BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46428_g1_i1 len=139 path=[1:0-138]

Length=139
                                                                      Score     E

gb|ABG56413.1|  MDR-like ABC transporter                              74.3    1e-13   Catharanthus roseus [chatas]
ref|XP_006355579.1|  PREDICTED: ABC transporter B family member 9...  72.8    4e-13   
ref|XP_004233862.2|  PREDICTED: ABC transporter B family member 9...  72.8    4e-13   
gb|EYU28158.1|  hypothetical protein MIMGU_mgv1a000293mg              72.8    4e-13   
gb|KHN47358.1|  ABC transporter B family member 9                     69.3    7e-12   
emb|CDP19825.1|  unnamed protein product                              68.2    1e-11   
ref|XP_007159374.1|  hypothetical protein PHAVU_002G232900g           67.8    2e-11   
ref|XP_003593852.1|  ABC transporter B family member                  67.4    2e-11   
ref|XP_007159375.1|  hypothetical protein PHAVU_002G233000g           67.4    3e-11   
ref|XP_010559276.1|  PREDICTED: ABC transporter B family member 9     67.4    3e-11   
ref|XP_003541677.1|  PREDICTED: ABC transporter B family member 9...  67.0    3e-11   
emb|CBI30804.3|  unnamed protein product                              67.0    4e-11   
ref|XP_010688391.1|  PREDICTED: ABC transporter B family member 1...  66.6    5e-11   
emb|CAN77320.1|  hypothetical protein VITISV_009891                   66.6    5e-11   Vitis vinifera
emb|CBI30805.3|  unnamed protein product                              66.6    5e-11   
ref|XP_003620170.1|  ABC transporter B family member                  66.2    6e-11   
ref|XP_010655616.1|  PREDICTED: ABC transporter B family member 9...  66.2    7e-11   
ref|XP_010655615.1|  PREDICTED: ABC transporter B family member 9...  66.2    7e-11   
gb|AES76388.2|  ABC transporter B family-like protein                 65.9    8e-11   
ref|XP_010690905.1|  PREDICTED: ABC transporter B family member 1...  65.9    9e-11   
ref|XP_004485974.1|  PREDICTED: ABC transporter B family member 9...  65.9    1e-10   
gb|AES64094.2|  ABC transporter B family protein                      65.5    1e-10   
ref|XP_010655614.1|  PREDICTED: ABC transporter B family member 9...  65.5    1e-10   
ref|XP_002271185.1|  PREDICTED: ABC transporter B family member 9...  65.5    1e-10   Vitis vinifera
ref|XP_006449604.1|  hypothetical protein CICLE_v10014058mg           65.1    2e-10   
gb|KDO78013.1|  hypothetical protein CISIN_1g000789mg                 65.1    2e-10   
ref|XP_006467555.1|  PREDICTED: ABC transporter B family member 9...  64.7    2e-10   
ref|XP_003593843.1|  ABC transporter B family member                  64.7    2e-10   
ref|XP_009414924.1|  PREDICTED: ABC transporter B family member 1...  64.7    3e-10   
ref|XP_004485973.1|  PREDICTED: ABC transporter B family member 9...  64.3    3e-10   
ref|XP_003609885.1|  ABC transporter B family member                  64.3    3e-10   
gb|KEH32389.1|  ABC transporter B family protein                      64.3    3e-10   
ref|XP_003593853.1|  ABC transporter B family member                  64.3    3e-10   
gb|KEH32390.1|  ABC transporter B family protein                      64.3    3e-10   
gb|AES64104.2|  ABC transporter B family-like protein                 64.3    4e-10   
ref|XP_010095132.1|  ABC transporter B family member 9                63.9    4e-10   
gb|KDP21188.1|  hypothetical protein JCGZ_21659                       63.9    4e-10   
ref|XP_010682394.1|  PREDICTED: ABC transporter B family member 9...  62.8    4e-10   
ref|XP_004485972.1|  PREDICTED: ABC transporter B family member 9...  63.5    5e-10   
ref|XP_002519759.1|  multidrug resistance protein 1, 2, putative      63.5    6e-10   Ricinus communis
ref|XP_008439691.1|  PREDICTED: ABC transporter B family member 9     63.2    7e-10   
gb|KFK22284.1|  hypothetical protein AALP_AAs69729U000100             62.8    8e-10   
ref|XP_010667802.1|  PREDICTED: ABC transporter B family member 9     63.2    9e-10   
ref|XP_002519757.1|  multidrug resistance protein 1, 2, putative      63.2    9e-10   Ricinus communis
ref|XP_004134559.1|  PREDICTED: ABC transporter B family member 9...  63.2    9e-10   
gb|KFK22285.1|  hypothetical protein AALP_AAs69729U000100             62.8    9e-10   
ref|XP_004508080.1|  PREDICTED: ABC transporter B family member 2...  62.8    1e-09   
ref|XP_004155533.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  62.8    1e-09   
ref|XP_004508079.1|  PREDICTED: ABC transporter B family member 2...  62.8    1e-09   
ref|XP_003609881.1|  ABC transporter B family member                  62.4    1e-09   
ref|XP_006597505.1|  PREDICTED: ABC transporter B family member 9...  62.4    1e-09   
ref|XP_003547192.1|  PREDICTED: ABC transporter B family member 9...  62.4    1e-09   
ref|XP_009136898.1|  PREDICTED: ABC transporter B family member 9     62.4    2e-09   
ref|XP_006597506.1|  PREDICTED: ABC transporter B family member 9...  62.4    2e-09   
ref|XP_006414157.1|  hypothetical protein EUTSA_v10024238mg           62.4    2e-09   
gb|KHN06940.1|  ABC transporter B family member 9                     62.0    2e-09   
ref|XP_003609882.1|  ABC transporter B family member                  62.0    2e-09   
ref|XP_002271305.1|  PREDICTED: ABC transporter B family member 9...  62.0    2e-09   Vitis vinifera
gb|AES64092.2|  ABC transporter B family-like protein                 62.0    2e-09   
gb|KHN14170.1|  ABC transporter B family member 11                    62.0    2e-09   
ref|XP_003593841.1|  ABC transporter B family member                  61.6    3e-09   
ref|XP_006847022.1|  hypothetical protein AMTR_s00017p00164980        61.6    3e-09   
ref|XP_004508078.1|  PREDICTED: ABC transporter B family member 2...  61.6    3e-09   
gb|EYU35917.1|  hypothetical protein MIMGU_mgv1a026620mg              61.6    3e-09   
ref|XP_003520772.2|  PREDICTED: ABC transporter B family member 4...  61.6    3e-09   
gb|AES92079.2|  ABC transporter B family protein                      61.2    3e-09   
ref|XP_004495861.1|  PREDICTED: ABC transporter B family member 2...  61.2    3e-09   
ref|XP_006597507.1|  PREDICTED: ABC transporter B family member 9...  61.2    3e-09   
ref|XP_006577180.1|  PREDICTED: ABC transporter B family member 4...  61.2    3e-09   
ref|XP_006577182.1|  PREDICTED: ABC transporter B family member 4...  61.2    3e-09   
ref|XP_007163242.1|  hypothetical protein PHAVU_001G218000g           61.2    4e-09   
gb|KHF98198.1|  ABC transporter B family member 9                     61.2    4e-09   
ref|XP_006577181.1|  PREDICTED: ABC transporter B family member 4...  61.2    4e-09   
gb|KEH32387.1|  ABC transporter B family protein                      60.8    4e-09   
gb|KCW88641.1|  hypothetical protein EUGRSUZ_A01006                   60.8    5e-09   
ref|XP_002988703.1|  hypothetical protein SELMODRAFT_184079           60.8    5e-09   
ref|XP_002986365.1|  ATP-binding cassette transporter                 60.8    6e-09   
emb|CAB78807.1|  multidrug resistance protein/P-glycoprotein-like     60.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002515187.1|  multidrug resistance protein 1, 2, putative      60.1    8e-09   Ricinus communis
gb|KDP28338.1|  hypothetical protein JCGZ_14109                       60.1    9e-09   
ref|XP_010045629.1|  PREDICTED: ABC transporter B family member 1...  60.1    9e-09   
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...  60.1    1e-08   
ref|NP_193539.6|  P-glycoprotein 9                                    60.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485975.1|  PREDICTED: ABC transporter B family member 9...  59.7    1e-08   
ref|XP_010052120.1|  PREDICTED: ABC transporter B family member 9...  59.7    1e-08   
ref|XP_004297068.1|  PREDICTED: ABC transporter B family member 4...  59.7    1e-08   
ref|XP_010054273.1|  PREDICTED: ABC transporter B family member 9...  59.7    1e-08   
gb|KCW75984.1|  hypothetical protein EUGRSUZ_D00349                   59.3    1e-08   
ref|XP_006356120.1|  PREDICTED: ABC transporter B family member 1...  59.3    2e-08   
ref|XP_006386686.1|  hypothetical protein POPTR_0002s18860g           59.3    2e-08   
emb|CAB53646.1|  multidrug resistance protein/P-glycoprotein-like     59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301547.1|  multidrug resistant ABC transporter family p...  59.3    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009604261.1|  PREDICTED: ABC transporter B family member 9...  59.3    2e-08   
