pol polyprotein-related                           53.1    3e-06   Medicago truncatula
ref|XP_010321167.1|  PREDICTED: uncharacterized protein LOC101245762  54.3    3e-06   
emb|CAN77904.1|  hypothetical protein VITISV_024390                   54.7    3e-06   Vitis vinifera
emb|CAN69836.1|  hypothetical protein VITISV_026000                   54.7    3e-06   Vitis vinifera
emb|CAN75698.1|  hypothetical protein VITISV_035985                   54.7    3e-06   Vitis vinifera
emb|CAN59949.1|  hypothetical protein VITISV_043423                   54.7    3e-06   Vitis vinifera
emb|CAN82526.1|  hypothetical protein VITISV_028058                   54.7    4e-06   Vitis vinifera
ref|XP_009601417.1|  PREDICTED: uncharacterized protein LOC104096708  53.5    4e-06   
ref|XP_004145411.1|  PREDICTED: uncharacterized protein LOC101209213  53.9    5e-06   
ref|XP_009790862.1|  PREDICTED: uncharacterized protein LOC104238242  53.1    5e-06   
ref|XP_004238497.1|  PREDICTED: uncharacterized protein LOC101255989  53.9    5e-06   
emb|CAN73102.1|  hypothetical protein VITISV_042891                   53.9    6e-06   Vitis vinifera
emb|CAN73002.1|  hypothetical protein VITISV_044056                   53.9    6e-06   Vitis vinifera
ref|XP_009626023.1|  PREDICTED: uncharacterized protein LOC104116792  53.5    7e-06   
gb|AES79018.2|  transmembrane protein, putative                       52.0    7e-06   
emb|CAN75638.1|  hypothetical protein VITISV_043620                   52.4    9e-06   Vitis vinifera
ref|XP_004245314.1|  PREDICTED: uncharacterized protein LOC101251909  53.1    9e-06   
emb|CAN84036.1|  hypothetical protein VITISV_024166                   53.5    9e-06   Vitis vinifera
emb|CAN78327.1|  hypothetical protein VITISV_034970                   53.1    1e-05   Vitis vinifera
emb|CAN60498.1|  hypothetical protein VITISV_027869                   53.1    1e-05   Vitis vinifera
ref|XP_008235981.1|  PREDICTED: uncharacterized protein LOC103334794  52.8    1e-05   
ref|XP_003622800.1|  hypothetical protein MTR_7g052570                52.0    1e-05   
ref|XP_006339073.1|  PREDICTED: uncharacterized protein LOC102582...  52.4    1e-05   
gb|AAB87099.1|  putative retroelement pol polyprotein                 52.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001175213.1|  Os07g0500000                                     52.4    2e-05   
emb|CAN76591.1|  hypothetical protein VITISV_020293                   52.8    2e-05   Vitis vinifera
emb|CAN64407.1|  hypothetical protein VITISV_003511                   52.8    2e-05   Vitis vinifera
emb|CAN62053.1|  hypothetical protein VITISV_016643                   52.4    2e-05   Vitis vinifera
ref|XP_010659776.1|  PREDICTED: uncharacterized protein LOC104881375  51.6    2e-05   
dbj|BAA97099.1|  retroelement pol polyprotein-like                    52.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004243070.1|  PREDICTED: uncharacterized protein LOC101252789  51.6    2e-05   
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...  52.0    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAG51258.1|AC025782_3  Ty1/copia-element polyprotein               52.0    3e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76176.1|  hypothetical protein VITISV_022748                   51.6    3e-05   Vitis vinifera
ref|XP_008778555.1|  PREDICTED: uncharacterized protein LOC103698337  51.6    3e-05   
ref|XP_010681247.1|  PREDICTED: uncharacterized protein LOC104896228  51.2    4e-05   
gb|AER13167.1|  putative retrovirus-like polyprotein                  51.6    4e-05   
emb|CAN62317.1|  hypothetical protein VITISV_026526                   51.2    4e-05   Vitis vinifera
ref|XP_003604634.1|  hypothetical protein MTR_4g015340                50.4    4e-05   
emb|CAN84135.1|  hypothetical protein VITISV_000113                   51.2    4e-05   Vitis vinifera
ref|XP_010513388.1|  PREDICTED: uncharacterized protein LOC104789378  50.8    5e-05   
ref|XP_007029052.1|  Uncharacterized protein TCM_024962               48.1    5e-05   
ref|XP_004301682.1|  PREDICTED: uncharacterized protein LOC101303134  50.8    5e-05   
ref|XP_010269630.1|  PREDICTED: uncharacterized protein LOC104606228  50.8    5e-05   
ref|XP_004514121.1|  PREDICTED: uncharacterized protein LOC101493292  51.2    5e-05   
emb|CAN72141.1|  hypothetical protein VITISV_017108                   51.2    5e-05   Vitis vinifera
emb|CAN80074.1|  hypothetical protein VITISV_018877                   50.8    5e-05   Vitis vinifera
ref|XP_010274487.1|  PREDICTED: uncharacterized protein LOC104609798  50.4    6e-05   
emb|CAN67120.1|  hypothetical protein VITISV_017484                   50.8    6e-05   Vitis vinifera
emb|CAN62906.1|  hypothetical protein VITISV_043610                   50.8    7e-05   Vitis vinifera
emb|CAN80841.1|  hypothetical protein VITISV_002785                   50.8    7e-05   Vitis vinifera
ref|XP_009606993.1|  PREDICTED: uncharacterized protein LOC104101248  50.1    8e-05   
ref|XP_010424622.1|  PREDICTED: uncharacterized protein LOC104709756  50.4    9e-05   
ref|XP_010675988.1|  PREDICTED: uncharacterized protein LOC104891900  50.1    1e-04   
emb|CAN66185.1|  hypothetical protein VITISV_025185                   49.7    1e-04   Vitis vinifera
ref|XP_010666583.1|  PREDICTED: uncharacterized protein LOC104883727  49.7    1e-04   
ref|XP_003621937.1|  hypothetical protein MTR_7g025220                49.7    1e-04   
ref|XP_010258252.1|  PREDICTED: uncharacterized protein LOC104598055  48.9    1e-04   
emb|CAN70756.1|  hypothetical protein VITISV_014702                   49.7    2e-04   Vitis vinifera
emb|CAN63507.1|  hypothetical protein VITISV_029435                   49.7    2e-04   Vitis vinifera
ref|XP_010431064.1|  PREDICTED: uncharacterized protein LOC104715347  49.3    2e-04   
gb|AAT40486.1|  putative polyprotein                                  49.7    2e-04   Solanum demissum
ref|XP_010683835.1|  PREDICTED: uncharacterized protein LOC104898448  49.3    2e-04   
dbj|BAA97287.1|  retroelement pol polyprotein-like                    49.7    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240625.1|  PREDICTED: uncharacterized protein LOC101261123  49.3    2e-04   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   49.7    2e-04   Vitis vinifera
emb|CAN74194.1|  hypothetical protein VITISV_040578                   49.7    2e-04   Vitis vinifera
ref|XP_009599421.1|  PREDICTED: uncharacterized protein LOC104095077  49.3    2e-04   
emb|CAN77739.1|  hypothetical protein VITISV_043316                   48.9    2e-04   Vitis vinifera
ref|XP_007048348.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  48.1    2e-04   
emb|CAN61738.1|  hypothetical protein VITISV_000022                   48.9    2e-04   Vitis vinifera
gb|ABI34293.1|  Integrase core domain containing protein              49.3    2e-04   Solanum demissum
gb|AAD19784.1|  putative retroelement pol polyprotein                 49.3    2e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN76019.1|  hypothetical protein VITISV_010645                   48.9    2e-04   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   49.3    2e-04   Vitis vinifera
emb|CAN76196.1|  hypothetical protein VITISV_041073                   49.3    2e-04   Vitis vinifera
emb|CAN79194.1|  hypothetical protein VITISV_000236                   48.9    2e-04   Vitis vinifera
emb|CAN69819.1|  hypothetical protein VITISV_025708                   49.3    2e-04   Vitis vinifera
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins         48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67119.1|  hypothetical protein VITISV_017483                   48.9    3e-04   Vitis vinifera
emb|CAN67076.1|  hypothetical protein VITISV_042382                   48.9    3e-04   Vitis vinifera
emb|CAN75292.1|  hypothetical protein VITISV_014745                   48.9    3e-04   Vitis vinifera
emb|CAN73074.1|  hypothetical protein VITISV_032386                   48.9    3e-04   Vitis vinifera
emb|CAN72018.1|  hypothetical protein VITISV_001841                   48.9    3e-04   Vitis vinifera
gb|AAC67205.1|  putative retroelement pol polyprotein                 48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN78616.1|  hypothetical protein VITISV_003658                   48.9    3e-04   Vitis vinifera
emb|CAN82064.1|  hypothetical protein VITISV_022772                   48.9    3e-04   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   48.9    3e-04   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   48.9    3e-04   Vitis vinifera
emb|CAN63730.1|  hypothetical protein VITISV_030286                   48.9    3e-04   Vitis vinifera
emb|CAN69688.1|  hypothetical protein VITISV_026774                   48.9    3e-04   Vitis vinifera
emb|CAN65932.1|  hypothetical protein VITISV_016257                   48.5    3e-04   Vitis vinifera
ref|XP_010535249.1|  PREDICTED: uncharacterized protein LOC104810602  48.1    3e-04   
emb|CAN69184.1|  hypothetical protein VITISV_004341                   48.5    3e-04   Vitis vinifera
emb|CAN75922.1|  hypothetical protein VITISV_030752                   48.5    3e-04   Vitis vinifera
emb|CAN76133.1|  hypothetical protein VITISV_036298                   48.5    3e-04   Vitis vinifera
emb|CAN62074.1|  hypothetical protein VITISV_001619                   48.5    3e-04   Vitis vinifera
ref|XP_010320045.1|  PREDICTED: uncharacterized protein LOC104647124  48.1    3e-04   
emb|CAN67317.1|  hypothetical protein VITISV_019719                   48.5    3e-04   Vitis vinifera
emb|CAN68904.1|  hypothetical protein VITISV_025822                   48.1    3e-04   Vitis vinifera
emb|CAN80753.1|  hypothetical protein VITISV_003323                   48.5    3e-04   Vitis vinifera
emb|CAN81099.1|  hypothetical protein VITISV_017741                   48.5    3e-04   Vitis vinifera
emb|CAN80247.1|  hypothetical protein VITISV_027801                   48.5    4e-04   Vitis vinifera
ref|XP_007032202.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  48.1    4e-04   
emb|CAN66243.1|  hypothetical protein VITISV_015916                   48.5    4e-04   Vitis vinifera
emb|CAN62535.1|  hypothetical protein VITISV_041880                   48.5    4e-04   Vitis vinifera
ref|XP_010666786.1|  PREDICTED: uncharacterized protein LOC104883908  47.8    4e-04   
ref|XP_009102751.1|  PREDICTED: uncharacterized protein LOC103828864  48.1    4e-04   
ref|XP_006594179.1|  PREDICTED: uncharacterized protein LOC102659...  47.4    4e-04   
emb|CAB10225.1|  retrovirus-related like polyprotein                  48.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CAN81916.1|  hypothetical protein VITISV_038548                   48.1    5e-04   Vitis vinifera
emb|CAN70277.1|  hypothetical protein VITISV_022230                   48.1    5e-04   Vitis vinifera
emb|CAN81139.1|  hypothetical protein VITISV_018760                   48.1    5e-04   Vitis vinifera
emb|CAN60837.1|  hypothetical protein VITISV_033823                   48.1    5e-04   Vitis vinifera
emb|CAN68348.1|  hypothetical protein VITISV_032025                   48.1    5e-04   Vitis vinifera
gb|ABA95797.1|  retrotransposon protein, putative, unclassified       47.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ABI34329.1|  Integrase core domain containing protein              47.8    6e-04   Solanum demissum
ref|XP_010490134.1|  PREDICTED: uncharacterized protein LOC104767865  47.8    6e-04   
emb|CAN60627.1|  hypothetical protein VITISV_018874                   47.4    7e-04   Vitis vinifera
emb|CAN73696.1|  hypothetical protein VITISV_038483                   47.8    7e-04   Vitis vinifera
emb|CAN81288.1|  hypothetical protein VITISV_036901                   47.4    7e-04   Vitis vinifera
emb|CAN65229.1|  hypothetical protein VITISV_011708                   47.8    7e-04   Vitis vinifera
ref|XP_009631584.1|  PREDICTED: uncharacterized protein LOC104121324  47.4    7e-04   
emb|CAN64673.1|  hypothetical protein VITISV_007430                   47.4    7e-04   Vitis vinifera
emb|CAN60593.1|  hypothetical protein VITISV_023128                   47.8    7e-04   Vitis vinifera
emb|CAN70029.1|  hypothetical protein VITISV_010388                   47.4    8e-04   Vitis vinifera
emb|CAN74310.1|  hypothetical protein VITISV_037517                   47.4    8e-04   Vitis vinifera
emb|CAN76658.1|  hypothetical protein VITISV_025162                   47.4    8e-04   Vitis vinifera
ref|XP_010463456.1|  PREDICTED: uncharacterized protein LOC104744141  47.0    8e-04   
emb|CAN60609.1|  hypothetical protein VITISV_036599                   47.4    9e-04   Vitis vinifera
emb|CAN73405.1|  hypothetical protein VITISV_010053                   47.4    9e-04   Vitis vinifera
emb|CAN65647.1|  hypothetical protein VITISV_001300                   47.4    0.001   Vitis vinifera
emb|CAN74286.1|  hypothetical protein VITISV_036410                   47.4    0.001   Vitis vinifera
ref|XP_010661279.1|  PREDICTED: uncharacterized protein LOC104881770  47.0    0.001   



