BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46607_g1_i1 len=143 path=[1:0-142]

Length=143
                                                                      Score     E

ref|XP_008652277.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  48.1    1e-04   
ref|XP_008652275.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  48.1    1e-04   
ref|XP_006658495.1|  PREDICTED: subtilisin-like protease-like         47.4    2e-04   
ref|XP_009397604.1|  PREDICTED: subtilisin-like protease              46.6    4e-04   
dbj|BAJ93850.1|  predicted protein                                    46.2    5e-04   
gb|EAZ09528.1|  hypothetical protein OsI_31804                        45.8    6e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010229557.1|  PREDICTED: subtilisin-like protease SBT5.3       45.4    7e-04   
ref|XP_010933350.1|  PREDICTED: LOW QUALITY PROTEIN: CO(2)-respon...  45.8    7e-04   
ref|XP_004956009.1|  PREDICTED: subtilisin-like protease-like         45.4    0.001   
ref|XP_009614807.1|  PREDICTED: subtilisin-like protease SBT5.3       45.4    0.001   



>ref|XP_008652277.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Zea mays]
 tpg|DAA60324.1| TPA: putative subtilase family protein [Zea mays]
Length=815

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC   GC GSAIL GFDD I DGVDV+S+SLG     +PDFS
Sbjct  283  VAMYRVCSQAGCAGSAILAGFDDAIADGVDVISVSLGASPYFRPDFS  329



>ref|XP_008652275.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Zea mays]
Length=816

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC   GC GSAIL GFDD I DGVDV+S+SLG     +PDFS
Sbjct  283  VAMYRVCSQAGCAGSAILAGFDDAIADGVDVISVSLGASPYFRPDFS  329



>ref|XP_006658495.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=806

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC + GC GSAIL GFDD + DG DV+S+SLG     +PDFS
Sbjct  281  VAMYRVCSDEGCAGSAILAGFDDAVADGGDVISVSLGASPYFRPDFS  327



>ref|XP_009397604.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=776

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            IAMYRVC   GC GSAIL GFDD I+DGVD++S+SLG     +PDF+
Sbjct  255  IAMYRVCFEDGCPGSAILAGFDDAIRDGVDLMSVSLGASKFNRPDFA  301



>dbj|BAJ93850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC + GC GSAIL GFDD I DGVDV+S+SLG      PDFS
Sbjct  264  VAMYRVCSDEGCAGSAILAGFDDAIGDGVDVVSVSLGASPYFSPDFS  310



>gb|EAZ09528.1| hypothetical protein OsI_31804 [Oryza sativa Indica Group]
Length=810

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC   GC GSAIL GFDD + DGVDV+S+SLG     +PDFS
Sbjct  282  VAMYRVCSGEGCAGSAILAGFDDAVADGVDVISVSLGASPYFRPDFS  328



>ref|XP_010229557.1| PREDICTED: subtilisin-like protease SBT5.3 [Brachypodium distachyon]
Length=633

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIK  79
            IAMY+VC+N GC GSAIL GFD  IK
Sbjct  248  IAMYKVCDNSGCPGSAILAGFDAAIK  273



>ref|XP_010933350.1| PREDICTED: LOW QUALITY PROTEIN: CO(2)-response secreted protease 
[Elaeis guineensis]
Length=778

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDF  139
            IAMYRVC   GC GSAIL GFDD I DGVD+LSLSLG     +PDF
Sbjct  257  IAMYRVCSYSGCAGSAILAGFDDAIADGVDLLSLSLGASPYFRPDF  302



>ref|XP_004956009.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDFS  142
            +AMYRVC   GC GSAIL GFDD + DGVDVLS+SLG     +PDF+
Sbjct  258  VAMYRVCSEEGCSGSAILAGFDDAVADGVDVLSVSLGASPYFRPDFT  304



>ref|XP_009614807.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=768

 Score = 45.4 bits (106),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    IAMYRVCENVGCQGSAILKGFDDGIKdgvdvlslslggfgglKPDF  139
            IAMYRVC   GC+GSAI+K FDD I DGVDVLSLSLG   GL+PDF
Sbjct  248  IAMYRVCTTFGCRGSAIMKAFDDAIADGVDVLSLSLGSSPGLEPDF  293



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520473380726