gb|KHN45005.1|  ABC transporter B family member 11                    59.3    2e-08   
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...  59.3    2e-08   
gb|ABG56414.1|  MDR-like ABC transporter                              58.9    2e-08   
ref|XP_009360960.1|  PREDICTED: ABC transporter B family member 9...  58.9    2e-08   
ref|XP_007025208.1|  P-glycoprotein 9 isoform 1                       58.9    2e-08   
ref|XP_010439908.1|  PREDICTED: ABC transporter B family member 9     58.9    2e-08   
gb|KDO86794.1|  hypothetical protein CISIN_1g000777mg                 58.9    2e-08   
gb|KDO86792.1|  hypothetical protein CISIN_1g000777mg                 58.9    2e-08   
gb|KDO86791.1|  hypothetical protein CISIN_1g000777mg                 58.9    2e-08   
ref|XP_006492413.1|  PREDICTED: ABC transporter B family member 4...  58.9    3e-08   
gb|KDO86793.1|  hypothetical protein CISIN_1g000777mg                 58.9    3e-08   
emb|CDY25095.1|  BnaC06g18370D                                        58.9    3e-08   
ref|XP_010434583.1|  PREDICTED: ABC transporter B family member 9...  58.5    3e-08   
ref|XP_002960296.1|  ATP-binding cassette transporter                 58.5    3e-08   
ref|XP_008383571.1|  PREDICTED: ABC transporter B family member 9...  58.5    3e-08   
ref|XP_011040312.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  58.5    3e-08   
ref|XP_002515185.1|  multidrug resistance protein 1, 2, putative      58.5    3e-08   Ricinus communis
gb|AIU41629.1|  ABC transporter family protein                        58.5    4e-08   
ref|XP_006283011.1|  hypothetical protein CARUB_v10004001mg           58.2    4e-08   
ref|XP_002515186.1|  multidrug resistance protein 1, 2, putative      58.2    4e-08   Ricinus communis
ref|XP_004152829.1|  PREDICTED: ABC transporter B family member 4...  58.2    4e-08   
ref|XP_011005823.1|  PREDICTED: ABC transporter B family member 9     58.2    4e-08   
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g           58.2    4e-08   
ref|XP_004234243.1|  PREDICTED: ABC transporter B family member 9...  58.2    4e-08   
ref|XP_011040271.1|  PREDICTED: ABC transporter B family member 1...  58.2    4e-08   
ref|XP_002870073.1|  P-glycoprotein 9                                 58.2    4e-08   
ref|XP_010449508.1|  PREDICTED: ABC transporter B family member 9...  58.2    5e-08   
ref|XP_002967417.1|  hypothetical protein SELMODRAFT_87743            58.2    5e-08   
emb|CDX67881.1|  BnaA07g19210D                                        57.8    5e-08   
gb|KDP28019.1|  hypothetical protein JCGZ_19099                       57.8    5e-08   
ref|XP_010544933.1|  PREDICTED: ABC transporter B family member 2...  57.8    6e-08   
ref|XP_006369863.1|  ABC transporter family protein                   57.8    6e-08   
ref|XP_006444609.1|  hypothetical protein CICLE_v10018532mg           57.8    6e-08   
emb|CAN81149.1|  hypothetical protein VITISV_020815                   57.8    7e-08   Vitis vinifera
ref|XP_006840349.1|  hypothetical protein AMTR_s00045p00108620        57.4    7e-08   
gb|KGN61258.1|  hypothetical protein Csa_2G074200                     57.4    7e-08   
ref|XP_003567027.1|  PREDICTED: ABC transporter B family member 4...  57.4    7e-08   
ref|XP_007214562.1|  hypothetical protein PRUPE_ppa000338mg           57.4    7e-08   
ref|XP_007225454.1|  hypothetical protein PRUPE_ppa000316mg           57.4    8e-08   
ref|XP_010666555.1|  PREDICTED: ABC transporter B family member 1...  57.4    8e-08   
ref|XP_008225385.1|  PREDICTED: ABC transporter B family member 9     57.4    8e-08   
gb|KGN61257.1|  hypothetical protein Csa_2G074190                     57.4    8e-08   
ref|XP_010916125.1|  PREDICTED: ABC transporter B family member 9...  57.4    8e-08   
ref|XP_004155099.1|  PREDICTED: ABC transporter B family member 4...  57.4    9e-08   
ref|XP_004303546.1|  PREDICTED: ABC transporter B family member 9...  57.4    9e-08   
ref|XP_009104372.1|  PREDICTED: ABC transporter B family member 21    57.0    1e-07   
gb|KFK23687.1|  hypothetical protein AALP_AAs50902U000500             57.0    1e-07   
ref|XP_009385387.1|  PREDICTED: ABC transporter B family member 4...  57.0    1e-07   
ref|XP_011090143.1|  PREDICTED: ABC transporter B family member 4...  56.6    1e-07   
ref|XP_002320938.2|  hypothetical protein POPTR_0014s10860g           57.0    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010054272.1|  PREDICTED: ABC transporter B family member 9...  56.6    1e-07   
ref|XP_003607429.1|  ABC transporter B family member                  56.6    1e-07   
ref|XP_002273987.1|  PREDICTED: ABC transporter B family member 11    56.6    1e-07   Vitis vinifera
gb|KCW75983.1|  hypothetical protein EUGRSUZ_D00348                   56.6    1e-07   
ref|XP_009353526.1|  PREDICTED: ABC transporter B family member 9...  56.6    1e-07   
gb|KEH30666.1|  ABC transporter B family protein                      56.6    2e-07   
gb|KEH30667.1|  ABC transporter B family protein                      56.6    2e-07   
ref|XP_004155127.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  56.6    2e-07   
ref|XP_009385385.1|  PREDICTED: ABC transporter B family member 4...  56.6    2e-07   
ref|XP_009360959.1|  PREDICTED: ABC transporter B family member 9...  56.6    2e-07   
ref|XP_009385386.1|  PREDICTED: ABC transporter B family member 4...  56.2    2e-07   
ref|XP_004152879.1|  PREDICTED: ABC transporter B family member 4...  56.2    2e-07   
emb|CBI37062.3|  unnamed protein product                              56.2    2e-07   
ref|XP_004308506.1|  PREDICTED: ABC transporter B family member 9...  56.2    2e-07   
ref|NP_191774.2|  ABC transporter B family member 21                  56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644533.1|  PREDICTED: ABC transporter B family member 4...  56.2    2e-07   
emb|CAB71875.1|  P-glycoprotein-like proetin                          56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011096468.1|  PREDICTED: ABC transporter B family member 9     56.2    2e-07   
gb|KFK35399.1|  hypothetical protein AALP_AA5G280000                  56.2    2e-07   
ref|XP_008223526.1|  PREDICTED: ABC transporter B family member 4...  55.8    2e-07   
ref|XP_007051282.1|  ATP binding cassette subfamily B4 isoform 2      55.8    2e-07   
ref|XP_007051281.1|  ATP binding cassette subfamily B4 isoform 1      55.8    2e-07   
gb|KDP28337.1|  hypothetical protein JCGZ_14108                       55.8    3e-07   
emb|CBI26020.3|  unnamed protein product                              55.8    3e-07   
ref|XP_006402405.1|  hypothetical protein EUTSA_v10005750mg           55.8    3e-07   
ref|XP_008349179.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  55.8    3e-07   
ref|XP_007154481.1|  hypothetical protein PHAVU_003G122500g           55.8    3e-07   
emb|CDX89963.1|  BnaA10g01190D                                        55.8    3e-07   
ref|XP_009119625.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  55.8    3e-07   
ref|XP_008227785.1|  PREDICTED: ABC transporter B family member 1...  55.8    3e-07   
ref|XP_008223527.1|  PREDICTED: ABC transporter B family member 4...  55.5    3e-07   
ref|XP_002876661.1|  P-glycoprotein 21                                55.5    3e-07   
ref|XP_007221461.1|  hypothetical protein PRUPE_ppa000313mg           55.5    3e-07   
ref|XP_008776904.1|  PREDICTED: ABC transporter B family member 9...  55.5    4e-07   
ref|NP_171753.1|  P-glycoprotein 11                                   55.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008776906.1|  PREDICTED: ABC transporter B family member 9...  55.5    4e-07   
gb|KHG29119.1|  ABC transporter B family member 21                    55.5    4e-07   
ref|XP_010428797.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  55.5    4e-07   
emb|CDY15249.1|  BnaC05g01280D                                        55.5    4e-07   
ref|XP_008776907.1|  PREDICTED: ABC transporter B family member 9...  55.5    4e-07   
ref|XP_011005962.1|  PREDICTED: ABC transporter B family member 1...  55.5    4e-07   
ref|XP_008776905.1|  PREDICTED: ABC transporter B family member 9...  55.5    4e-07   
ref|XP_008776908.1|  PREDICTED: ABC transporter B family member 9...  55.5    4e-07   
ref|XP_010316891.1|  PREDICTED: ABC transporter B family member 9...  55.1    4e-07   
ref|XP_008383572.1|  PREDICTED: ABC transporter B family member 9...  55.1    4e-07   