>ref|XP_010647451.1| PREDICTED: uncharacterized protein LOC104878577 [Vitis vinifera]
Length=359

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 48/94 (51%), Gaps = 20/94 (21%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F +NLISASKL KD +CC+I   D C +Q+    KMIG  K+  GLYY+     P  
Sbjct  255  VPSFNLNLISASKLAKDQNCCIIFFPDYCILQDLVSGKMIGSGKQCGGLYYMH----PST  310

Query  124  LKTGVPGLENNMFSSTCNFAYSQ---LWHYRLGH  32
             K+ V             F  SQ   LWH RLGH
Sbjct  311  NKSVV-------------FHVSQPSDLWHLRLGH  331



>emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera]
Length=1461

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 14/93 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F +NL+S SKLT+   C ++   D C +Q+    K IG+ K+ NGLYY+   Q+P
Sbjct  467  LKVPQFQVNLLSVSKLTRALQCIVMFFFDFCVVQDATTRKTIGLGKQHNGLYYLAQDQNP  526

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L              +     +S LWH RLGH
Sbjct  527  AL--------------AYAIHKHSDLWHQRLGH  545



>emb|CAN68682.1| hypothetical protein VITISV_024814 [Vitis vinifera]
Length=1248

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 7/96 (7%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV    +NLIS  KLT+D  C ++     C  Q+++  +MIG A+E +GLYY+++P   
Sbjct  335  LHVPRLTMNLISIQKLTQDLHCNVVFYHSHCVFQDEDSGRMIGHARERDGLYYLKAPSQS  394

Query  130  PLLKTGVPGLENNMF-SSTCNFAYSQLW--HYRLGH  32
             + K    G  ++ F S   +F   ++W  H RLGH
Sbjct  395  NITK----GKSSHSFVSEDFSFNKEKVWLHHRRLGH  426



>emb|CAN74229.1| hypothetical protein VITISV_000584 [Vitis vinifera]
Length=1039

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 46/93 (49%), Gaps = 14/93 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F +NL+S SKLT+   C ++   D C +Q+    K  G+ K+ NGLYY+   Q+P
Sbjct  59   LKVPQFQVNLLSVSKLTRALQCIVMFXSDFCVVQDATTRKTXGLGKQHNGLYYLAQDQNP  118

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L              +     +S LWH RLGH
Sbjct  119  AL--------------AYAIHKHSDLWHQRLGH  137



>emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera]
Length=1262

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 3/96 (3%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ--SPQ  137
            L+V  F INL+SAS+LTKD+S  L  L   C +Q+ +  +MIG A+  +GL ++Q  S Q
Sbjct  422  LYVPSFNINLVSASRLTKDNSIGLFFLQSKCILQDLSKWRMIGXAEVQSGLXHLQQLSAQ  481

Query  136  SPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
                + +   GL ++    +C    S LWH+RLGH+
Sbjct  482  XNKEMXSSSIGLPSSSLVESCT-VNSDLWHFRLGHI  516



>ref|XP_009787908.1| PREDICTED: uncharacterized protein LOC104235787 [Nicotiana sylvestris]
Length=254

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 45/93 (48%), Gaps = 8/93 (9%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NL+S SKLTKD  C    L   C  Q+    ++  I KE+ GLY ++     
Sbjct  43   LHVPDFKFNLMSVSKLTKDLKCAATFLPTLCVFQDLYNGRVKAIGKENEGLYILKG----  98

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                 GV  L +N+     N   S LWH RLGH
Sbjct  99   ----RGVRFLASNVNVGGSNAETSYLWHERLGH  127



>emb|CAA36615.1| unnamed protein product [Solanum tuberosum]
Length=675

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 47/95 (49%), Gaps = 11/95 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S  KLT+  +C +I   D C  QEK   KMIG A+ES GLY+       
Sbjct  25   LHVPKLSCNLVSFRKLTRSLNCRVIFYSDLCEFQEKVSGKMIGSARESGGLYF-------  77

Query  130  PLLKTGVPGLENN--MFSSTCNFAYSQLWHYRLGH  32
              L  G   L+ N    +ST       LWHY LGH
Sbjct  78   --LDNGNNSLQLNPIFLNSTFVLNKVMLWHYGLGH  110



>ref|XP_009801985.1| PREDICTED: uncharacterized protein LOC104247620 [Nicotiana sylvestris]
Length=686

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 23/114 (20%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F  NL+S SKLTK+  CC ++  + C  Q     ++ GI KE +GLY +Q  + P
Sbjct  448  LYVPNFKYNLLSVSKLTKELKCCALIFHEFCIFQSLYNSRVSGIGKEKDGLYILQPAKIP  507

Query  130  PLLKT----GVPGLE-----------------NNMFSSTCNFAYSQLWHYRLGH  32
            P +K       P L                  +N+ S  C  ++  +WH RLGH
Sbjct  508  PPVKVPDTPSAPALNSFISSATPYPNILIPESSNITSKPC--SHPSIWHQRLGH  559



>emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera]
Length=1576

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  558  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  617

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  618  G-----SNSFSVSCQNNDSAIRLWHYRLGH  642



>emb|CAN82851.1| hypothetical protein VITISV_027998 [Vitis vinifera]
Length=1239

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  237  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  296

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  297  G-----SNSFSVSCQNNDSAIRLWHYRLGH  321



>ref|XP_009768866.1| PREDICTED: uncharacterized protein LOC104219827 [Nicotiana sylvestris]
Length=142

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 9/94 (10%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NLI+ S+L K   C ++ LDD  FIQE++   +IG  +ESNGLYY       
Sbjct  27   LYVPNSPFNLIAVSRLAKLLKCAVLFLDDHVFIQERSTGWIIGTGRESNGLYY-------  79

Query  130  PLLKTGVPGLENNMFSSTCNFAYS-QLWHYRLGH  32
             L+     GL + + S+TC    S  L H RLG 
Sbjct  80   -LILAKSRGLTSCLPSTTCPVTDSPDLLHKRLGR  112



>emb|CAN64580.1| hypothetical protein VITISV_002159 [Vitis vinifera]
Length=1453

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NLIS  KLT+D  C ++     C  Q+++  +MIG A+E +GLYY+++P   
Sbjct  501  LHVPRLTTNLISIQKLTQDLHCNVVFYHSHCVFQDEDSGRMIGHARERDGLYYLKTPSQS  560

Query  130  PLLKTGVPGLENNMF-SSTCNFAYSQLW--HYRLGH  32
             + K    G  ++ F S   +F   ++W  H RL H
Sbjct  561  NITK----GKSSHSFVSEVFSFNKEKVWLHHRRLXH  592



>emb|CAN73624.1| hypothetical protein VITISV_042460 [Vitis vinifera]
Length=1287

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 10/92 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  443  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  502

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGHLL  26
            G     +N FS +C  N +  +LWHYRLG  L
Sbjct  503  G-----SNSFSVSCQNNDSAIRLWHYRLGEFL  529



>ref|XP_004243080.1| PREDICTED: uncharacterized protein LOC101259058 [Solanum lycopersicum]
Length=1041

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 48/96 (50%), Gaps = 12/96 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NL+S  KLT++ SC +I + D C  Q  +  K++GI KE   LY        
Sbjct  381  LHVPEFQFNLLSVYKLTRELSCAVIFIPDFCIFQALSNGKVMGIGKERECLY--------  432

Query  130  PLLKTGVPGLEN---NMFSSTCNFAYSQLWHYRLGH  32
             +LK  +P   N   N+ +         LWHYRLGH
Sbjct  433  -ILKDCLPSTFNMSANISAKITRSEEDTLWHYRLGH  467



>gb|ABD32757.1| Integrase, catalytic region [Medicago truncatula]
Length=1157

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 52/101 (51%), Gaps = 18/101 (18%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI----QSPQSPP  128
            F +NLIS SK+ K  SC +    DSC IQE +  +MIG+ +  +GLY +     S QSP 
Sbjct  451  FNLNLISVSKMCKSLSCFVNFSTDSCIIQELSTKRMIGLGENIHGLYRLVVSADSFQSPS  510

Query  127  LLKTGVPGLENNMFSSTCNFAYSQ--------LWHYRLGHL  29
                      NN+F S  N + S         LWHYR+GHL
Sbjct  511  ------HRFNNNLFVSCNNVSQSHFIVIPNSALWHYRMGHL  545



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 46/91 (51%), Gaps = 14/91 (15%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F +NLISASKL KD +C +I   D C +Q+    KMIG  K+  GLYY+     P  
Sbjct  700  VPSFNLNLISASKLAKDQNCYIIFFPDYCILQDLVSGKMIGSGKQRGGLYYMH----PST  755

Query  124  LKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             K+ V  +             S LWH RLGH
Sbjct  756  NKSVVFHVSQP----------SDLWHLRLGH  776



>emb|CAN82268.1| hypothetical protein VITISV_009286 [Vitis vinifera]
Length=961

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL+KDS+CC+I  +  C  Q+++  K IG A+  NGLYY +
Sbjct  382  LHVPKLTCNLLSVSKLSKDSNCCVIFYESHCIFQDQSSGKTIGSARMINGLYYFE  436



>ref|XP_008779879.1| PREDICTED: uncharacterized protein LOC103699645, partial [Phoenix 
dactylifera]
Length=521

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (56%), Gaps = 5/97 (5%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYY-IQSPQSPP  128
            V  F  NL+SA K+ +  +CCLI   + CF+Q+ +    IG+ +  NGLY+ ++   +  
Sbjct  357  VPSFSFNLLSAKKIAESLNCCLIFFSNRCFLQDLSSWTTIGMGEVRNGLYHLLRMEVASS  416

Query  127  LLKTGVPGLENNMFSSTCNF----AYSQLWHYRLGHL  29
            +L T +  L +  FS + +     + S LWH RLGH+
Sbjct  417  ILVTTLSKLSHKDFSVSASIMNDRSVSDLWHCRLGHI  453



>emb|CAN66087.1| hypothetical protein VITISV_044185 [Vitis vinifera]
Length=878

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  606  NLLSISKLTKEKRCTTNFSSTHCEFQDLDSGKTIGNAEECSGLYILKECHDPQEQPQMAV  665

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  666  G-----SNFFSVSCQNNDSAIRLWHYRLGH  690



>emb|CAN60373.1| hypothetical protein VITISV_034932 [Vitis vinifera]
Length=1264

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---P  140
            L V +   NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    P
Sbjct  352  LLVPHLDCNLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDP  411

Query  139  QSPPLLKTGVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            Q  P +  G     +N FS +C  N +   LWHYRLGH
Sbjct  412  QEQPQMAVG-----SNSFSVSCQNNDSAIMLWHYRLGH  444



>ref|XP_009368236.1| PREDICTED: uncharacterized protein LOC103957758 [Pyrus x bretschneideri]
Length=631

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 14/93 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F ++L+S SKLT+   C +I   D C IQ+ +  + IG+ K  NGLYY+      
Sbjct  430  LHVPNFRVHLLSVSKLTEALRCIVIFFPDFCVIQDMDTRRTIGLGKRYNGLYYLAP----  485

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                      E+N+  +      S LWH RLGH
Sbjct  486  ----------EHNLRLAHHISRNSTLWHQRLGH  508



>emb|CBI34284.3| unnamed protein product [Vitis vinifera]
Length=191

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  307  HVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQ  137
            HV  F  NL+S  KLT D  C +I L   C +QE+   + IG+AKE +GLY+++S Q
Sbjct  83   HVPKFSANLVSIQKLTHDLKCYVIFLPSYCVLQEQGSGRRIGLAKERSGLYHLESSQ  139