ref|XP_002301550.2|  hypothetical protein POPTR_0002s18850g           55.1    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004233863.1|  PREDICTED: ABC transporter B family member 9...  55.1    5e-07   
gb|EMT10003.1|  ABC transporter B family member 11                    54.7    5e-07   
gb|KDP28336.1|  hypothetical protein JCGZ_14107                       54.7    6e-07   
ref|XP_008223623.1|  PREDICTED: ABC transporter B family member 1...  54.7    6e-07   
ref|XP_002275143.2|  PREDICTED: ABC transporter B family member 1...  54.7    6e-07   Vitis vinifera
ref|XP_008441862.1|  PREDICTED: ABC transporter B family member 4...  54.7    6e-07   
ref|NP_171754.1|  P-glycoprotein 12                                   54.7    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007224072.1|  hypothetical protein PRUPE_ppa015389mg           54.7    7e-07   
ref|XP_002320939.2|  hypothetical protein POPTR_0014s10870g           54.3    8e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002977745.1|  ATP-binding cassette transporter                 54.3    9e-07   
gb|KHN45006.1|  ABC transporter B family member 11                    54.3    9e-07   
ref|XP_006594001.1|  PREDICTED: ABC transporter B family member 2...  54.3    9e-07   
ref|XP_011080373.1|  PREDICTED: ABC transporter B family member 4...  54.3    9e-07   
gb|AAG10627.1|AC022521_5  Putative ABC transporter                    54.3    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004298257.1|  PREDICTED: ABC transporter B family member 1...  54.3    1e-06   
ref|XP_011080370.1|  PREDICTED: ABC transporter B family member 4...  54.3    1e-06   
ref|XP_006303137.1|  hypothetical protein CARUB_v10008098mg           54.3    1e-06   
ref|XP_002275169.3|  PREDICTED: ABC transporter B family member 1...  54.3    1e-06   Vitis vinifera
ref|XP_011040252.1|  PREDICTED: ABC transporter B family member 1...  53.9    1e-06   
ref|XP_002519336.1|  multidrug resistance protein 1, 2, putative      53.9    1e-06   Ricinus communis
emb|CDY48003.1|  BnaA04g26870D                                        53.9    1e-06   
ref|XP_009417764.1|  PREDICTED: ABC transporter B family member 4...  53.9    1e-06   
ref|XP_006414519.1|  hypothetical protein EUTSA_v10024241mg           53.9    1e-06   
ref|XP_008360230.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  53.9    1e-06   
emb|CDM83833.1|  unnamed protein product                              53.5    2e-06   
gb|EMT22893.1|  ABC transporter B family member 4                     53.5    2e-06   
ref|XP_002314333.2|  hypothetical protein POPTR_0010s00540g           53.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009417767.1|  PREDICTED: ABC transporter B family member 2...  53.5    2e-06   
ref|XP_010271028.1|  PREDICTED: ABC transporter B family member 2...  53.5    2e-06   
gb|EMS48422.1|  ABC transporter B family member 4                     53.5    2e-06   
ref|XP_002979534.1|  hypothetical protein SELMODRAFT_177681           53.5    2e-06   
ref|XP_009142463.1|  PREDICTED: ABC transporter B family member 4     53.5    2e-06   
ref|XP_009363069.1|  PREDICTED: ABC transporter B family member 11    53.5    2e-06   
gb|KFK30733.1|  hypothetical protein AALP_AA6G020200                  53.5    2e-06   
emb|CDX80072.1|  BnaA05g00840D                                        53.5    2e-06   
ref|XP_006397891.1|  hypothetical protein EUTSA_v10001285mg           53.5    2e-06   
ref|XP_008353913.1|  PREDICTED: ABC transporter B family member 1...  53.1    2e-06   
gb|KDO72233.1|  hypothetical protein CISIN_1g040099mg                 53.1    2e-06   
ref|XP_003567026.1|  PREDICTED: ABC transporter B family member 4...  53.1    2e-06   
emb|CDY27510.1|  BnaC04g51510D                                        53.1    2e-06   
ref|XP_009142574.1|  PREDICTED: ABC transporter B family member 4     53.1    2e-06   
ref|XP_010999324.1|  PREDICTED: ABC transporter B family member 4...  53.1    2e-06   
ref|XP_010232190.1|  PREDICTED: ABC transporter B family member 4...  53.1    2e-06   
ref|XP_009353437.1|  PREDICTED: ABC transporter B family member 1...  53.1    2e-06   
ref|XP_006418332.1|  hypothetical protein EUTSA_v10006577mg           53.1    3e-06   
ref|XP_010457237.1|  PREDICTED: ABC transporter B family member 1...  52.8    3e-06   
ref|XP_010457236.1|  PREDICTED: ABC transporter B family member 1...  52.8    3e-06   
ref|XP_007214672.1|  hypothetical protein PRUPE_ppa020815mg           52.8    3e-06   
ref|XP_007213163.1|  hypothetical protein PRUPE_ppa026713mg           52.8    3e-06   
gb|EMS56139.1|  ABC transporter B family member 4                     52.8    3e-06   
ref|XP_002882100.1|  P-glycoprotein 4, P-glycoprotein4                52.8    3e-06   
ref|NP_182223.1|  auxin efflux transmembrane transporter MDR4         52.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488718.1|  PREDICTED: ABC transporter B family member 1...  52.8    3e-06   
ref|XP_010424672.1|  PREDICTED: ABC transporter B family member 3     52.8    3e-06   
ref|XP_003569618.2|  PREDICTED: ABC transporter B family member 1...  52.8    3e-06   
gb|EMT32504.1|  ABC transporter B family member 4                     52.8    3e-06   
ref|XP_002458359.1|  hypothetical protein SORBIDRAFT_03g032000        52.8    3e-06   Sorghum bicolor [broomcorn]
dbj|BAB85651.1|  multidrug resistance protein 1 homolog               52.4    4e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AEY84034.1|  ABCB2                                                 48.9    4e-06   
ref|XP_010507941.1|  PREDICTED: ABC transporter B family member 4...  52.4    4e-06   
ref|XP_010518387.1|  PREDICTED: ABC transporter B family member 4     52.4    4e-06   
ref|XP_004295414.1|  PREDICTED: ABC transporter B family member 9...  52.4    4e-06   
ref|XP_008656775.1|  PREDICTED: ABC transporter B family member 1...  52.4    4e-06   
ref|XP_004297085.1|  PREDICTED: ABC transporter B family member 1...  52.4    4e-06   
ref|XP_009630707.1|  PREDICTED: ABC transporter B family member 4...  52.4    4e-06   
gb|EAZ13201.1|  hypothetical protein OsJ_03121                        52.4    4e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAD59587.1|  MDR-like ABC transporter                             52.4    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232186.1|  PREDICTED: ABC transporter B family member 4...  52.4    4e-06   
ref|XP_004304810.1|  PREDICTED: ABC transporter B family member 4...  52.4    5e-06   
gb|EEE55238.1|  hypothetical protein OsJ_03116                        52.4    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007224221.1|  hypothetical protein PRUPE_ppa017251mg           52.4    5e-06   
ref|XP_008343216.1|  PREDICTED: ABC transporter B family member 1...  52.4    5e-06   
ref|XP_010522857.1|  PREDICTED: ABC transporter B family member 1...  52.0    5e-06   
ref|XP_007145098.1|  hypothetical protein PHAVU_007G209700g           52.0    5e-06   
gb|AFW83646.1|  hypothetical protein ZEAMMB73_678152                  52.0    5e-06   
emb|CAA75922.1|  P-glycoprotein-like protein                          52.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002440179.1|  hypothetical protein SORBIDRAFT_09g027330        52.0    6e-06   Sorghum bicolor [broomcorn]
ref|XP_010497210.1|  PREDICTED: ABC transporter B family member 4...  51.2    6e-06   
ref|XP_006293571.1|  hypothetical protein CARUB_v10022518mg           52.0    6e-06   
ref|NP_192091.1|  ABC transporter B family member 3                   52.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|EMT20011.1|  ABC transporter B family member 4                     52.0    6e-06   
ref|XP_004240558.1|  PREDICTED: ABC transporter B family member 21    52.0    6e-06   
ref|XP_010035396.1|  PREDICTED: ABC transporter B family member 4...  52.0    6e-06   
gb|EYU46227.1|  hypothetical protein MIMGU_mgv1a000348mg              52.0    7e-06   
ref|XP_009593037.1|  PREDICTED: ABC transporter B family member 1...  52.0    7e-06   
gb|KFO18364.1|  Multidrug resistance protein 1                        52.0    7e-06   
ref|XP_009630706.1|  PREDICTED: ABC transporter B family member 4...  52.0    7e-06   
ref|XP_009630702.1|  PREDICTED: ABC transporter B family member 4...  51.6    7e-06   
ref|XP_009778876.1|  PREDICTED: ABC transporter B family member 2...  51.6    7e-06   
ref|XP_010035392.1|  PREDICTED: ABC transporter B family member 4...  51.6    7e-06   