>gb|ACB45089.1| putative polyprotein [Solanum habrochaites]
Length=849

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L++  F  NL+S S+LTK+  CC++   D C +Q+ +  K+ G     NGLYY     SP
Sbjct  187  LYIPDFKYNLLSVSELTKELHCCMVFYPDHCILQDLHTVKVKGTGSMENGLYYWSHIVSP  246

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             +  +  P +  +            LWH RLGH+
Sbjct  247  TVAYSVSPSVALSTLDDV------DLWHRRLGHI  274



>ref|XP_010662484.1| PREDICTED: uncharacterized protein LOC104882143 [Vitis vinifera]
Length=1207

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 45/96 (47%), Gaps = 20/96 (21%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F +NLIS SKL  DS    I L   CFIQ+    KMIG+  ES GLY +  P+  
Sbjct  461  LCVPLFYLNLISISKLAFDSFYVTIFLRQVCFIQDLQSGKMIGMGTESEGLYCLNLPR--  518

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQ---LWHYRLGH  32
                             TCN   ++   LWH RLGH
Sbjct  519  ---------------KGTCNVVNTKTQDLWHQRLGH  539



>emb|CAN61004.1| hypothetical protein VITISV_015023 [Vitis vinifera]
Length=1010

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  117  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  176

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  177  G-----SNSFSVSCQNNDSAIRLWHYRLGH  201



>gb|KHN44567.1| hypothetical protein glysoja_042716, partial [Glycine soja]
Length=113

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L++  F  NLIS SKL   ++  LI    SC +QE N    IGI +  +GLY++   Q P
Sbjct  15   LYIPTFTFNLISISKLVSSNNYELIFSSTSCVLQETNNHVKIGIVEARHGLYHLIPNQIP  74

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                  +      +    CN     LWH+R+GH
Sbjct  75   TKAANSI------ITHPQCNTIPIDLWHFRMGH  101



>emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera]
Length=1394

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  434  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKECHDPQEQPQMTV  493

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  494  G-----SNSFSVSCQNNDSAIRLWHYRLGH  518



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  443  NLLSISKLTKEKRCITNFSSTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  502

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  503  G-----SNSFSVSCQNNDSAIRLWHYRLGH  527



>gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1311

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 17/99 (17%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L++  F  NLIS SKL   + C LI    SC +Q+ +    IGI +E +GLY++      
Sbjct  324  LYMPAFTFNLISISKLVSSTHCALIFSSTSCMLQDASTRTKIGIVEEKHGLYHL------  377

Query  130  PLLKTGVPGLENNMFSST-----CNFAYSQLWHYRLGHL  29
                  +P   N +  ST     C      LWH+R+GHL
Sbjct  378  ------IPDQVNKVICSTIIHPKCKIIPIDLWHFRMGHL  410



>ref|XP_010321261.1| PREDICTED: uncharacterized protein LOC104647531 [Solanum lycopersicum]
Length=606

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 48/93 (52%), Gaps = 10/93 (11%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  +  NL+S SKLTKD  C + +  D C +Q     ++IGI KES+GL YI   +  
Sbjct  207  LHVPNYRFNLLSISKLTKDLKCSVSIYPDLCVMQTLFTREVIGIGKESDGL-YIHRQEVI  265

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
            P +           F S  N    +LWH RLGH
Sbjct  266  PTIGAA--------FKSK-NSEEHKLWHLRLGH  289



>ref|XP_009780762.1| PREDICTED: uncharacterized protein LOC104229761 [Nicotiana sylvestris]
Length=535

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 44/83 (53%), Gaps = 9/83 (11%)
 Frame = -2

Query  277  SASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVPGLE  98
            + S+L K   C  + LDD  FIQE+N  ++IG  +ESNG YY        L+   + GL 
Sbjct  59   AVSRLAKSLKCAFLFLDDHAFIQERNTRRIIGTGRESNGFYY--------LILAKLHGLT  110

Query  97   NNMFSSTCNFAYS-QLWHYRLGH  32
            + + S TC    S  L H RLGH
Sbjct  111  SCLPSPTCPVTDSPALLHKRLGH  133



>emb|CAN69715.1| hypothetical protein VITISV_011263 [Vitis vinifera]
Length=1040

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  116  NLLSISKLTKEKRCITNFSSTHCEFQDLDLGKTIGNAEECSGLYILKERHDPQEQPQMTV  175

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  176  G-----SNSFSVSCQNNDSAIRLWHYRLGH  200



>emb|CAN60374.1| hypothetical protein VITISV_001215 [Vitis vinifera]
Length=1535

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 15/99 (15%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F ++L+S S+LT+  +C +      C +Q+    +MIG+ K+ +GLYY+ +      
Sbjct  465  VPTFKVDLMSVSRLTRGLNCSVTFFPHWCVLQDLATRRMIGLGKQRDGLYYLAA------  518

Query  124  LKTGVPGLENNMFSS-----TCNFAYS--QLWHYRLGHL  29
            L T     E N +SS     TCN   S   LWH RLGH+
Sbjct  519  LTTN--KTETNSYSSPNRPPTCNLTTSSTDLWHSRLGHV  555



>emb|CAN67245.1| hypothetical protein VITISV_008680 [Vitis vinifera]
Length=1333

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS---PQSPPLLKT  116
            NL+S SKLTK+  C        C  Q+ +  K IG A+E +GLY ++    PQ  P +  
Sbjct  734  NLLSISKLTKEKRCITNFSFTHCEFQDLDSGKTIGNAEECSGLYILKERHDPQEQPQMTV  793

Query  115  GVPGLENNMFSSTC--NFAYSQLWHYRLGH  32
            G     +N FS +C  N +  +LWHYRLGH
Sbjct  794  G-----SNSFSVSCQNNDSAIRLWHYRLGH  818



>dbj|BAF02002.1| hypothetical protein [Arabidopsis thaliana]
Length=269

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 14/85 (16%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            +LIS S+LT+  SC   + D  C IQ++    +IG  K+ NGLY+ +  ++   +     
Sbjct  169  HLISVSQLTRAKSCVFQITDKVCIIQDRITLTLIGAGKQQNGLYFFRGTETVASM-----  223

Query  106  GLENNMFSSTCNFAYSQLWHYRLGH  32
                 M SS      SQLWH RLGH
Sbjct  224  ---TRMDSS------SQLWHCRLGH  239



>emb|CAN76494.1| hypothetical protein VITISV_024984 [Vitis vinifera]
Length=988

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +  C  Q+++  K IG AK  NGLYY +
Sbjct  249  LHVPKLTCNLLSVSKLSRDSNCCVIFYESHCIFQDQSSGKTIGSAKMINGLYYFE  303



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 44/94 (47%), Gaps = 20/94 (21%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F +NLIS SKL  DS    I L   CFIQ+    KMIG+  ES GLY +  P+    
Sbjct  463  VPLFYLNLISISKLAFDSFYVTIFLRQVCFIQDLQSGKMIGMGTESEGLYCLNLPR----  518

Query  124  LKTGVPGLENNMFSSTCNFAYSQ---LWHYRLGH  32
                           TCN   ++   LWH RLGH
Sbjct  519  -------------KGTCNVVNTKTQDLWHQRLGH  539



>ref|XP_010651623.1| PREDICTED: uncharacterized protein LOC104879667 isoform X1 [Vitis 
vinifera]
Length=398

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +  C  Q+++  K IG A+  NGLYY +
Sbjct  325  LHVPKLTCNLLSVSKLSRDSNCCVIFYESHCIFQDQSSGKTIGSARMINGLYYFE  379



>ref|XP_008245294.1| PREDICTED: uncharacterized protein LOC103343416 [Prunus mume]
Length=582

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 45/93 (48%), Gaps = 14/93 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F + L+S SKLT    C +I     C IQ+ +  + IG+ K  NGLYY+   Q+P
Sbjct  437  LHVPNFRVCLLSVSKLTAALRCIVIFFPGFCVIQDMDTRRTIGLGKRYNGLYYLAPEQNP  496

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L       +  N          S LWH RLGH
Sbjct  497  RLAH----HISRN----------SILWHQRLGH  515



>emb|CAN67064.1| hypothetical protein VITISV_017541 [Vitis vinifera]
Length=1127

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 9/95 (9%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S SKL++DS+CC+I  +     Q+++  K IG A+  NGLYY +     
Sbjct  210  LHVPKLTCNLLSVSKLSRDSNCCVIFYESHYIFQDQSSGKTIGSARMINGLYYFEDNLPS  269

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQL--WHYRLGH  32
              +  G+  +       +  F   Q+  WH RLGH
Sbjct  270  NKIAQGLSSI-------SSLFVRDQIVAWHCRLGH  297



>emb|CAN60902.1| hypothetical protein VITISV_023048 [Vitis vinifera]
Length=575

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +  C  Q+++  K IG A+  NGLYY +
Sbjct  238  LHVPKLTCNLLSVSKLSRDSNCCVIFYESHCIFQDQSSGKTIGSARMINGLYYFE  292



>emb|CAN73437.1| hypothetical protein VITISV_031733 [Vitis vinifera]
Length=1322

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 13/101 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI-----Q  146
            L V  F ++L+S S++TKD +C +      C +Q+      IG+ ++ +GLYY+     +
Sbjct  384  LGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCILQDLTTRTTIGLGEQRDGLYYLVALASE  443

Query  145  SP--QSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             P  Q+P    T      + + SST       LWH+RLGHL
Sbjct  444  KPKNQTPSAAATSCRSPSSQVTSSTA------LWHHRLGHL  478



>ref|XP_009768559.1| PREDICTED: uncharacterized protein LOC104219561 [Nicotiana sylvestris]
Length=305

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 9/83 (11%)
 Frame = -2

Query  277  SASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVPGLE  98
            + S+L K   C ++ LDD  FIQE++  ++IG  +ESN LYY+   +S         GL 
Sbjct  59   AVSRLAKSLKCAVLFLDDHVFIQERSTGRIIGTGRESNRLYYLILAKS--------HGLT  110

Query  97   NNMFSSTCNFAYS-QLWHYRLGH  32
            + + S+TC    S  L H RLGH
Sbjct  111  SCLPSTTCPVTDSPDLLHKRLGH  133



>gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1486

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V     +LIS S+LT+   C   + D  C +Q++    +IG  +E NGLY+ +     
Sbjct  434  LFVDGLHCHLISVSQLTRTRRCIFQITDKVCIVQDRTTLMLIGAGRELNGLYFFR-----  488

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                    G+E     ++     SQLWH RLGH
Sbjct  489  --------GVETAAAVTSKALPSSQLWHQRLGH  513



>dbj|BAB10837.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1462

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 14/85 (16%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            +LIS S+LT+  SC   + D  C IQ++    +IG  K+ NGLY+ +  ++         
Sbjct  407  HLISVSQLTRAKSCVFQITDKVCIIQDRITLTLIGAGKQQNGLYFFRGTET---------  457

Query  106  GLENNMFSSTCNFAYSQLWHYRLGH  32
                 + S T   + SQLWH RLGH
Sbjct  458  -----VASMTRMDSSSQLWHCRLGH  477



>gb|KHN05285.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1346

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 51/101 (50%), Gaps = 15/101 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F +NLIS S+L   +   L   D  C IQE+   KMIG+ +  +GLYY       
Sbjct  351  LYVPTFTVNLISVSQLCHHTPYTLNFTDTICSIQEQKSLKMIGLGESRDGLYY-------  403

Query  130  PLLKTGVPGLENN-----MFSSTCNFAYSQ--LWHYRLGHL  29
             L +T      +N     +FSS  N    +  +WH+RLGHL
Sbjct  404  -LTQTNKECASSNYNISSIFSSANNVHIPENAIWHFRLGHL  443



>emb|CAN73099.1| hypothetical protein VITISV_042888 [Vitis vinifera]
Length=393

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS SKLT+D  C        C  Q+    +MIG A+E   LY +Q   +P      V 
Sbjct  228  NLISVSKLTRDXKCVANFSHTCCSFQDLALGRMIGNAEECVRLYLLQKVDNPEKQTQIVR  287

Query  106  GLENNMFSSTCNFAYSQLWHYRLGH  32
             +   +FS + N +   LWHYRLGH
Sbjct  288  DVSFPIFSMSNNESAIMLWHYRLGH  312



>gb|ABD32755.1| gag-pol polyprotein-related [Medicago truncatula]
Length=238

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI  149
            LH+     +LIS  KLTKD SC +I+ + SC  Q+K   +  G A+E NGLYY+
Sbjct  140  LHIPKLSTSLISIQKLTKDLSCNVILNNKSCVFQDKESGRTTGNAREWNGLYYL  193



>ref|XP_010321167.1| PREDICTED: uncharacterized protein LOC101245762 [Solanum lycopersicum]
Length=549

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 7/94 (7%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S +KLT+  +CC I   D   +Q+    K+  I +E+ GLY ++SPQ  
Sbjct  435  LYVPDLNFNLLSVAKLTRQLNCCAIFYPDFFILQDLFTGKVKEIGEENGGLYILKSPQ--  492