ref|XP_009341519.1|  PREDICTED: ABC transporter B family member 11    51.6    7e-06   
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...  51.6    8e-06   
ref|XP_010523879.1|  PREDICTED: ABC transporter B family member 4...  51.6    9e-06   
ref|XP_009111196.1|  PREDICTED: ABC transporter B family member 11    51.6    9e-06   
ref|XP_006644563.1|  PREDICTED: ABC transporter B family member 4...  51.2    9e-06   
emb|CDY51307.1|  BnaCnng20520D                                        51.6    9e-06   
ref|XP_010481062.1|  PREDICTED: ABC transporter B family member 1...  51.2    9e-06   
ref|XP_010481058.1|  PREDICTED: ABC transporter B family member 1...  51.2    9e-06   
ref|XP_011096469.1|  PREDICTED: ABC transporter B family member 9...  51.2    9e-06   
ref|XP_004253157.2|  PREDICTED: ABC transporter B family member 1...  51.2    9e-06   
gb|KCW46763.1|  hypothetical protein EUGRSUZ_K00570                   51.2    9e-06   
ref|XP_007051287.1|  P-glycoprotein 21                                51.2    9e-06   
ref|XP_009630708.1|  PREDICTED: ABC transporter B family member 4...  51.2    1e-05   
gb|AAL74249.1|AF466305_1  ABC transporter AbcB2                       51.2    1e-05   
ref|XP_629136.1|  ABC transporter B family protein                    51.2    1e-05   
ref|XP_010474667.1|  PREDICTED: ABC transporter B family member 1...  51.2    1e-05   
ref|XP_010091424.1|  ABC transporter B family member 11               51.2    1e-05   
ref|XP_002456200.1|  hypothetical protein SORBIDRAFT_03g032030        51.2    1e-05   
gb|EMS45430.1|  ABC transporter B family member 11                    51.2    1e-05   
gb|EEC71330.1|  hypothetical protein OsI_03378                        51.2    1e-05   
ref|XP_003566056.1|  PREDICTED: ABC transporter B family member 5...  51.2    1e-05   
gb|EMT27767.1|  ABC transporter B family member 4                     51.2    1e-05   
ref|XP_004288326.1|  PREDICTED: ABC transporter B family member 4...  51.2    1e-05   
ref|XP_011082400.1|  PREDICTED: ABC transporter B family member 1...  50.8    1e-05   
ref|XP_010504005.1|  PREDICTED: ABC transporter B family member 1...  50.8    1e-05   
emb|CAD59586.1|  MDR-like ABC transporter                             50.8    1e-05   
gb|EAY75483.1|  hypothetical protein OsI_03383                        50.8    1e-05   
ref|XP_008244487.1|  PREDICTED: ABC transporter B family member 1...  50.8    1e-05   
ref|XP_002868205.1|  hypothetical protein ARALYDRAFT_355242           50.8    1e-05   
ref|XP_010231185.1|  PREDICTED: ABC transporter B family member 4...  50.8    1e-05   
ref|XP_004969646.1|  PREDICTED: ABC transporter B family member 4...  50.8    1e-05   
ref|XP_010457230.1|  PREDICTED: ABC transporter B family member 1...  50.8    2e-05   
gb|EMT28282.1|  ABC transporter B family member 11                    50.8    2e-05   
ref|XP_010457233.1|  PREDICTED: ABC transporter B family member 1...  50.8    2e-05   
ref|XP_010457234.1|  PREDICTED: ABC transporter B family member 1...  50.8    2e-05   
ref|XP_010231184.1|  PREDICTED: ABC transporter B family member 4...  50.8    2e-05   
ref|XP_008445963.1|  PREDICTED: ABC transporter B family member 4...  50.8    2e-05   
gb|EMS46445.1|  ABC transporter B family member 4                     50.4    2e-05   
ref|XP_010923337.1|  PREDICTED: ABC transporter B family member 1...  50.4    2e-05   
dbj|BAD87673.1|  putative multidrug resistance protein 1              50.4    2e-05   
emb|CAD59593.1|  MDR-like ABC transporter                             50.4    2e-05   
ref|XP_002455740.1|  hypothetical protein SORBIDRAFT_03g023740        50.4    2e-05   
gb|EPS73821.1|  hypothetical protein M569_00935                       50.1    2e-05   
ref|XP_009801769.1|  PREDICTED: ABC transporter B family member 4...  50.4    2e-05   
gb|EAY74405.1|  hypothetical protein OsI_02294                        50.4    2e-05   
emb|CDM83826.1|  unnamed protein product                              50.4    2e-05   
ref|XP_010232183.1|  PREDICTED: ABC transporter B family member 9...  50.4    2e-05   
ref|XP_006355822.1|  PREDICTED: ABC transporter B family member 2...  50.4    2e-05   
ref|XP_010936203.1|  PREDICTED: ABC transporter B family member 1...  50.4    2e-05   
ref|NP_001172926.1|  Os02g0323000                                     49.7    2e-05   
ref|XP_010474666.1|  PREDICTED: ABC transporter B family member 1...  50.1    2e-05   
ref|XP_009772017.1|  PREDICTED: ABC transporter B family member 9...  50.1    2e-05   
gb|EMS62269.1|  ABC transporter B family member 4                     50.1    2e-05   
gb|EEE54740.1|  hypothetical protein OsJ_02095                        50.1    2e-05   
ref|XP_002531485.1|  multidrug resistance protein 1, 2, putative      50.1    3e-05   
ref|XP_010321859.1|  PREDICTED: ABC transporter B family member 2...  50.1    3e-05   
ref|XP_009610882.1|  PREDICTED: ABC transporter B family member 9     50.1    3e-05   
ref|XP_006396373.1|  hypothetical protein EUTSA_v10029280mg           49.7    3e-05   
ref|XP_008675533.1|  PREDICTED: ABC transporter B family member 1...  50.1    3e-05   
ref|XP_008675535.1|  PREDICTED: ABC transporter B family member 1...  50.1    3e-05   
ref|XP_008790310.1|  PREDICTED: ABC transporter B family member 9...  50.1    3e-05   
ref|XP_008367112.1|  PREDICTED: ABC transporter B family member 1...  49.7    3e-05   
ref|XP_005405569.1|  PREDICTED: multidrug resistance protein 1-like   50.1    3e-05   
ref|XP_004253158.1|  PREDICTED: ABC transporter B family member 1...  50.1    3e-05   
gb|KCW46762.1|  hypothetical protein EUGRSUZ_K00570                   50.1    3e-05   
gb|EFA76461.1|  hypothetical protein PPL_10227                        49.7    3e-05   
ref|XP_004630015.1|  PREDICTED: multidrug resistance protein 1-like   50.1    3e-05   
gb|EFA76459.1|  ABC transporter B family protein                      50.1    3e-05   
emb|CDP17032.1|  unnamed protein product                              49.7    3e-05   
gb|EMS63365.1|  ABC transporter B family member 4                     49.7    3e-05   
ref|XP_008675534.1|  PREDICTED: ABC transporter B family member 1...  49.7    3e-05   
ref|XP_006645970.1|  PREDICTED: ABC transporter B family member 2...  49.7    3e-05   
gb|EYU38439.1|  hypothetical protein MIMGU_mgv1a020314mg              49.7    4e-05   
gb|EYU38437.1|  hypothetical protein MIMGU_mgv1a000327mg              49.7    4e-05   
ref|XP_010232184.1|  PREDICTED: ABC transporter B family member 4...  49.3    4e-05   
ref|XP_010234563.1|  PREDICTED: ABC transporter B family member 4...  49.3    4e-05   
emb|CDM85068.1|  unnamed protein product                              49.7    4e-05   
emb|CDM83831.1|  unnamed protein product                              49.3    4e-05   
ref|XP_010234562.1|  PREDICTED: ABC transporter B family member 4...  49.3    4e-05   
ref|XP_004851267.1|  PREDICTED: multidrug resistance protein 1-like   49.3    5e-05   
ref|XP_004899124.1|  PREDICTED: multidrug resistance protein 1-like   49.3    5e-05   
ref|XP_010231069.1|  PREDICTED: ABC transporter B family member 5...  49.3    5e-05   
ref|XP_006355823.1|  PREDICTED: ABC transporter B family member 2...  49.3    5e-05   
gb|EHB12084.1|  Multidrug resistance protein 1                        49.3    5e-05   
ref|XP_004963620.1|  PREDICTED: ABC transporter B family member 4...  49.3    5e-05   
ref|XP_006349962.1|  PREDICTED: ABC transporter B family member 2...  49.3    5e-05   
ref|XP_010481013.1|  PREDICTED: ABC transporter B family member 1...  49.3    5e-05   
ref|NP_001043254.1|  Os01g0533900                                     48.9    6e-05   
dbj|BAM33973.1|  ATP-binding cassette protein                         48.9    6e-05   
ref|XP_010481046.1|  PREDICTED: ABC transporter B family member 1...  48.9    6e-05   
emb|CDP05479.1|  unnamed protein product                              48.9    6e-05   
emb|CDP19223.1|  unnamed protein product                              47.4    6e-05   
gb|KHG03822.1|  ABC transporter B family member 21                    48.9    6e-05   
gb|EYU28159.1|  hypothetical protein MIMGU_mgv11b000380mg             48.9    7e-05   
gb|EEE64579.1|  hypothetical protein OsJ_19431                        48.9    7e-05   
dbj|GAM29257.1|  hypothetical protein SAMD00019534_124340             48.9    7e-05   
gb|EYU28160.1|  hypothetical protein MIMGU_mgv1a000337mg              48.9    7e-05   
emb|CDY24379.1|  BnaA07g03040D                                        48.9    7e-05   
ref|XP_010234560.1|  PREDICTED: ABC transporter B family member 4...  48.9    7e-05   
ref|XP_002440178.1|  hypothetical protein SORBIDRAFT_09g027320        48.9    7e-05   
gb|EEE56861.1|  hypothetical protein OsJ_06485                        48.9    7e-05   
ref|XP_010234561.1|  PREDICTED: ABC transporter B family member 4...  48.5    7e-05   
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg              48.9    7e-05   
gb|KHG11900.1|  ABC transporter B family member 21                    48.5    8e-05   
ref|XP_008656000.1|  PREDICTED: ABC transporter B family member 1...  48.5    8e-05   
ref|NP_001056226.1|  Os05g0548300                                     48.5    8e-05   
gb|EEC73043.1|  hypothetical protein OsI_06988                        48.5    8e-05   
emb|CDP16081.1|  unnamed protein product                              47.4    9e-05   
dbj|BAD15946.1|  putative MDR-like ABC transporter                    48.5    9e-05   
ref|XP_004968884.1|  PREDICTED: ABC transporter B family member 4...  48.5    9e-05   
ref|XP_004166183.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  48.5    1e-04   
ref|XP_004135527.1|  PREDICTED: ABC transporter B family member 4...  48.5    1e-04   
gb|EYU27077.1|  hypothetical protein MIMGU_mgv1a025774mg              48.5    1e-04   
gb|EPS73347.1|  hypothetical protein M569_01408                       48.5    1e-04   
emb|CDY20842.1|  BnaC07g06910D                                        48.1    1e-04   
ref|XP_009121075.1|  PREDICTED: ABC transporter B family member 5...  48.1    1e-04   
ref|XP_010233138.1|  PREDICTED: ABC transporter B family member 5...  48.1    1e-04   
ref|XP_003285409.1|  ABC transporter B family protein                 48.1    1e-04   
ref|XP_008790456.1|  PREDICTED: ABC transporter B family member 1...  48.1    1e-04   
ref|XP_010231182.1|  PREDICTED: ABC transporter B family member 1...  48.1    1e-04   
gb|EMS51757.1|  ABC transporter B family member 11                    47.8    1e-04   
ref|XP_008656002.1|  PREDICTED: ABC transporter B family member 1...  47.8    1e-04   
ref|XP_008676311.1|  PREDICTED: ABC transporter B family member 4...  47.8    1e-04   
ref|XP_010231183.1|  PREDICTED: ABC transporter B family member 1...  47.8    1e-04   
gb|KDO78014.1|  hypothetical protein CISIN_1g047286mg                 47.8    1e-04   
ref|XP_008656001.1|  PREDICTED: ABC transporter B family member 1...  47.8    1e-04   
ref|XP_010614446.1|  PREDICTED: multidrug resistance protein 1-like   47.8    1e-04   
dbj|BAD87676.1|  putative CjMDR1                                      47.8    2e-04   
ref|XP_006675147.1|  hypothetical protein BATDEDRAFT_15754            47.8    2e-04   
gb|EEC79641.1|  hypothetical protein OsI_20863                        47.8    2e-04   
ref|NP_001172394.1|  Os01g0534700                                     47.4    2e-04   
gb|EKC35579.1|  Multidrug resistance protein 1                        47.4    2e-04   
ref|XP_010234151.1|  PREDICTED: ABC transporter B family member 1...  47.4    2e-04   
gb|EYU46879.1|  hypothetical protein MIMGU_mgv1a000296mg              47.4    2e-04   
emb|CDP20011.1|  unnamed protein product                              47.4    2e-04   
emb|CDY58790.1|  BnaA07g38050D                                        47.0    2e-04   
ref|XP_010231181.1|  PREDICTED: ABC transporter B family member 1...  47.0    3e-04   
gb|ABW04992.1|  mutant ATP-binding cassette sub-family B member 4     43.9    3e-04   
ref|XP_009104300.1|  PREDICTED: ABC transporter B family member 5...  47.0    3e-04   
gb|ABH04441.1|  truncated ATP-binding cassette sub-family B member 4  43.9    3e-04   
gb|EPZ35336.1|  ABC transporter domain-containing protein             47.0    3e-04   
ref|XP_004008268.1|  PREDICTED: multidrug resistance protein 3        46.6    3e-04   
emb|CDM63412.1|  multidrug resistance protein 1                       46.6    3e-04   
emb|CDP05477.1|  unnamed protein product                              46.6    3e-04   
ref|XP_004633894.1|  PREDICTED: multidrug resistance protein 3        47.0    3e-04   
ref|XP_006655547.1|  PREDICTED: ABC transporter B family member 2...  46.6    3e-04   
ref|XP_006648585.1|  PREDICTED: ABC transporter B family member 1...  46.6    4e-04   
ref|XP_009811835.1|  PREDICTED: multidrug resistance protein 3-like   46.2    4e-04   
ref|XP_006349874.1|  PREDICTED: ABC transporter B family member 1...  46.6    4e-04   
ref|XP_004330570.1|  PREDICTED: multidrug resistance protein 3-like   46.2    4e-04   
ref|XP_010035399.1|  PREDICTED: ABC transporter B family member 2...  46.6    4e-04   
emb|CDM63419.1|  multidrug resistance protein 1                       46.2    4e-04   
gb|AAW56716.1|  multi-drug resistance protein 1                       46.2    4e-04   
gb|EEE54742.1|  hypothetical protein OsJ_02099                        46.6    4e-04   
ref|XP_009876034.1|  PREDICTED: multidrug resistance protein 1-like   46.2    5e-04   
ref|XP_005679267.1|  PREDICTED: LOW QUALITY PROTEIN: multidrug re...  46.6    5e-04   
ref|XP_010035397.1|  PREDICTED: ABC transporter B family member 2...  46.2    5e-04   
emb|CAD59588.1|  MDR-like ABC transporter                             46.2    5e-04   
ref|XP_007115686.1|  PREDICTED: multidrug resistance protein 3        46.2    5e-04   
ref|XP_010710902.1|  PREDICTED: multidrug resistance protein 1        46.2    5e-04   
emb|CDM63413.1|  multidrug resistance protein 1                       45.8    5e-04   
gb|AAD23956.1|AF099732_1  multidrug resistance transporter homolog    46.2    5e-04   
ref|XP_009918408.1|  PREDICTED: multidrug resistance protein 3-like   45.8    5e-04   
ref|XP_010129296.1|  PREDICTED: multidrug resistance protein 1-like   45.8    5e-04   
ref|XP_005901069.1|  PREDICTED: multidrug resistance protein 3        46.2    5e-04   
emb|CDM63421.1|  multidrug resistance protein 1                       46.2    5e-04   
ref|XP_003771962.1|  PREDICTED: multidrug resistance protein 3-like   46.2    6e-04   
gb|EFA83580.1|  hypothetical protein PPL_02646                        46.2    6e-04   
ref|XP_009474940.1|  PREDICTED: multidrug resistance protein 1-like   45.8    6e-04   
ref|XP_005985921.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...  46.2    6e-04   
ref|XP_010098744.1|  ABC transporter B family member 11               46.2    6e-04   
emb|CDM63411.1|  multidrug resistance protein 1                       46.2    6e-04   
ref|NP_990225.1|  multidrug resistance protein 1                      46.2    6e-04   
gb|EYU27079.1|  hypothetical protein MIMGU_mgv1a020574mg              46.2    6e-04   
emb|CDY51560.1|  BnaCnng20890D                                        45.8    6e-04   
ref|XP_010825552.1|  PREDICTED: multidrug resistance protein 3 is...  45.8    6e-04   
ref|XP_009986121.1|  PREDICTED: multidrug resistance protein 1-like   45.8    7e-04   
gb|KFQ04990.1|  Multidrug resistance protein 3                        45.4    7e-04   
gb|EOB02510.1|  Multidrug resistance protein 1                        45.8    8e-04   
ref|XP_005040817.1|  PREDICTED: multidrug resistance protein 3        45.8    8e-04   
gb|EMT02744.1|  ABC transporter B family member 11                    45.8    8e-04   
ref|XP_010171785.1|  PREDICTED: multidrug resistance protein 3-like   45.4    8e-04   
ref|XP_004972115.1|  PREDICTED: ABC transporter B family member 1...  45.8    8e-04   
ref|XP_010397518.1|  PREDICTED: multidrug resistance protein 1        45.8    8e-04   
ref|XP_007505004.1|  PREDICTED: multidrug resistance protein 1-li...  45.8    8e-04   
ref|XP_004952373.1|  PREDICTED: ABC transporter B family member 1...  45.8    8e-04   
gb|KFQ92704.1|  Multidrug resistance protein 3                        45.4    8e-04   
ref|XP_008628111.1|  PREDICTED: multidrug resistance protein 1-like   45.8    8e-04   
emb|CDP05476.1|  unnamed protein product                              45.4    9e-04   
emb|CAD59585.1|  MDR-like ABC transporter                             45.4    0.001   
ref|NP_001043962.1|  Os01g0695700                                     45.4    0.001   
ref|XP_006840351.1|  hypothetical protein AMTR_s00045p00109940        45.4    0.001   
ref|XP_002872874.1|  P-glycoprotein 5                                 45.4    0.001   
emb|CDM63423.1|  multidrug resistance protein 1                       45.4    0.001   
ref|XP_009936225.1|  PREDICTED: multidrug resistance protein 1-like   45.4    0.001   