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             L+  G    ++   ++  N A  ++WH RLGH+
Sbjct  493  -LINIG----QHKSMTAVKNSADGEVWHKRLGHI  521



>emb|CAN77904.1| hypothetical protein VITISV_024390 [Vitis vinifera]
Length=1210

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/103 (36%), Positives = 43/103 (42%), Gaps = 25/103 (24%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS----  143
            LHV     NL+S S LTK S+C    L   C  Q+ +  K IG AKE  GLYY       
Sbjct  421  LHVPNLSCNLLSISXLTKQSNCSXKFLPSHCVFQDLSSRKTIGSAKEREGLYYFDEIDMX  480

Query  142  PQSPPLLKTGVPGLENNMFSSTCNFAYSQ------LWHYRLGH  32
             Q PP               + CN A         LWH R+GH
Sbjct  481  GQCPP---------------TVCNSASRPRDSELLLWHKRMGH  508



>emb|CAN69836.1| hypothetical protein VITISV_026000 [Vitis vinifera]
Length=1263

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 35/68 (51%), Gaps = 0/68 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S S+LTKDS+C    L   C  Q+ +  K IG AKE  GLYY       
Sbjct  394  LHVPKLSCNLLSVSQLTKDSNCSAKFLPSHCVFQDLSSGKTIGSAKEHEGLYYFDETDVL  453

Query  130  PLLKTGVP  107
              L  GVP
Sbjct  454  GQLIYGVP  461



>emb|CAN75698.1| hypothetical protein VITISV_035985 [Vitis vinifera]
Length=1105

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +  C  Q+++  K IG A+  NGLYY +
Sbjct  358  LHVPKLTCNLLSISKLSRDSNCCVIFYESHCIFQDQSSGKTIGSARIINGLYYFE  412



>emb|CAN59949.1| hypothetical protein VITISV_043423 [Vitis vinifera]
Length=1059

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI-----Q  146
            L V  F ++L+S S++TKD +C +      C +Q+      IG+ ++ +GLYY+     +
Sbjct  430  LGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCILQDLTTRTTIGLGEQRDGLYYLVALASE  489

Query  145  SP--QSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             P  Q+P    T      + + SST       LWH RLGHL
Sbjct  490  KPKTQTPSXXATSCRSPSSQVTSSTA------LWHXRLGHL  524



>emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera]
Length=1125

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI-----Q  146
            L V  F ++L+S S++TKD +C +      C +Q+      IG+ ++ +GLYY+     +
Sbjct  166  LGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCILQDLTTRTTIGLGEQRDGLYYLVALASE  225

Query  145  SP--QSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             P  Q+P    T      + + SST       LWH RLGHL
Sbjct  226  KPKTQTPSAATTSCRSPSSQVTSSTA------LWHRRLGHL  260



>ref|XP_009601417.1| PREDICTED: uncharacterized protein LOC104096708 [Nicotiana tomentosiformis]
Length=341

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NL+S SKLTK+ SCC +   D C +Q     K++GI KES GLY +    + 
Sbjct  267  LHVPVFMFNLLSVSKLTKELSCCAMFFPDFCVLQGLYNGKVMGIDKESRGLYLLHRRSTR  326

Query  130  PLLKTGV  110
              +   V
Sbjct  327  ATMSAVV  333



>ref|XP_004145411.1| PREDICTED: uncharacterized protein LOC101209213 [Cucumis sativus]
Length=620

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 8/95 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S SK+T + +C  I L DS   Q+ +  +MIG A+ S GLY +      
Sbjct  472  LHVPKLSYNLLSISKITHELNCKAIFLPDSVSFQDLSSGRMIGTARHSRGLYLLDD----  527

Query  130  PLLKTGVPGLENNMFSS--TCNFAYSQLWHYRLGH  32
                + +P    ++ SS  T +     LWH+RLGH
Sbjct  528  DTYSSSIP--RTSLLSSYFTTSEQDCMLWHFRLGH  560



>ref|XP_009790862.1| PREDICTED: uncharacterized protein LOC104238242 [Nicotiana sylvestris]
Length=293

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 9/83 (11%)
 Frame = -2

Query  277  SASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVPGLE  98
            + S+L K   C ++ LDD  F+QE++  ++IG  +ESNGLYY        L+     GL 
Sbjct  55   AVSRLAKSLKCAVLFLDDHVFVQERSTGRIIGTERESNGLYY--------LILAKSHGLT  106

Query  97   NNMFSSTCNFAYS-QLWHYRLGH  32
            + + S+TC    S  L H  LGH
Sbjct  107  SCLPSTTCPVTDSPDLLHKWLGH  129



>ref|XP_004238497.1| PREDICTED: uncharacterized protein LOC101255989 [Solanum lycopersicum]
Length=587

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 52/104 (50%), Gaps = 12/104 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSP---  140
            L V  F  NL+S S+LTK   C ++   D C  Q+    +++GI KE+ GLY + +P   
Sbjct  412  LFVPEFKYNLLSVSQLTKLLKCAVVFFPDFCIFQDLFNGRVLGIGKENQGLYILNTPVTT  471

Query  139  -QSPPLLKTGVPGLENNM-------FSSTCNFAYSQLWHYRLGH  32
              S   + +G    E          FSST + + S LWH RLGH
Sbjct  472  KPSNDQVSSGECAKEAAYKRIRPISFSSTAD-SLSSLWHKRLGH  514



>emb|CAN73102.1| hypothetical protein VITISV_042891 [Vitis vinifera]
Length=1493

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 47/96 (49%), Gaps = 11/96 (11%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S S+LTK S+C    L   C  Q+ +  K IG AKE  GLYY       
Sbjct  471  LHVPNLSCNLLSISQLTKKSNCSAKFLSSHCVFQDLSSGKTIGSAKEREGLYYFD-----  525

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQ---LWHYRLGH  32
               +T V G  +    ++ +++      LWH R+GH
Sbjct  526  ---ETDVLGQSSPTVCNSTSYSKDSELLLWHKRMGH  558



>emb|CAN73002.1| hypothetical protein VITISV_044056 [Vitis vinifera]
Length=1121

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 49/93 (53%), Gaps = 7/93 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S  KLT D  C  I     C +QE+   + IG+AKE +GLYY++S Q  
Sbjct  446  LHVPKLSANLVSIQKLTHDLKCYAIFFPSYCVLQEQGLGRRIGLAKEMSGLYYLESSQ--  503

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
               KT      + + SS  +  +  L+H RLGH
Sbjct  504  ---KTSNNLSLSLLSSSNKDTIW--LYHLRLGH  531



>ref|XP_009626023.1| PREDICTED: uncharacterized protein LOC104116792 [Nicotiana tomentosiformis]
Length=764

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 46/93 (49%), Gaps = 11/93 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NL+S SK+TK  SC  +   D C  Q     K++GI KE  GLY +Q     
Sbjct  369  LHVPDFKFNLLSVSKITKQLSCVALFSPDFCVFQGLFNGKVLGIGKEKEGLYILQE----  424

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
              +K  V    +       ++   +LWH+RLGH
Sbjct  425  -TIKLAVGATVHKE-----DYG-RKLWHWRLGH  450



>gb|AES79018.2| transmembrane protein, putative [Medicago truncatula]
Length=236

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 46/98 (47%), Gaps = 11/98 (11%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKT  116
            F +NLIS SKL K  SC +    DSC IQ+ N  KMIG+    NGLY +         K+
Sbjct  133  FNLNLISISKLYKSISCFVQFSTDSCIIQDLNTRKMIGLGDNLNGLYRLV--VHVDSSKS  190

Query  115  GVPGLENNMFSSTCN---------FAYSQLWHYRLGHL  29
                  N   S+ CN            S LWH RLGHL
Sbjct  191  SSFTSFNKKCSAFCNNISKPESTVIPCSALWHVRLGHL  228



>emb|CAN75638.1| hypothetical protein VITISV_043620 [Vitis vinifera]
Length=331

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 49/91 (54%), Gaps = 6/91 (7%)
 Frame = -2

Query  307  HVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPP  128
            HV     NLIS  KLT+D  C ++     C  Q+++  +MIG A+E + LYY+++P    
Sbjct  245  HVPRLTTNLISIQKLTQDLHCNVVFYHSHCVFQDEDSGRMIGHAREWDRLYYLKAPSQSN  304

Query  127  LLKTGVPGLENNMF-SSTCNFAYSQLW-HYR  41
            + K    G  ++ F S   +F   ++W H+R
Sbjct  305  ITK----GKSSHSFVSEVFSFNKEKVWFHHR  331



>ref|XP_004245314.1| PREDICTED: uncharacterized protein LOC101251909 [Solanum lycopersicum]
Length=648

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 11/103 (11%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F  NL+S S+LTK   C ++   D C  Q+    +++GI KE+ GLY + +  + 
Sbjct  493  LFVPEFKYNLLSVSQLTKQLRCTVVFFPDFCIFQDLFNGRVLGIGKENQGLYILNTAATT  552

Query  130  PLLK----TGVPGLENN------MFSSTCNFAYSQLWHYRLGH  32
             L      +G    E+        F+ST   A S LWH RLGH
Sbjct  553  KLSNDQGSSGKYAKEDACKRNPISFNSTVESA-SSLWHKRLGH  594



>emb|CAN84036.1| hypothetical protein VITISV_024166 [Vitis vinifera]
Length=1337

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 7/93 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S  KLT D  C  I     C +QE+   + IG+AKE +GLY+++S Q  
Sbjct  353  LHVPKLSANLVSIQKLTHDLKCYAIFFPSYCVLQEQGSGRRIGLAKEMSGLYHLESSQ--  410

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
               KT      + + SS  +  +  L+H RLGH
Sbjct  411  ---KTSNNLSLSLLSSSNKDTIW--LYHLRLGH  438



>emb|CAN78327.1| hypothetical protein VITISV_034970 [Vitis vinifera]
Length=687

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LH      NL+S SKLTK  +C      + C  ++    KMIG AKE NGLYY+ + +  
Sbjct  122  LHAPKMSCNLLSISKLTKTDNCSGTFFPNYCVFKDLTLGKMIGSAKERNGLYYLDTEE--  179

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                 G  G    +F S        L H RLGH
Sbjct  180  -----GEKGAAEGLFESY------WLMHERLGH  201



>emb|CAN60498.1| hypothetical protein VITISV_027869 [Vitis vinifera]
Length=2077

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  289  INLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
             NLIS SK+T   +C +I  D S  +Q+++  K IGI +ES GLY++ SP SP
Sbjct  578  FNLISISKITHTLNCFIIFSDKSVILQDRSTGKTIGIGRESQGLYHLTSPSSP  630



>ref|XP_008235981.1| PREDICTED: uncharacterized protein LOC103334794 [Prunus mume]
Length=554

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F +NL+SASKLT   +CC I+    C +Q+    KMIG  K+  GLYY+   Q  
Sbjct  480  LCVPSFRLNLMSASKLTTSLNCCAILFPTFCVLQDLATRKMIGSGKQRGGLYYMSPLQKT  539

Query  130  PL  125
            P+
Sbjct  540  PV  541



>ref|XP_003622800.1| hypothetical protein MTR_7g052570 [Medicago truncatula]
Length=358

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 46/98 (47%), Gaps = 11/98 (11%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKT  116
            F +NLIS SKL K  SC +    DSC IQ+ N  KMIG+    NGLY +         K+
Sbjct  255  FNLNLISISKLYKSISCFVQFSTDSCIIQDLNTRKMIGLGDNLNGLYRLVVHVD--SSKS  312

Query  115  GVPGLENNMFSSTCN---------FAYSQLWHYRLGHL  29
                  N   S+ CN            S LWH RLGHL
Sbjct  313  SSFTSFNKKCSAFCNNISKPESTVIPCSALWHVRLGHL  350



>ref|XP_006339073.1| PREDICTED: uncharacterized protein LOC102582788 isoform X1 [Solanum 
tuberosum]
Length=409

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 5/93 (5%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F  NL+S SK+TK+ SC +    D C  Q+    K+ GI +E  GLY I +  + 
Sbjct  304  LYVPEFRYNLLSVSKVTKELSCLVTFFPDFCVFQDLYSGKVKGIGREQGGLYLIVADTNK  363

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L+   +         S+ +  Y  LWH RLGH
Sbjct  364  SLINNEL----KTAHLSSKDEDYD-LWHKRLGH  391



>gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1496

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 13/94 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F   LIS SKL K +S   I  D  CF+Q++    +IG  +E  G+YY       
Sbjct  427  LFVPDFDCTLISVSKLLKQTSSIAIFTDTFCFLQDRFLRTLIGAGEEREGVYYF------  480

Query  130  PLLKTGVPGLENNMFSSTCNFAYS-QLWHYRLGH  32
                TGV  L   +  ++ +FA S  LWH RLGH
Sbjct  481  ----TGV--LAPRVHKASSDFAISGDLWHRRLGH  508



>ref|NP_001175213.1| Os07g0500000 [Oryza sativa Japonica Group]
 dbj|BAH93941.1| Os07g0500000 [Oryza sativa Japonica Group]
Length=662

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 54/95 (57%), Gaps = 7/95 (7%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIA---KESNGLYYIQSPQS  134
            V    +NLIS  ++T D +C +   D SCF+Q+++   ++G     K S+GLY + +   
Sbjct  127  VPKLSMNLISVGQIT-DKNCFVGFDDTSCFVQDRHSGAVVGTGHCQKGSSGLYILDNLNM  185

Query  133  PPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
            P    TG P + + + SS C  ++ Q WH+RLGHL
Sbjct  186  PS-SSTGTPIVTSPVCSSACK-SFPQ-WHHRLGHL  217



>emb|CAN76591.1| hypothetical protein VITISV_020293 [Vitis vinifera]
Length=1416

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+  SKL+KDS+CC+I  +  C  Q+ +  K IG A+  NGLYY +
Sbjct  690  LHVPKLTCNLLFVSKLSKDSNCCVIFYESHCIFQDWSSGKTIGSARMINGLYYFK  744



>emb|CAN64407.1| hypothetical protein VITISV_003511 [Vitis vinifera]
Length=1081

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +     Q+++  K IG A+  NGLYY +
Sbjct  299  LHVPKLTCNLLSVSKLSRDSNCCVIFYESHXIFQDQSSGKKIGXARMINGLYYFE  353



>emb|CAN62053.1| hypothetical protein VITISV_016643 [Vitis vinifera]
Length=587

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 43/97 (44%), Gaps = 13/97 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSP---  140
            LHV     NL+S S+LTK S+C    L   C  Q  +  K IG AKE  GLYY       
Sbjct  309  LHVPNLSCNLLSISQLTKKSNCSAKFLPPHCVFQHLSSRKTIGSAKECEGLYYFDETNVL  368

Query  139  -QSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             Q PP +       ++N            LWH R+GH
Sbjct  369  GQYPPTVCNSASHPKDNEL---------LLWHKRMGH  396



>ref|XP_010659776.1| PREDICTED: uncharacterized protein LOC104881375 [Vitis vinifera]
 ref|XP_010659777.1| PREDICTED: uncharacterized protein LOC104881375 [Vitis vinifera]
Length=328

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+S SKL++DS+CC+I  +  C  Q+++  K IG A+  N LYY +
Sbjct  252  LHVPKLTCNLLSISKLSRDSNCCVIFYESHCIFQDRSSGKTIGNARMINCLYYFE  306



>dbj|BAA97099.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1098

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 14/94 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F   LIS +KL K + C  I  D  CF+Q++    +IG  +E  G+YY       
Sbjct  431  LFVPDFNCTLISVAKLLKHTGCVAIFTDTLCFLQDRFTRTLIGAGEEREGVYYF------  484

Query  130  PLLKTGVPGLE-NNMFSSTCNFAYSQLWHYRLGH  32
                TGV     N  F  + +   + LWH+RLGH
Sbjct  485  ----TGVLAARVNKGFKESSS---ATLWHHRLGH  511



>ref|XP_004243070.1| PREDICTED: uncharacterized protein LOC101252789 [Solanum lycopersicum]
Length=548

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS  143
            +H+  F  NL+S S+LTK+  C ++   D C +Q+ +  K+ GI KE NGLY  QS
Sbjct  464  MHIPEFKYNLLSVSQLTKELQCAVLFYPDFCILQDLSSGKVKGIGKEENGLYVFQS  519



>gb|ABB47665.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47666.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1682

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 7/95 (7%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIA---KESNGLYYIQSPQS  134
            V    +NLIS  +LT D++C +   D SCF+Q+++   +IG     K S GL YI    S
Sbjct  242  VPKLSMNLISVGQLT-DTNCFVGFDDTSCFVQDRHTGAVIGTGHRQKRSCGL-YILDSLS  299

Query  133  PPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             P   T  P + + M S+ C  ++ Q WH+RLGHL
Sbjct  300  LPSSSTNTPSVYSPMCSTACK-SFPQ-WHHRLGHL  332



>gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidopsis thaliana]
Length=1152

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 11/93 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V      LIS ++L ++  C  I  D  C IQ++    +IG+  ESNG+Y++Q  +  
Sbjct  439  LFVPDLSCTLISVARLLRELHCFAIFTDKVCVIQDRTSKMLIGVGTESNGVYHLQRAE--  496

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                  V     N+     N A   LWH RLGH
Sbjct  497  ------VVATSANVVKWKTNKA---LWHMRLGH  520



>emb|CAN76176.1| hypothetical protein VITISV_022748 [Vitis vinifera]
Length=1025

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ SP +P + + T V
Sbjct  332  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSPSTPAVCISTDV  391

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  392  P----------------LLIHSRLGH  401



>ref|XP_008778555.1| PREDICTED: uncharacterized protein LOC103698337 [Phoenix dactylifera]
Length=848

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 13/101 (13%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F  NLISASKL   ++CCL+ +  SCFIQ+    + I + K  +GLY++Q  +    
Sbjct  322  VPKFSFNLISASKLIASNNCCLMFISASCFIQDLLNWRTIRMGKLEDGLYHLQLNE----  377

Query  124  LKTGVPGLENNMFSSTCNFAYS---------QLWHYRLGHL  29
            ++T    L +++  S+   + S          LWH RLGHL
Sbjct  378  IQTTTGTLNSSLSKSSSPLSSSSAVVSSHEFDLWHCRLGHL  418



>ref|XP_010681247.1| PREDICTED: uncharacterized protein LOC104896228 [Beta vulgaris 
subsp. vulgaris]
Length=561

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NLIS S++  +SSC +   D  C IQ+     +IG  +  +GLYY    + P
Sbjct  432  LYVPTLTCNLISVSQMIDESSCIVRFTDSLCVIQDLRSGNLIGAGERRDGLYYF--CRIP  489

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L     P L              +LWH+RLGH
Sbjct  490  TLHAVSTPVLSE-----------FELWHHRLGH  511



>gb|AER13167.1| putative retrovirus-like polyprotein [Phaseolus vulgaris]
Length=1009

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (48%), Gaps = 6/94 (6%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S SKL+ + +C LI   ++C IQ+    + IGI     GLY  +S    
Sbjct  678  LYVPQLSFNLVSTSKLSLNMNCSLIFSSNNCMIQDNTTKERIGIVSVKAGLYAFESSF--  735

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
                T    + +   S  C      LWHYR+GHL
Sbjct  736  -FRNTATHTIAH---SFNCTVKDINLWHYRMGHL  765



>emb|CAN62317.1| hypothetical protein VITISV_026526 [Vitis vinifera]
Length=768

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP-PLLKTGV  110
            NLIS SK+T+  +C +   + S  +Q+++  K IGI +ES GLY++ SP SP   + T  
Sbjct  335  NLISISKITRTLNCSITFSNKSVILQDRSTGKTIGIGRESQGLYHLTSPSSPAACISTDA  394

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  395  P----------------LLIHSRLGH  404



>ref|XP_003604634.1| hypothetical protein MTR_4g015340 [Medicago truncatula]
 gb|AES86831.1| hypothetical protein MTR_4g015340 [Medicago truncatula]
Length=317

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 11/100 (11%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKT  116
            F +NLIS +K+    +C +  L D C IQ+    KMIG+A    GLY ++   S     +
Sbjct  188  FNVNLISIAKIISSLNCYVKFLPDKCIIQDLITNKMIGLADPYGGLYKLRISPSAFAFNS  247

Query  115  GVPGL-----------ENNMFSSTCNFAYSQLWHYRLGHL  29
             V  +           ++ + SS  +   S LWH+RLGHL
Sbjct  248  SVSHISHCNISINKDYQSFVSSSFTHIPDSALWHFRLGHL  287



>emb|CAN84135.1| hypothetical protein VITISV_000113 [Vitis vinifera]
Length=1323

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP  +   VP
Sbjct  377  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAKM---VP  433

Query  106  GLENNMFSSTCNFAYSQLWHYRL  38
               + + S  C F +S + H R+
Sbjct  434  RF-STLSSLPCEFMFSLVKHTRV  455



>ref|XP_010513388.1| PREDICTED: uncharacterized protein LOC104789378 [Camelina sativa]
Length=539

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 11/93 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F   LIS S+L K + C  I  D  C +Q++    +IG  +E +G+YY     + 
Sbjct  444  LYVPNFNCTLISVSRLLKQTGCIAIFTDTLCVLQDRFTKTLIGTGEEHDGVYYFTGVTAA  503

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             + +T    + +           S+LWH RLG+
Sbjct  504  RVHRTAAHQISS-----------SKLWHRRLGY  525



>ref|XP_007029052.1| Uncharacterized protein TCM_024962 [Theobroma cacao]
 gb|EOY09554.1| Uncharacterized protein TCM_024962 [Theobroma cacao]
Length=103

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS  143
            L++  F  NLIS SKLT   +CC+    + C  Q+    ++IG  +ES GLYY+ +
Sbjct  48   LNLPKFSFNLISVSKLTSALNCCISFFPNFCLFQDLTTKRIIGTGRESEGLYYLDT  103



>ref|XP_004301682.1| PREDICTED: uncharacterized protein LOC101303134 [Fragaria vesca 
subsp. vesca]
Length=690

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 4/94 (4%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAK-ESNGLYYIQSPQS  134
            LHV    +NL+S +KL +D+ C +I+ D    +Q+K   K +   K  ++GLY  +SP+ 
Sbjct  211  LHVPSLVVNLLSFNKLCRDNHCYIIMDDVDIMMQDKASRKTLYEGKTNADGLYLFKSPR-  269

Query  133  PPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                K+ +P +     +   +   S LWH RLGH
Sbjct  270  --FSKSSLPSVSATATAFVGSSISSSLWHKRLGH  301



>ref|XP_010269630.1| PREDICTED: uncharacterized protein LOC104606228 [Nelumbo nucifera]
Length=462

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S S+L +DS+C +   +  C I ++    +IG  ++  GLYY QS  S 
Sbjct  356  LYVPNLNCNLLSVSQLIEDSNCVVQFTNKLCVIHDRTTRMLIGAGEQREGLYYFQSITST  415

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
              +KT     E+  +          +WH RLGH
Sbjct  416  RAMKT----TESXTWD---------IWHQRLGH  435



>ref|XP_004514121.1| PREDICTED: uncharacterized protein LOC101493292 [Cicer arietinum]
Length=1614

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 5/93 (5%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S SKLT+D +C    L   C  Q+ +  + IG A+E  GLY++Q+ +  
Sbjct  416  LYVPKLNCNLLSISKLTQDLNCFTKFLPHLCEFQDLDSGRKIGNAEECAGLYFLQASEFK  475

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                  V      + +S        LWHYRLGH
Sbjct  476  KRRNNSV-----YVAASRGENEAVMLWHYRLGH  503



>emb|CAN72141.1| hypothetical protein VITISV_017108 [Vitis vinifera]
Length=1416

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            LHV     NL+  SKL++D +CC+I  +  C  Q+++  K IG A+  NGLYY +
Sbjct  338  LHVPKLTCNLLFVSKLSRDFNCCVIFYESHCIFQDRSSRKTIGSARMINGLYYFE  392



>emb|CAN80074.1| hypothetical protein VITISV_018877 [Vitis vinifera]
Length=1001

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP-PLLK  119
            +  NLIS SK+T+  +C +   D S  +Q+++  + I I +ES GLY++ SP SP   + 
Sbjct  329  YPFNLISISKITRTLNCSITFFDKSVILQDQSTGQTIDIGRESQGLYHLTSPSSPAACIS  388

Query  118  TGVPGLENN  92
            T  P L +N
Sbjct  389  TDAPLLIHN  397



>ref|XP_010274487.1| PREDICTED: uncharacterized protein LOC104609798 [Nelumbo nucifera]
Length=569

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+VS    NLIS S+L ++S+C + + +  C +Q++     IG  +   GLYY +   S 
Sbjct  362  LYVSRLNCNLISVSQLLEESNCNIQITNKFCVVQDRTSRMAIGAGELREGLYYFKDACSS  421

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
               K  V              A  +LWH R+GH
Sbjct  422  KFHKAKVK-------------ASYELWHKRIGH  441



>emb|CAN67120.1| hypothetical protein VITISV_017484 [Vitis vinifera]
Length=1179

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 45/87 (52%), Gaps = 15/87 (17%)
 Frame = -2