>gb|ABG56413.1| MDR-like ABC transporter [Catharanthus roseus]
Length=1266

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            L+VQNIATV AG++I+FTANWILA IILAV+PL+GLQGF+QM+ Y
Sbjct  823  LVVQNIATVAAGLVISFTANWILALIILAVLPLVGLQGFLQMKFY  867



>ref|XP_006355579.1| PREDICTED: ABC transporter B family member 9-like [Solanum tuberosum]
Length=1262

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            LIVQNIATVVAG++IAFTANWILA IIL V+PL+G+QGF+Q ++Y
Sbjct  819  LIVQNIATVVAGLVIAFTANWILALIILLVMPLIGVQGFLQTKMY  863



>ref|XP_004233862.2| PREDICTED: ABC transporter B family member 9-like [Solanum lycopersicum]
Length=1263

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            LIVQNIATVVAG++IAFTANWILA IIL V+PL+G+QGF+Q ++Y
Sbjct  820  LIVQNIATVVAGLVIAFTANWILALIILLVMPLIGVQGFLQTKMY  864



>gb|EYU28158.1| hypothetical protein MIMGU_mgv1a000293mg [Erythranthe guttata]
Length=1290

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            L+VQNI+TV+AG++IAFTANW+LA I+  V+P +GLQGFMQMR Y
Sbjct  847  LVVQNISTVIAGLVIAFTANWLLALIVFLVLPFIGLQGFMQMRFY  891



>gb|KHN47358.1| ABC transporter B family member 9 [Glycine soja]
Length=1648

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAFTANWILAF+ILAV PLL +QG++Q + 
Sbjct  791  LIVQNIATVSAGLVIAFTANWILAFVILAVSPLLLIQGYLQTKF  834



>emb|CDP19825.1| unnamed protein product [Coffea canephora]
Length=1265

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            L+VQN++TVV G++I+FTANWILAFI++AV+P +GLQGF+Q + +
Sbjct  822  LVVQNLSTVVTGLVISFTANWILAFIVVAVLPFIGLQGFLQAKFH  866



>ref|XP_007159374.1| hypothetical protein PHAVU_002G232900g [Phaseolus vulgaris]
 gb|ESW31368.1| hypothetical protein PHAVU_002G232900g [Phaseolus vulgaris]
Length=1249

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT+ AG++IAFTANWILAF+ILAV PLL LQG++Q + 
Sbjct  806  LIVQNIATITAGLVIAFTANWILAFVILAVSPLLLLQGYLQTKF  849



>ref|XP_003593852.1| ABC transporter B family member [Medicago truncatula]
Length=814

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAF+ANWIL+FIILAV PL+ +QG++Q + 
Sbjct  371  LIVQNIATVAAGLVIAFSANWILSFIILAVSPLMLIQGYIQTKF  414



>ref|XP_007159375.1| hypothetical protein PHAVU_002G233000g [Phaseolus vulgaris]
 gb|ESW31369.1| hypothetical protein PHAVU_002G233000g [Phaseolus vulgaris]
Length=1197

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQN++T+++G++I+FTANWILAFIILAV PL+ +QGF+QM+ 
Sbjct  808  LIVQNLSTIISGLVISFTANWILAFIILAVSPLVLIQGFLQMKF  851



>ref|XP_010559276.1| PREDICTED: ABC transporter B family member 9 [Tarenaya hassleriana]
Length=1267

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQN+AT++AG+ IAFTANWILAF +LAV PL+ LQG+ QM+ 
Sbjct  824  LIVQNVATIIAGLFIAFTANWILAFTVLAVSPLMILQGYFQMKF  867



>ref|XP_003541677.1| PREDICTED: ABC transporter B family member 9-like [Glycine max]
Length=1261

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAFTANWILAF+ILAV PLL +QG++Q + 
Sbjct  820  LIVQNIATVSAGLVIAFTANWILAFVILAVSPLLLIQGYLQTKF  863



>emb|CBI30804.3| unnamed protein product [Vitis vinifera]
Length=1930

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
             L++QNI+TVVAG+ I+FTANW LA +ILAV+PL+GLQG++QM+
Sbjct  1754  LVIQNISTVVAGLAISFTANWSLALVILAVLPLVGLQGYLQMK  1796


 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQN+ TV+AG++I+FTANWILA IILAV+PL+ LQG+ QM+
Sbjct  733  LVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQMK  775



>ref|XP_010688391.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010688392.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=1272

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++IAF ANWILAFI+LA++PL+GL G++QM+ 
Sbjct  828  LLVQNIATAIAGLLIAFLANWILAFIVLALIPLIGLNGYIQMKF  871



>emb|CAN77320.1| hypothetical protein VITISV_009891 [Vitis vinifera]
Length=2006

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             L++QNI+TVVAG+ I+FTANW LA +ILAV+PL+GLQG++QM+ 
Sbjct  1862  LVIQNISTVVAGLAISFTANWSLALVILAVLPLVGLQGYLQMKF  1905


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+ TV+AG++I+FTANWILA IILAV+PL+ LQG+ QM+ 
Sbjct  819  LVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQMKF  862



>emb|CBI30805.3| unnamed protein product [Vitis vinifera]
Length=2405

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+ TV AG++I+FTANWILA IILAV+PL+G QG++Q R 
Sbjct  747  LVVQNLVTVAAGLVISFTANWILALIILAVLPLMGFQGYLQTRF  790


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQ  16
             L+VQN+ T++ G+II+FTANWILA IIL V+PLLG +GF+Q
Sbjct  1949  LLVQNLTTIIVGLIISFTANWILALIILGVMPLLGFEGFVQ  1989



>ref|XP_003620170.1| ABC transporter B family member [Medicago truncatula]
Length=1287

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNI TVVAG++IAFTANWILAFI+LAV PL+ +QG +QM+ 
Sbjct  834  LLVQNITTVVAGLVIAFTANWILAFIVLAVSPLILMQGMVQMKF  877



>ref|XP_010655616.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Vitis vinifera]
Length=1194

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQN+ TV AG++I+FTANWILA IILAV+PL+G QG++Q R
Sbjct  750  LVVQNLVTVAAGLVISFTANWILALIILAVLPLMGFQGYLQTR  792



>ref|XP_010655615.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Vitis vinifera]
Length=1212

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQN+ TV AG++I+FTANWILA IILAV+PL+G QG++Q R
Sbjct  768  LVVQNLVTVAAGLVISFTANWILALIILAVLPLMGFQGYLQTR  810



>gb|AES76388.2| ABC transporter B family-like protein [Medicago truncatula]
Length=1264

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNI TVVAG++IAFTANWILAFI+LAV PL+ +QG +QM+ 
Sbjct  821  LLVQNITTVVAGLVIAFTANWILAFIVLAVSPLILMQGMVQMKF  864



>ref|XP_010690905.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690906.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=1261

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+AT +AG++IAFTANWILAFIILA++P++GL G++Q++ 
Sbjct  817  LTVQNVATAIAGLVIAFTANWILAFIILALIPVIGLNGYVQVKF  860



>ref|XP_004485974.1| PREDICTED: ABC transporter B family member 9-like [Cicer arietinum]
Length=1252

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAF+ANWIL+F+ILAV PLL +QG++Q + 
Sbjct  809  LIVQNIATVTAGLVIAFSANWILSFVILAVSPLLLIQGYIQTKF  852



>gb|AES64094.2| ABC transporter B family protein [Medicago truncatula]
Length=1259

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAF+ANWIL+FIILAV PL+ +QG++Q + 
Sbjct  816  LIVQNIATVAAGLVIAFSANWILSFIILAVSPLMLIQGYIQTKF  859



>ref|XP_010655614.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Vitis vinifera]
Length=1165

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+ TV+AG++I+FTANWILA IILAV+PL+ LQG+ QM+ 
Sbjct  721  LVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQMKF  764



>ref|XP_002271185.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Vitis vinifera]
Length=1270

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+ TV+AG++I+FTANWILA IILAV+PL+ LQG+ QM+ 
Sbjct  826  LVVQNLTTVIAGLVISFTANWILALIILAVLPLVFLQGYFQMKF  869



>ref|XP_006449604.1| hypothetical protein CICLE_v10014058mg [Citrus clementina]
 gb|ESR62844.1| hypothetical protein CICLE_v10014058mg [Citrus clementina]
Length=1284

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG+IIAFTANWILAF+ILAV PL+ +QG+ Q + 
Sbjct  841  LVVQNIATIAAGLIIAFTANWILAFVILAVSPLMLVQGYTQTKF  884



>gb|KDO78013.1| hypothetical protein CISIN_1g000789mg [Citrus sinensis]
Length=1283

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG+IIAFTANWILAF+ILAV PL+ +QG+ Q + 
Sbjct  840  LVVQNIATIAAGLIIAFTANWILAFVILAVSPLMLVQGYTQTKF  883



>ref|XP_006467555.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Citrus sinensis]
 ref|XP_006467556.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Citrus sinensis]
 ref|XP_006467557.1| PREDICTED: ABC transporter B family member 9-like isoform X3 
[Citrus sinensis]
Length=1283

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG+IIAFTANWILAF+ILAV PL+ +QG+ Q + 
Sbjct  840  LVVQNIATIAAGLIIAFTANWILAFVILAVSPLMLVQGYTQTKF  883



>ref|XP_003593843.1| ABC transporter B family member [Medicago truncatula]
Length=926

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV AG++IAF+ANWIL+FIILAV PL+ +QG++Q + 
Sbjct  854  LIVQNIATVAAGLVIAFSANWILSFIILAVSPLMLIQGYIQTKF  897



>ref|XP_009414924.1| PREDICTED: ABC transporter B family member 11-like [Musa acuminata 
subsp. malaccensis]
Length=1301

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI T++AG++IAF ANW LA IILA+VPLLGL G++QM+ 
Sbjct  857  LIVQNITTLIAGLLIAFIANWQLALIILALVPLLGLNGYVQMKF  900



>ref|XP_004485973.1| PREDICTED: ABC transporter B family member 9-like [Cicer arietinum]
Length=1266

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG+++AFTANWILAFI+LAV P++ +QG +QM+ 
Sbjct  818  LIVQNISTITAGLVLAFTANWILAFIVLAVTPVVLIQGILQMKF  861



>ref|XP_003609885.1| ABC transporter B family member [Medicago truncatula]
 gb|AES92082.1| ABC transporter B family protein [Medicago truncatula]
Length=1333

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+NIAT +AG++IAFTA+W LA IILA+VPLLGL GF+Q++ 
Sbjct  889  LLVENIATAIAGLVIAFTASWQLALIILALVPLLGLNGFLQVKF  932



>gb|KEH32389.1| ABC transporter B family protein [Medicago truncatula]
Length=1278

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+NIAT +AG++IAFTA+W LA IILA+VPLLGL GF+Q++ 
Sbjct  834  LLVENIATAIAGLVIAFTASWQLALIILALVPLLGLNGFLQVKF  877



>ref|XP_003593853.1| ABC transporter B family member [Medicago truncatula]
Length=1279

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+TV+AG++IAFTANWILAFI+L + P++ +QG +QM+ 
Sbjct  836  LIVQNISTVIAGLVIAFTANWILAFIVLVLTPMILMQGIVQMKF  879



>gb|KEH32390.1| ABC transporter B family protein [Medicago truncatula]
Length=1101

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+NIAT +AG++IAFTA+W LA IILA+VPLLGL GF+Q++ 
Sbjct  657  LLVENIATAIAGLVIAFTASWQLALIILALVPLLGLNGFLQVKF  700



>gb|AES64104.2| ABC transporter B family-like protein [Medicago truncatula]
Length=1268

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+TV+AG++IAFTANWILAFI+L + P++ +QG +QM+ 
Sbjct  825  LIVQNISTVIAGLVIAFTANWILAFIVLVLTPMILMQGIVQMKF  868



>ref|XP_010095132.1| ABC transporter B family member 9 [Morus notabilis]
 gb|EXB58298.1| ABC transporter B family member 9 [Morus notabilis]
Length=1281

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT+ +G+II+FTANWILA IILAV PL+ +QGF+Q + 
Sbjct  838  LIVQNIATITSGLIISFTANWILALIILAVSPLMIIQGFLQAKF  881



>gb|KDP21188.1| hypothetical protein JCGZ_21659 [Jatropha curcas]
Length=1268

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV A ++IAFTANWILA II+A+ PLL  QGF+Q R 
Sbjct  825  LIVQNIATVTAALLIAFTANWILALIIVAISPLLLFQGFIQARF  868



>ref|XP_010682394.1| PREDICTED: ABC transporter B family member 9-like [Beta vulgaris 
subsp. vulgaris]
Length=382

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QNIATV+AG++IAFTANWILA IILAV PL+  QG++Q + 
Sbjct  184  LIMQNIATVIAGLVIAFTANWILALIILAVAPLMFAQGYLQGKF  227



>ref|XP_004485972.1| PREDICTED: ABC transporter B family member 9-like [Cicer arietinum]
Length=1261

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG+++AFTANWILAFI+LAV P++ +QG +QM+ 
Sbjct  818  LIVQNISTITAGLVLAFTANWILAFIVLAVSPVVLIQGILQMKF  861



>ref|XP_002519759.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF42732.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1269

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIATV AG++IAF ANWILAFIILAV PL+  QG++Q++ 
Sbjct  826  LLVQNIATVAAGLVIAFRANWILAFIILAVSPLMIFQGYIQVKF  869



>ref|XP_008439691.1| PREDICTED: ABC transporter B family member 9 [Cucumis melo]
Length=1267

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG++IAFTANWILA +IL V PLL +QG++Q + 
Sbjct  821  LVVQNIATITAGLVIAFTANWILALVILGVSPLLLVQGYLQTKF  864



>gb|KFK22284.1| hypothetical protein AALP_AAs69729U000100, partial [Arabis alpina]
Length=756

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAF+ANW+LAFIIL V P + +QG+ QM+ 
Sbjct  567  LIVQNIATVATGLIIAFSANWMLAFIILLVSPFIFIQGYFQMKF  610



>ref|XP_010667802.1| PREDICTED: ABC transporter B family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=1279

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LI+QNIATV+AG++IAFTANWILA IILAV PL+  QG++Q +
Sbjct  833  LIMQNIATVIAGLVIAFTANWILALIILAVAPLMFAQGYLQGK  875



>ref|XP_002519757.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF42730.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1249

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI QNIAT+VA +IIAFTANWILA +I+AV PLL  QGF+Q R 
Sbjct  806  LIFQNIATIVAALIIAFTANWILALVIVAVSPLLLFQGFIQARF  849



>ref|XP_004134559.1| PREDICTED: ABC transporter B family member 9-like [Cucumis sativus]
 gb|KGN49354.1| hypothetical protein Csa_6G521010 [Cucumis sativus]
Length=1270

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG+IIAFTANWILA +I+ V PLL +QG++Q + 
Sbjct  824  LVVQNIATITAGLIIAFTANWILALVIIGVSPLLLVQGYLQTKF  867



>gb|KFK22285.1| hypothetical protein AALP_AAs69729U000100, partial [Arabis alpina]
Length=743

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAF+ANW+LAFIIL V P + +QG+ QM+ 
Sbjct  567  LIVQNIATVATGLIIAFSANWMLAFIILLVSPFIFIQGYFQMKF  610



>ref|XP_004508080.1| PREDICTED: ABC transporter B family member 21-like isoform X2 
[Cicer arietinum]
Length=1282

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++IAF A+W LAFI+LA+ PLLGL G++Q++ 
Sbjct  836  LLVQNIATAIAGLVIAFQASWQLAFIVLALAPLLGLNGYVQVKF  879



>ref|XP_004155533.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
9-like [Cucumis sativus]
Length=1268

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT+ AG+IIAFTANWILA +I+ V PLL +QG++Q + 
Sbjct  823  LVVQNIATITAGLIIAFTANWILALVIIGVSPLLLVQGYLQTKF  866



>ref|XP_004508079.1| PREDICTED: ABC transporter B family member 21-like isoform X1 
[Cicer arietinum]
Length=1269

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++IAF A+W LAFI+LA+ PLLGL G++Q++ 
Sbjct  823  LLVQNIATAIAGLVIAFQASWQLAFIVLALAPLLGLNGYVQVKF  866



>ref|XP_003609881.1| ABC transporter B family member [Medicago truncatula]
 gb|AES92078.1| ABC transporter B family protein [Medicago truncatula]
Length=1280

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT++ G++IAF A+W LAFI+LA+ PLLGL G++Q+++
Sbjct  836  LLVQNIATIIVGMVIAFQASWQLAFIVLALAPLLGLNGYVQVKV  879



>ref|XP_006597505.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Glycine max]
Length=1245

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG++I+FTANWILA II+AV PL+ +QG +QM+ 
Sbjct  802  LIVQNISTITAGLVISFTANWILALIIVAVSPLIFIQGVLQMKF  845



>ref|XP_003547192.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Glycine max]
Length=1260

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG++I+FTANWILA II+AV PL+ +QG +QM+ 
Sbjct  817  LIVQNISTITAGLVISFTANWILALIIVAVSPLIFIQGVLQMKF  860



>ref|XP_009136898.1| PREDICTED: ABC transporter B family member 9 [Brassica rapa]
Length=1257

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIATV AG+IIAFTANW+LA +ILAV P + +QG++Q +
Sbjct  814  LIVQNIATVTAGLIIAFTANWMLALVILAVSPFMVMQGYVQTK  856