Query  289  INLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGV  110
             NLIS SK+T+  +C +   D S  + +++  K IGI +ES GLY++ SP SP      V
Sbjct  337  FNLISISKITRTLNCSITFSDKSVILWDRSTGKTIGIGRESQGLYHLASPSSP------V  390

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGHL  29
              +  +          S L H RLGHL
Sbjct  391  ACISTDA---------SLLIHSRLGHL  408



>emb|CAN62906.1| hypothetical protein VITISV_043610 [Vitis vinifera]
Length=1498

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 14/99 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F ++LIS S+LTK  +C +      C +Q+    + IG+ K+ + LYY       
Sbjct  454  LSVPTFKVDLISVSRLTKGLNCSVTFFPYWCILQDLATRRTIGLGKQRDRLYY-------  506

Query  130  PLLKTGVPGLENNMFSST----CNFAYS--QLWHYRLGH  32
             L+         N  SST    CN A S   LWH RLGH
Sbjct  507  -LVALATEKSLTNHSSSTNQPACNLAISSTDLWHSRLGH  544



>emb|CAN80841.1| hypothetical protein VITISV_002785 [Vitis vinifera]
Length=1184

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ SP +P + + T  
Sbjct  379  NLISISKITRTLNCSITFSDKFMTLQDRSTGKTIGIGRESQGLYHLTSPSTPAVCISTDA  438

Query  109  PGLENN  92
            P L +N
Sbjct  439  PLLIHN  444



>ref|XP_009606993.1| PREDICTED: uncharacterized protein LOC104101248 [Nicotiana tomentosiformis]
Length=484

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F  NL+S SKLTK   CC+    D C  Q+    K+ GI KE +GLY +Q  +  
Sbjct  226  LYVPLFKYNLLSISKLTKQLQCCVDFYPDFCIFQDLCTSKVKGIGKEKDGLYLLQPTKKL  285

Query  130  PLLKTGVP  107
              +K  VP
Sbjct  286  SPVKAHVP  293



>ref|XP_010424622.1| PREDICTED: uncharacterized protein LOC104709756 [Camelina sativa]
Length=915

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 13/84 (15%)
 Frame = -2

Query  283  LISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVPG  104
             +S SKL KDS+C     D  C +Q++    +IG  KE +G+YY    ++  + K     
Sbjct  430  FLSVSKLLKDSNCFAFFTDAVCVLQDRFSRTLIGAGKERDGVYYFADDKTARVNK-----  484

Query  103  LENNMFSSTCNFAYSQLWHYRLGH  32
                    T      QLWH RLGH
Sbjct  485  --------TVRKVDEQLWHQRLGH  500



>ref|XP_010675988.1| PREDICTED: uncharacterized protein LOC104891900 [Beta vulgaris 
subsp. vulgaris]
Length=968

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 34/95 (36%), Positives = 44/95 (46%), Gaps = 17/95 (18%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V +   NL+S S+LT   +C L    D C IQ+ +   +IG A   NGLYY     S 
Sbjct  439  LFVPHLHCNLLSVSQLTAAMNCVLKFDSDVCVIQDPSR-NLIGTAVRRNGLYYFGGGSSA  497

Query  130  PLLKTG--VPGLENNMFSSTCNFAYSQLWHYRLGH  32
              +  G  VP LE              LWH+R+GH
Sbjct  498  HHVSVGEVVPSLE--------------LWHHRMGH  518



>emb|CAN66185.1| hypothetical protein VITISV_025185 [Vitis vinifera]
Length=676

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T V
Sbjct  297  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPVVCISTDV  356

Query  109  PGLENN  92
            P L +N
Sbjct  357  PLLIHN  362



>ref|XP_010666583.1| PREDICTED: uncharacterized protein LOC104883727 [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 17/102 (17%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LH+  F  NLIS  KLT DS C +    D C+IQ  +  K   ++K  NGLY +  P   
Sbjct  263  LHIPDFKFNLISIPKLTHDSKCEISSSSDYCYIQCPSLKKPQLLSKIKNGLYCLAHPSV-  321

Query  130  PLLKTGVPGLENNMFSSTCN--------FAYSQLWHYRLGHL  29
                      ++N+ S+ C+           ++LWH RLGH+
Sbjct  322  --------HSDDNLQSAVCSSITNDQTAIDQAKLWHLRLGHM  355



>ref|XP_003621937.1| hypothetical protein MTR_7g025220 [Medicago truncatula]
Length=455

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 10/102 (10%)
 Frame = -2

Query  307  HVSY---FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQ  137
            HV Y   F IN+IS SKL +  SC +   + +C IQ     +MIG+ +  NGLY ++  Q
Sbjct  301  HVLYSPMFQINVISVSKLCESLSCYVKFSNSTCMIQAMKCPQMIGLGELVNGLYRLKV-Q  359

Query  136  SPPLLKTGVPGLENNMFSSTCNFAY------SQLWHYRLGHL  29
             P           +   +S  N AY      S LWH+RLGHL
Sbjct  360  DPAPFFVNSVSSSSIFSNSCNNVAYETYIPMSALWHFRLGHL  401



>ref|XP_010258252.1| PREDICTED: uncharacterized protein LOC104598055 [Nelumbo nucifera]
Length=269

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 42/94 (45%), Gaps = 5/94 (5%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S SKLTK+ +C +      C  Q++   + IG   E  GLYY  +    
Sbjct  163  LHVPSLTSNLLSVSKLTKNLNCSITFFPTHCVFQDRLTRRTIGSGHEYGGLYYFDADIGS  222

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             L  +     E     S  +     LWH RLG++
Sbjct  223  ALQASATTSPE-----SMESITRLHLWHARLGYV  251



>emb|CAN70756.1| hypothetical protein VITISV_014702 [Vitis vinifera]
Length=1212

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+   +  NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP
Sbjct  306  LYTPEYPFNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSP  365

Query  130  PL-LKTGVPGLENN  92
             + + T  P L +N
Sbjct  366  AVCISTDAPLLIHN  379



>emb|CAN63507.1| hypothetical protein VITISV_029435 [Vitis vinifera]
Length=1211

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+ S    NLIS SK+T   +C +   D    +Q+++  K IGI +ES GLYY+ S  SP
Sbjct  404  LYTSKCPFNLISISKITHTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYYLTSDSSP  463

Query  130  PLLKTGVPGLENNMFSSTCN  71
              L+  VP    ++F    N
Sbjct  464  ASLQ--VPEDGPSLFPKRLN  481



>ref|XP_010431064.1| PREDICTED: uncharacterized protein LOC104715347 [Camelina sativa]
Length=614

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 12/93 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F   LIS +KL K + C  +  D  CF+Q++    +IG  +E  G+YY       
Sbjct  432  LFVPDFNCTLISVAKLLKHTGCIAVFTDTLCFLQDRFTRTLIGAGEEREGVYYF------  485

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                TGV  L   +       + + LWH RLGH
Sbjct  486  ----TGV--LAARVHKVVKESSSAILWHQRLGH  512



>gb|AAT40486.1| putative polyprotein [Solanum demissum]
Length=1065

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 15/93 (16%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NLI  SKLT +++C +I  D  C IQ++    +IG+ ++ +G+YY ++    
Sbjct  389  LYVPQLKCNLIVVSKLTIENNCLVIFSDKLCVIQDRTLRTVIGVGEQCDGVYYFKAQA--  446

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                      + N      NF    LWH RLGH
Sbjct  447  ----------QANNTHKVDNF---DLWHRRLGH  466



>ref|XP_010683835.1| PREDICTED: uncharacterized protein LOC104898448 [Beta vulgaris 
subsp. vulgaris]
Length=477

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYY  152
            LH+  F  NL+S +KLT++ +C +I     C IQ+ N   + GI K  NGLYY
Sbjct  425  LHIPSFKHNLVSVTKLTQEGNCKIIFHHKYCVIQDTNSNAVKGIGKAVNGLYY  477



>dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1491

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     +LIS SKL K   C  +  D  C +Q++    +IG  +E +G+YY+    + 
Sbjct  440  LYVPALNCSLISVSKLVKQIKCLALFTDTICVLQDRFSRTLIGTGEERDGVYYLTDAATT  499

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             + K  V          T + A   LWH RLGH
Sbjct  500  TVHKVDV----------TTDHA---LWHQRLGH  519



>ref|XP_004240625.1| PREDICTED: uncharacterized protein LOC101261123 [Solanum lycopersicum]
Length=943

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 47/101 (47%), Gaps = 19/101 (19%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLY--YIQSPQ--  137
            V  F  NL+S S++TKD +CC+      C +Q+    K+  I KE +GLY  Y Q  Q  
Sbjct  450  VPAFKFNLLSVSQMTKDLNCCVTFYPSCCVLQDLGSGKVRMIGKEEDGLYTFYSQPGQYD  509

Query  136  -----SPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
                  P    T +  +E N          + +WH RLGH+
Sbjct  510  HNKMLQPHHCMTTIQSVEAN----------ANIWHQRLGHV  540



>emb|CAN63908.1| hypothetical protein VITISV_044218 [Vitis vinifera]
Length=1236

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 13/101 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYI-----Q  146
            L V  F ++L+S S++TKD +C +      C +Q+      IG+ ++ +GLYY+     +
Sbjct  413  LGVPSFKVDLMSVSRVTKDLNCSVTFFPHWCILQDLTTRTTIGLGEQRDGLYYLVALASK  472

Query  145  SP--QSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             P  Q+P    T      + + SST       LWH  LGHL
Sbjct  473  KPKTQTPSAAATSCRSPSSQVTSSTA------LWHRCLGHL  507



>emb|CAN74194.1| hypothetical protein VITISV_040578 [Vitis vinifera]
Length=1353

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 3/93 (3%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S S+LT+D +C    L   C  Q  N  K IG A+   GLY +++ +  
Sbjct  379  LYVPKLDCNLLSISRLTQDLNCVTKFLPHMCEFQALNSGKRIGNAEVRAGLYLLRAEEIR  438

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L       + N    ST   +   LWHYRLGH
Sbjct  439  RLPMKTACVVSN---PSTKTDSVVMLWHYRLGH  468



>ref|XP_009599421.1| PREDICTED: uncharacterized protein LOC104095077, partial [Nicotiana 
tomentosiformis]
Length=909

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLY  155
            LH++ F  NL+S SKLTK+  C      D C  QE +  K++GI KE  GLY
Sbjct  396  LHITEFKYNLLSVSKLTKELRCLAAFYPDICVFQELSSGKVLGIGKEELGLY  447



>emb|CAN77739.1| hypothetical protein VITISV_043316 [Vitis vinifera]
Length=548

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 8/94 (9%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLD-DSCFIQEKNGCKMIGIAKESNGLYYIQSPQS  134
            L+V  F  NLI  S LT+ S CC +  + +SCFIQ++   +MIGI +    LY +     
Sbjct  147  LYVPQFRFNLILISALTQ-SHCCFVKFEFESCFIQDRMQRQMIGIGRRDGNLYVLDPANL  205

Query  133  PPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             P L     GL NN+  +       ++WH  L H
Sbjct  206  FPTL-AHTSGLCNNVSKTN-----HEIWHTHLSH  233



>ref|XP_007048348.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX92505.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=230

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ  146
            L +S F  NL+S  KLT+D +C L    + C IQ+    ++IG+ +  +GLYY++
Sbjct  22   LRISNFNFNLLSVIKLTQDLNCVLTFWLEFCVIQDLPSRRLIGVGRVHDGLYYLE  76



>emb|CAN61738.1| hypothetical protein VITISV_000022 [Vitis vinifera]
Length=479

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+S SKLTKD    +  L   C  +E    K IG AKE  GLYY ++ Q+ 
Sbjct  125  LHVPKLACNLLSISKLTKDLDFSIQFLPSHCEFEEVTSGKRIGNAKELGGLYYFENKQA-  183

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQ--LWHYRL  38
                           +S+  F  ++  LWH+RL
Sbjct  184  ----------STRSCASSSLFRKNEIMLWHFRL  206



>gb|ABI34293.1| Integrase core domain containing protein [Solanum demissum]
Length=716

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 43/92 (47%), Gaps = 8/92 (9%)
 Frame = -2

Query  304  VSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL  125
            V  F  NL+S SK+TKD + C+    + C  Q+    K+    +E NGLY + +  +   
Sbjct  253  VPSFKFNLMSVSKVTKDMNGCVKFYPEQCVFQDLCTGKVKVTGREKNGLYILNTRNNDHF  312

Query  124  LKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
            L  G         S T +     LWH RLGH+
Sbjct  313  LTEGR--------SMTVSRPLPDLWHRRLGHV  336



>gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1501

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V      LIS SKL K + C     D  CF+Q+++   +IG  +E  G+YY+ +  +P
Sbjct  457  LFVPSLNCTLISVSKLLKQTQCLATFTDTLCFLQDRSSKTLIGSGEERGGVYYL-TDVTP  515

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
              + T       N+ S         LWH RLGH
Sbjct  516  AKIHTA------NVDSD------QALWHQRLGH  536



>emb|CAN76019.1| hypothetical protein VITISV_010645 [Vitis vinifera]
Length=698

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+   +  NLIS SK+T+  +C +   D    +Q+++  K IGI  ES GLY++ SP +P
Sbjct  105  LYAPEYPFNLISISKITRTLNCSITFSDKFVTMQDRSTGKTIGIGHESQGLYHLTSPSTP  164

Query  130  PL-LKTGVPGL  101
             + + T  P L
Sbjct  165  AVCISTDAPLL  175



>emb|CAN65410.1| hypothetical protein VITISV_040416 [Vitis vinifera]
Length=2253

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286   NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
             NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  942   NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  1001

Query  109   PGLENN  92
             P L +N
Sbjct  1002  PLLIHN  1007



>emb|CAN76196.1| hypothetical protein VITISV_041073 [Vitis vinifera]
Length=1505

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 46/95 (48%), Gaps = 8/95 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ--SPQ  137
            LHV     NL+S SK+T+D  C        C  QE    + IG A+E  GLY+ +  S  
Sbjct  415  LHVPNLSCNLLSISKITQDHQCQANFYPSYCEFQELTSGRTIGNAREIGGLYFFENGSES  474

Query  136  SPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
              P+  T     E+   +S+ +     LWHYRLGH
Sbjct  475  RKPIQST---CFESISVASSDDII---LWHYRLGH  503



>emb|CAN79194.1| hypothetical protein VITISV_000236 [Vitis vinifera]
Length=1210

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSP  140
            NLIS SK+T+  +C +I  D S  +Q+ +  K IGI +ES GLY++ SP
Sbjct  518  NLISISKITRTLNCSIIFSDKSVILQDWSTGKTIGIGRESQGLYHLTSP  566



>emb|CAN69819.1| hypothetical protein VITISV_025708 [Vitis vinifera]
Length=1626

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  825  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  884

Query  109  PGLENN  92
            P L +N
Sbjct  885  PLLIHN  890



>gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana]
Length=1522

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 12/85 (14%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            +L+S SKLT D  C +    DS  I +K   K++ + +  +GLY ++ P+    L+    
Sbjct  394  SLLSVSKLTSDYPCSVEFDADSVRINDKATKKLLVMGRNRDGLYSLEEPK----LQV---  446

Query  106  GLENNMFSSTCNFAYSQLWHYRLGH  32
                 ++S+  N A S++WH RLGH
Sbjct  447  -----LYSTRQNSASSEVWHRRLGH  466



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  359  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  418

Query  109  PGLENN  92
            P L +N
Sbjct  419  PLLIHN  424



>emb|CAN67076.1| hypothetical protein VITISV_042382 [Vitis vinifera]
Length=1236

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/66 (41%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  KMIGI  ES GLY++ S  SP + + T  
Sbjct  302  NLISISKITRTLNCSITFSDKFVTLQDQSTGKMIGIGGESQGLYHLTSDSSPAVCISTDA  361

Query  109  PGLENN  92
            P L +N
Sbjct  362  PLLIHN  367



>emb|CAN75292.1| hypothetical protein VITISV_014745 [Vitis vinifera]
Length=1472

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 47/100 (47%), Gaps = 14/100 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F ++LI  S+LT+  +C +      C +Q     + IG+ K+ +GLYY       
Sbjct  423  LFVLTFKVDLILVSRLTRGLNCSMTFFPYWCILQNLATRRTIGLGKQRDGLYY-------  475

Query  130  PLLKTGVPGLENNMFSST----CNFAYS--QLWHYRLGHL  29
             L+         N  SST    CN A S   LWH RLGH+
Sbjct  476  -LVALATEKSLTNHSSSTNQPACNLAISSTDLWHSRLGHV  514



>emb|CAN73074.1| hypothetical protein VITISV_032386 [Vitis vinifera]
Length=1195

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  339  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  398

Query  109  PGLENN  92
            P L +N
Sbjct  399  PLLIHN  404



>emb|CAN72018.1| hypothetical protein VITISV_001841 [Vitis vinifera]
Length=1225

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  358  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  417

Query  109  PGLENN  92
            P L +N
Sbjct  418  PLLIHN  423



>gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1413

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 13/93 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     +LIS SKL K   C  +  D  C +Q++    +IG  +E +G+YY+    + 
Sbjct  440  LYVPALNCSLISVSKLVKQIKCLALFTDTICVLQDRFSRTLIGTGEERDGVYYLTDAATT  499

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             + K  +          T + A   LWH RLGH
Sbjct  500  TVHKVDI----------TTDHA---LWHQRLGH  519



>emb|CAN78616.1| hypothetical protein VITISV_003658 [Vitis vinifera]
Length=2172

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286   NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
             NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  1091  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  1150

Query  109   PGLENN  92
             P L +N
Sbjct  1151  PLLIHN  1156



>emb|CAN82064.1| hypothetical protein VITISV_022772 [Vitis vinifera]
Length=1224

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  396  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  455

Query  109  PGLENN  92
            P L +N
Sbjct  456  PLLIHN  461



>emb|CAN61179.1| hypothetical protein VITISV_032292 [Vitis vinifera]
Length=1237

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  377  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  436

Query  109  PGLENN  92
            P L +N
Sbjct  437  PLLIHN  442



>emb|CAN75744.1| hypothetical protein VITISV_040125 [Vitis vinifera]
Length=1257

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  377  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  436

Query  109  PGLENN  92
            P L +N
Sbjct  437  PLLIHN  442



>emb|CAN63730.1| hypothetical protein VITISV_030286 [Vitis vinifera]
Length=1205

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  361  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  420

Query  109  PGLENN  92
            P L +N
Sbjct  421  PLLIHN  426



>emb|CAN69688.1| hypothetical protein VITISV_026774 [Vitis vinifera]
Length=1382

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  573  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  632

Query  109  PGLENN  92
            P L +N
Sbjct  633  PLLIHN  638



>emb|CAN65932.1| hypothetical protein VITISV_016257 [Vitis vinifera]
Length=498

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  359  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  418

Query  109  PGLENN  92
            P L +N
Sbjct  419  PLLIHN  424



>ref|XP_010535249.1| PREDICTED: uncharacterized protein LOC104810602 [Tarenaya hassleriana]
Length=486

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 13/93 (14%)
 Frame = -2

Query  295  FGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKT  116
            F  NL+S S LT+D+   +    DS  IQ+     MIG  K+ + LY+++          
Sbjct  389  FHFNLLSVSALTRDTPFTVSFSHDSYMIQDPTQALMIGRGKKRHNLYFLE--------LQ  440

Query  115  GVPGLENNMFSSTCNFAYS-----QLWHYRLGH  32
            G+P   + +F      A S      LWH RLGH
Sbjct  441  GIPSSSSPVFPDALCTALSAPASIDLWHTRLGH  473



>emb|CAN69184.1| hypothetical protein VITISV_004341 [Vitis vinifera]
Length=1360

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 3/93 (3%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL+S S+LT+D +C    L   C  Q  N  K IG A+   GLY +++ +  
Sbjct  368  LYVPKLDCNLLSISRLTQDLNCVTKFLPHMCEFQALNSGKRIGNAEVRXGLYLLRAEEIR  427

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             L       + N    ST   +   LWHYRLGH
Sbjct  428  RLPMKTACVVSN---PSTKTDSVVMLWHYRLGH  457



>emb|CAN75922.1| hypothetical protein VITISV_030752 [Vitis vinifera]
Length=1214

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  361  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  420

Query  109  PGLENN  92
            P L +N
Sbjct  421  PLLIHN  426



>emb|CAN76133.1| hypothetical protein VITISV_036298 [Vitis vinifera]
Length=1161

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  297  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  356

Query  109  PGLENN  92
            P L +N
Sbjct  357  PLLIHN  362



>emb|CAN62074.1| hypothetical protein VITISV_001619 [Vitis vinifera]
Length=1237

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  323  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  382

Query  109  PGLENN  92
            P L +N
Sbjct  383  PLLIHN  388



>ref|XP_010320045.1| PREDICTED: uncharacterized protein LOC104647124 [Solanum lycopersicum]
Length=457

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS  143
            L +  F  NL+S S+LTK   C +I   D C  Q+ +  K++GI +E  GLY +Q+
Sbjct  388  LFIPEFKYNLLSVSQLTKQLKCAVIFFPDFCVFQDLSNGKVLGIGREDQGLYLLQT  443



>emb|CAN67317.1| hypothetical protein VITISV_019719 [Vitis vinifera]
Length=1240

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  392  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  451

Query  109  PGLENN  92
            P L +N
Sbjct  452  PLLIHN  457



>emb|CAN68904.1| hypothetical protein VITISV_025822 [Vitis vinifera]
Length=487

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 46/94 (49%), Gaps = 15/94 (16%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+ S    NLIS SK+T+  +C +   D    +Q+++  K I I +ES GLY++ SP +P
Sbjct  345  LYASECPFNLISISKITRTLNCSITFSDKFVTLQDRSMRKTISIGRESQGLYHLTSPSTP  404

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
             +  +    L               L H RLGHL
Sbjct  405  AVCISTDASL---------------LIHSRLGHL  423



>emb|CAN80753.1| hypothetical protein VITISV_003323 [Vitis vinifera]
Length=1304

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  366  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  425

Query  109  PGLENN  92
            P L +N
Sbjct  426  PLLIHN  431



>emb|CAN81099.1| hypothetical protein VITISV_017741 [Vitis vinifera]
Length=1455

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 7/100 (7%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQ--  137
            LHV     NL+S SK  KD+        DSCF++++    ++ + K  +GLY   S    
Sbjct  431  LHVPSITKNLLSVSKFAKDNKVFFEFHSDSCFVKDQVTQAVLMVGKVRDGLYAFDSSHLA  490

Query  136  -SPPLLKTGVPGLENNMFSS-TCNFAYS---QLWHYRLGH  32
              P    +  P +  + FSS  C  + S    LWH RLGH
Sbjct  491  LRPTQSLSKSPSVVASSFSSKVCTTSLSSTFDLWHKRLGH  530



>emb|CAN80247.1| hypothetical protein VITISV_027801 [Vitis vinifera]
Length=1001

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+ +  +C +   +    +Q+++  K IGI  ES GLY++ SP +P L + T V
Sbjct  223  NLISISKIIRTLNCSITFSNKFVTLQDRSTGKTIGIGHESQGLYHLTSPSTPALCISTDV  282

Query  109  PGLENN  92
            P L +N
Sbjct  283  PLLIHN  288



>ref|XP_007032202.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY03128.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=647

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 47/101 (47%), Gaps = 11/101 (11%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQ-----  146
            L V  F  NLIS S+L+K  + CLI  +  C I E     MIG+A+   GL+ +Q     
Sbjct  234  LFVPSFKFNLISVSQLSKSRNHCLIFTNKHCIILEIPSWTMIGVAEVKVGLHLMQCKLLG  293

Query  145  -SPQSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHLL  26
              PQ      T +     N  S   N     LWH+RL H+L
Sbjct  294  KRPQGSISASTTIKIPICNSVSLRFN-----LWHHRLRHIL  329



>emb|CAN66243.1| hypothetical protein VITISV_015916 [Vitis vinifera]
Length=1258

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 41/86 (48%), Gaps = 16/86 (19%)
 Frame = -2

Query  289  INLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGV  110
             NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ SP     + T  
Sbjct  352  FNLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSPSPAVCISTDA  411

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  412  P----------------LLIHSRLGH  421



>emb|CAN62535.1| hypothetical protein VITISV_041880 [Vitis vinifera]
Length=1314

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  377  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  436

Query  109  PGLENN  92
            P L +N
Sbjct  437  PLLIHN  442



>ref|XP_010666786.1| PREDICTED: uncharacterized protein LOC104883908 [Beta vulgaris 
subsp. vulgaris]
Length=394

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (49%), Gaps = 7/94 (7%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NLIS  KL KD SC ++   + C IQ  N      + +  +GLY ++   S 
Sbjct  162  LHVLGFKFNLISTHKLCKDLSCEVVFSHNKCIIQGPNMNPSQVLGEPHSGLYVVEDKCSK  221

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGHL  29
                  +  +E+   S T     ++LWH RLGH+
Sbjct  222  ------LSNIEDGA-SCTTTLEDAKLWHLRLGHM  248



>ref|XP_009102751.1| PREDICTED: uncharacterized protein LOC103828864 [Brassica rapa]
Length=673

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 42/93 (45%), Gaps = 10/93 (11%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F   LIS SKL K + C  I  D  C +Q++    +IG  +E  G+YY  S    
Sbjct  431  LYVPDFNCTLISVSKLLKQTGCIAIFTDTICVLQDRFTRTLIGAGEEREGVYYFSSVTVA  490

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             + K G     ++          S LWH RL H
Sbjct  491  RVNKAGQIKTPSS----------SVLWHRRLEH  513



>ref|XP_006594179.1| PREDICTED: uncharacterized protein LOC102659499 isoform X1 [Glycine 
max]
 ref|XP_006594180.1| PREDICTED: uncharacterized protein LOC102659499 isoform X2 [Glycine 
max]
Length=307

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L++  F  NLIS SKL  +  C LI   D C I +    +MIG  +   GLY +  P + 
Sbjct  207  LYLPIFNFNLISISKLVANLRCQLIFSSDHCLILDVTNQRMIGTIECVQGLYRLMLPSAE  266

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
             ++   +     ++FS  CN     L H+ LGH
Sbjct  267  SVVINTISLNAKSVFS--CNKVPINLCHFCLGH  297



>emb|CAB10225.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
 emb|CAB78488.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
Length=1489

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 44/98 (45%), Gaps = 15/98 (15%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV  F  NL+S S L K  SC      D C IQE +   MIG  +  + LY +++  + 
Sbjct  521  LHVPDFKFNLMSVSSLVKTISCSAHFYVDCCLIQELSQGLMIGRGRLYHNLYILETENTS  580

Query  130  PLLKTGVPGLENNMFSSTCNFAYS-----QLWHYRLGH  32
            P   T  P        + C F  S      LWH RLGH
Sbjct  581  P--STSTP--------AACLFTGSVLNDGHLWHQRLGH  608



>emb|CAN81916.1| hypothetical protein VITISV_038548 [Vitis vinifera]
Length=1202

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ SP     + T  P
Sbjct  380  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIRRESQGLYHLTSPSPAVCISTDAP  439

Query  106  GL  101
             L
Sbjct  440  LL  441



>emb|CAN70277.1| hypothetical protein VITISV_022230 [Vitis vinifera]
Length=1166

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 42/86 (49%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP-PLLKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IG  +ES GLY++ SP SP   + T  
Sbjct  384  NLISISKITRTLNCSITFSDKFVILQDRSMGKTIGRGRESQGLYHLTSPSSPAACISTDA  443

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  444  P----------------LLIHSRLGH  453



>emb|CAN81139.1| hypothetical protein VITISV_018760 [Vitis vinifera]
Length=1403

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  495  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPXVCISTDA  554

Query  109  PGLENN  92
            P L +N
Sbjct  555  PLLIHN  560



>emb|CAN60837.1| hypothetical protein VITISV_033823 [Vitis vinifera]
Length=1155

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 15/86 (17%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS SK+T   +C +   D S  + +++  K IGI +ES GLY++ SP SP        
Sbjct  347  NLISISKITCTLNCSITFSDKSVILWDRSTGKTIGIGRESQGLYHLASPSSP--------  398

Query  106  GLENNMFSSTCNFAYSQLWHYRLGHL  29
                    +  +   S L H RLGHL
Sbjct  399  -------VACISTDASLLIHSRLGHL  417



>emb|CAN68348.1| hypothetical protein VITISV_032025 [Vitis vinifera]
Length=1670

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 43/86 (50%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  339  NLISISKITRTLNCSITFXDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPTVCISTDA  398

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  399  P----------------LLIHXRLGH  408



>gb|ABA95797.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1588

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQ  137
            LHV  F +NL+S S +     C +I  ++SC  QEK   + IG     NGL+YI   +
Sbjct  489  LHVPSFPVNLLSVSSIIDQFKCIVIFDENSCLFQEKGTGRRIGTGVRRNGLWYINQEE  546



>gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum]
Length=1775

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 43/94 (46%), Gaps = 17/94 (18%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V     NL S S+LTK   C +   DD   +Q+++  +MIG   ES GLYY+ S  S 
Sbjct  417  LYVPGSPFNLASVSRLTKALHCSITFFDDFFLMQDRSTGQMIGTGHESQGLYYLTSSNS-  475

Query  130  PLLKTGVPGLENNMFSSTCNFAYS-QLWHYRLGH  32
                            + C+   S  L H RLGH
Sbjct  476  ---------------LAACSITDSPDLIHKRLGH  494



>ref|XP_010490134.1| PREDICTED: uncharacterized protein LOC104767865 [Camelina sativa]
Length=721

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 46/97 (47%), Gaps = 17/97 (18%)
 Frame = -2

Query  310  LHVSYF--GI--NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQS  143
            LH  YF  G+  +LIS S+LT+D  C   + +  C IQ++    +IG  ++ NGLY+ QS
Sbjct  306  LHDVYFFDGLQCHLISVSQLTRDRGCVFQITNTLCVIQDRITRMLIGSGEQHNGLYFFQS  365

Query  142  PQSPPLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                         ++            S+LWH  LGH
Sbjct  366  -------------MDVAATMHITKVTSSELWHQPLGH  389



>emb|CAN60627.1| hypothetical protein VITISV_018874 [Vitis vinifera]
Length=416

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYY  152
            LHV     NL+S S+LTK S+C    L   C  Q+ +  K IG  KE  GLYY
Sbjct  356  LHVPNLSCNLLSISQLTKQSNCSAKFLPSHCVFQDLSSGKTIGSVKECEGLYY  408



>emb|CAN73696.1| hypothetical protein VITISV_038483 [Vitis vinifera]
Length=1783

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 14/100 (14%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F ++LIS S+LT+  +C +      C +Q+    + IG+ K+ +GLYY+ +  + 
Sbjct  807  LSVPTFKVDLISVSRLTRGLNCSVTCFPYWCILQDLATRRTIGLGKQRDGLYYLVALATE  866

Query  130  PLLKTGVPGLENNMFSST----CNFAYS--QLWHYRLGHL  29
              L         N  SST    CN A S   LWH  LGH+
Sbjct  867  KSL--------TNHSSSTNQPACNLAISSTDLWHSCLGHV  898



>emb|CAN81288.1| hypothetical protein VITISV_036901 [Vitis vinifera]
Length=520

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP
Sbjct  361  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSP  412



>emb|CAN65229.1| hypothetical protein VITISV_011708 [Vitis vinifera]
Length=1149

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 44/94 (47%), Gaps = 15/94 (16%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V     NLIS S+L +DS   + + D  C IQ+++  K+IG  ++  GLY++    S 
Sbjct  364  LFVPKLKCNLISVSQLLRDSGLVIQLTDKFCVIQDRSTRKVIGAGEQREGLYFLNGAASV  423

Query  130  PLLK-TGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
               K  GV   E              LWH R+G+
Sbjct  424  HAFKMNGVTSFE--------------LWHRRMGY  443



>ref|XP_009631584.1| PREDICTED: uncharacterized protein LOC104121324 [Nicotiana tomentosiformis]
Length=673

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 7/93 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F  NL+S S+ TK+ +  +    D C  QE     + GI K   GL YI +P +P
Sbjct  370  LYVPEFQFNLLSVSRYTKELNSSVHFYPDFCVFQELFNGMVKGIGKLKGGL-YILNPSTP  428

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                  V    +N  S++     S LWH RLGH
Sbjct  429  ------VTASASNCVSASIQSNSSALWHQRLGH  455



>emb|CAN64673.1| hypothetical protein VITISV_007430 [Vitis vinifera]
Length=1079

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 42/86 (49%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS SK+T+  +C +   D    +Q++   K IGI +ES GLY++ S  SP        
Sbjct  316  NLISISKITRTLNCSITFSDKFVTLQDRRTGKTIGIGRESQGLYHLTSDSSP--------  367

Query  106  GLENNMFSSTCNFAYSQLW-HYRLGH  32
                    + C F  + L  H RLGH
Sbjct  368  --------AVCIFTDAPLLIHNRLGH  385



>emb|CAN60593.1| hypothetical protein VITISV_023128 [Vitis vinifera]
Length=1285

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 42/86 (49%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS  K+T+  +C +   D    +Q++   KMIGI +ES GLY++  P +P + + T  
Sbjct  241  NLISIXKITRTLNCSIXFSDKFVTLQDRITGKMIGIGRESQGLYHLTXPSTPAVCISTDA  300

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  301  P----------------LLIHSRLGH  310



>emb|CAN70029.1| hypothetical protein VITISV_010388 [Vitis vinifera]
Length=1222

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLK  119
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP   K
Sbjct  343  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSNSSPTFQK  398



>emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera]
Length=1266

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  374  NLISISKITRTLNCSITFSDKFVTLQDRSMGKTIGIGRESQGLYHLTSDSSPVVCISTDA  433

Query  109  PGLENN  92
            P L +N
Sbjct  434  PLLIHN  439



>emb|CAN76658.1| hypothetical protein VITISV_025162 [Vitis vinifera]
Length=645

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 45/96 (47%), Gaps = 12/96 (13%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L+V  F  NL S S LT+   C +  L +SC IQ++   KMIG+      LY +      
Sbjct  366  LYVLQFRFNLFSISALTQFHHCSVHFLSESCLIQDRMQEKMIGMGSCFXNLYILDPANLF  425

Query  130  PLLKTGVPGLENNMFSSTCNFAYS---QLWHYRLGH  32
            P+          +  S+TCN A     QLWH  LGH
Sbjct  426  PMF---------SRVSATCNNATKSDHQLWHSCLGH  452



>ref|XP_010463456.1| PREDICTED: uncharacterized protein LOC104744141 [Camelina sativa]
Length=531

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 42/93 (45%), Gaps = 11/93 (12%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            L V  F   LI  SKL K +    I  D  CF+Q++    +IG  +E  G+YY       
Sbjct  410  LVVPDFDCTLIFVSKLLKQTGSIAIFTDTLCFLQDRFSRILIGAGEEREGVYYF------  463

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
                TGV     N  SS  + A   LWH RLGH
Sbjct  464  ----TGVSAACVNKVSSDVS-ASPALWHRRLGH  491



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+ +  K IGI +ES GLY++ S  SP + + T  
Sbjct  522  NLISISKITRTLNCSITFSDKFVTLQDXSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  581

Query  109  PGLENN  92
            P L +N
Sbjct  582  PLLIHN  587



>emb|CAN73405.1| hypothetical protein VITISV_010053 [Vitis vinifera]
Length=768

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 7/93 (8%)
 Frame = -2

Query  310  LHVSYFGINLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSP  131
            LHV     NL+   K T D  C        C +QE+   + IG+AKE +GLY+++S Q  
Sbjct  82   LHVPKLSANLVXIQKHTHDLKCYAFFFPSYCVLQEQGSGRRIGLAKEMSGLYHLESSQ--  139

Query  130  PLLKTGVPGLENNMFSSTCNFAYSQLWHYRLGH  32
               KT      + + SS  +  +  L+H RLGH
Sbjct  140  ---KTSNNLSLSLLSSSNKDTIW--LYHLRLGH  167



>emb|CAN65647.1| hypothetical protein VITISV_001300 [Vitis vinifera]
Length=1094

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 43/86 (50%), Gaps = 17/86 (20%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T   +C +   D    +Q+++  K IGI +ES GLY++ SP +P + + T  
Sbjct  269  NLISISKITCTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSPSTPAVCISTDA  328

Query  109  PGLENNMFSSTCNFAYSQLWHYRLGH  32
            P                 L H RLGH
Sbjct  329  P----------------LLIHSRLGH  338



>emb|CAN74286.1| hypothetical protein VITISV_036410 [Vitis vinifera]
Length=1262

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPL-LKTGV  110
            NLIS SK+T+  +C +   D    +Q+++  K IGI +ES GLY++ S  SP + + T  
Sbjct  377  NLISISKITRTLNCSITFSDKFVTLQDRSTGKTIGIGRESQGLYHLTSDSSPAVCISTDA  436

Query  109  P  107
            P
Sbjct  437  P  437



>ref|XP_010661279.1| PREDICTED: uncharacterized protein LOC104881770 [Vitis vinifera]
Length=853

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 41/85 (48%), Gaps = 12/85 (14%)
 Frame = -2

Query  286  NLISASKLTKDSSCCLIVLDDSCFIQEKNGCKMIGIAKESNGLYYIQSPQSPPLLKTGVP  107
            NLIS S+LTKD++CC+        IQ++    ++G+ +  NGLY +       +  T  P
Sbjct  371  NLISISQLTKDNNCCVTFSSSGFTIQDRVTRVVLGVRRCENGLYVLDRRHHALVSTTSSP  430

Query  106  GLENNMFSSTCNFAYSQLWHYRLGH  32
                         A  +LWH RLGH
Sbjct  431  R------------ASIRLWHTRLGH  443



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513816688404