>ref|XP_006597506.1| PREDICTED: ABC transporter B family member 9-like isoform X3 
[Glycine max]
Length=1243

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG++I+FTANWILA II+AV PL+ +QG +QM+ 
Sbjct  800  LIVQNISTITAGLVISFTANWILALIIVAVSPLIFIQGVLQMKF  843



>ref|XP_006414157.1| hypothetical protein EUTSA_v10024238mg [Eutrema salsugineum]
 gb|ESQ55610.1| hypothetical protein EUTSA_v10024238mg [Eutrema salsugineum]
Length=1222

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNI+TV+AG+IIAF+ANWILA I+LA+ PL+ +QG++Q +
Sbjct  779  LIVQNISTVIAGLIIAFSANWILALIVLALSPLIVMQGYLQTK  821



>gb|KHN06940.1| ABC transporter B family member 9 [Glycine soja]
Length=1211

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+ AG++I+FTANWILA II+AV PL+ +QG +QM+ 
Sbjct  768  LIVQNISTITAGLVISFTANWILALIIVAVSPLIFIQGVLQMKF  811



>ref|XP_003609882.1| ABC transporter B family member [Medicago truncatula]
Length=1355

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++I+F A+W LAFI+LA+ PLLGL G++Q+++
Sbjct  836  LLVQNIATAIAGLVISFQASWQLAFIVLALAPLLGLNGYVQVKV  879



>ref|XP_002271305.1| PREDICTED: ABC transporter B family member 9-like [Vitis vinifera]
Length=1265

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQ  16
            L+VQN+ T++ G+II+FTANWILA IIL V+PLLG +GF+Q
Sbjct  816  LLVQNLTTIIVGLIISFTANWILALIILGVMPLLGFEGFVQ  856



>gb|AES64092.2| ABC transporter B family-like protein [Medicago truncatula]
Length=1257

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQN++T+ AG+I+AFT+NWILAFI+LAV P++ +QG +QM+ 
Sbjct  814  LIVQNLSTITAGLILAFTSNWILAFIVLAVSPVVLIQGIIQMQF  857



>gb|KHN14170.1| ABC transporter B family member 11 [Glycine soja]
Length=1265

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  820  LLVQNIATALAGLIIAFVASWQLAFILLVLVPLIGINGYIQMKF  863



>ref|XP_003593841.1| ABC transporter B family member [Medicago truncatula]
Length=1262

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQN++T+ AG+I+AFT+NWILAFI+LAV P++ +QG +QM+ 
Sbjct  814  LIVQNLSTITAGLILAFTSNWILAFIVLAVSPVVLIQGIIQMQF  857



>ref|XP_006847022.1| hypothetical protein AMTR_s00017p00164980 [Amborella trichopoda]
 gb|ERN08603.1| hypothetical protein AMTR_s00017p00164980 [Amborella trichopoda]
Length=1279

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQNI+++ AG++IAF ANW LAFIILA++P +GLQG++QM+ 
Sbjct  835  LAVQNISSITAGLVIAFVANWQLAFIILALLPFVGLQGYVQMKF  878



>ref|XP_004508078.1| PREDICTED: ABC transporter B family member 21-like [Cicer arietinum]
Length=1269

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++IAF A+W LA IILA+VPLL + GF+Q++ 
Sbjct  826  LLVQNIATAIAGLVIAFAASWQLALIILAIVPLLAINGFLQVKF  869



>gb|EYU35917.1| hypothetical protein MIMGU_mgv1a026620mg [Erythranthe guttata]
Length=1230

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLYA  1
            L+VQNIAT VAG+II F+A+W L+ I+LA++PL+GL G++QM+  A
Sbjct  784  LLVQNIATAVAGLIIGFSASWQLSLIVLALLPLIGLNGYLQMKFVA  829



>ref|XP_003520772.2| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Glycine max]
Length=1283

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  838  LLVQNIATALAGLIIAFVASWQLAFILLVLVPLIGINGYIQMKF  881



>gb|AES92079.2| ABC transporter B family protein [Medicago truncatula]
Length=1280

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++I+F A+W LAFI+LA+ PLLGL G++Q+++
Sbjct  836  LLVQNIATAIAGLVISFQASWQLAFIVLALAPLLGLNGYVQVKV  879



>ref|XP_004495861.1| PREDICTED: ABC transporter B family member 21-like isoform X1 
[Cicer arietinum]
 ref|XP_004495862.1| PREDICTED: ABC transporter B family member 21-like isoform X2 
[Cicer arietinum]
 ref|XP_004495863.1| PREDICTED: ABC transporter B family member 21-like isoform X3 
[Cicer arietinum]
Length=1283

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+AT +AG+IIAF A+W LAFIIL ++PL+GL G++QM+ 
Sbjct  838  LMVQNLATALAGLIIAFVASWKLAFIILVLLPLIGLNGYVQMKF  881



>ref|XP_006597507.1| PREDICTED: ABC transporter B family member 9-like isoform X4 
[Glycine max]
Length=1242

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNI+T+ AG++I+FTANWILA II+AV PL+ +QG +QM+
Sbjct  799  LIVQNISTITAGLVISFTANWILALIIVAVSPLIFIQGVLQMK  841



>ref|XP_006577180.1| PREDICTED: ABC transporter B family member 4-like isoform X2 
[Glycine max]
Length=1296

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  838  LLVQNIATALAGLIIAFVASWQLAFILLVLVPLIGINGYIQMKF  881



>ref|XP_006577182.1| PREDICTED: ABC transporter B family member 4-like isoform X4 
[Glycine max]
Length=1258

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  838  LLVQNIATALAGLIIAFVASWQLAFILLVLVPLIGINGYIQMKF  881



>ref|XP_007163242.1| hypothetical protein PHAVU_001G218000g [Phaseolus vulgaris]
 ref|XP_007163243.1| hypothetical protein PHAVU_001G218000g [Phaseolus vulgaris]
 gb|ESW35236.1| hypothetical protein PHAVU_001G218000g [Phaseolus vulgaris]
 gb|ESW35237.1| hypothetical protein PHAVU_001G218000g [Phaseolus vulgaris]
Length=1282

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT + G+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  837  LIVQNIATALTGLIIAFVASWQLAFIVLVLVPLIGMNGYIQMKF  880



>gb|KHF98198.1| ABC transporter B family member 9 [Gossypium arboreum]
Length=1295

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIAT+VAG++IAFTANWILA  ILAV+P   +QG++Q +
Sbjct  847  LIVQNIATIVAGLVIAFTANWILAIAILAVMPFTLIQGYLQTK  889



>ref|XP_006577181.1| PREDICTED: ABC transporter B family member 4-like isoform X3 
[Glycine max]
Length=1271

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG+IIAF A+W LAFI+L +VPL+G+ G++QM+ 
Sbjct  838  LLVQNIATALAGLIIAFVASWQLAFILLVLVPLIGINGYIQMKF  881



>gb|KEH32387.1| ABC transporter B family protein [Medicago truncatula]
Length=982

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT +AG++I+F A+W LAFI+LA+ PLLGL G++Q+++
Sbjct  836  LLVQNIATAIAGLVISFQASWQLAFIVLALAPLLGLNGYVQVKV  879



>gb|KCW88641.1| hypothetical protein EUGRSUZ_A01006 [Eucalyptus grandis]
Length=1037

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNIA+ +AG++IAFTA+W LA IILA+VPL+G+ G++Q++ 
Sbjct  851  IVQNIASAIAGLVIAFTASWQLALIILALVPLIGVNGYVQVKF  893



>ref|XP_002988703.1| hypothetical protein SELMODRAFT_184079 [Selaginella moellendorffii]
 gb|EFJ10214.1| hypothetical protein SELMODRAFT_184079 [Selaginella moellendorffii]
Length=1267

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L++QN+A+++AG++IAFTANWIL+ ++LA++PLLG QG +Q ++
Sbjct  820  LLLQNLASLIAGLVIAFTANWILSLVVLALIPLLGAQGVVQTKM  863



>ref|XP_002986365.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ12574.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1270

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L++QN+A+++AG++IAFTANWIL+ ++LA++PLLG QG +Q ++
Sbjct  823  LLLQNLASLIAGLVIAFTANWILSLVVLALIPLLGAQGVVQTKM  866



>emb|CAB78807.1| multidrug resistance protein/P-glycoprotein-like [Arabidopsis 
thaliana]
Length=1323

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAFTANWILA I+LA+ P + +QG+ Q + 
Sbjct  835  LIVQNIATVTTGLIIAFTANWILALIVLALSPFIVIQGYAQTKF  878



>ref|XP_002515187.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF47171.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1269

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+A+ VAG++IAFTA+W LAFIILA++PL+G+ G++Q++ 
Sbjct  825  MVQNLASAVAGLVIAFTASWQLAFIILALIPLIGVTGYVQVKF  867



>gb|KDP28338.1| hypothetical protein JCGZ_14109 [Jatropha curcas]
Length=772

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIAT VA ++IAFTA+W LAFIILA+VPL+G+ G +Q++ 
Sbjct  328  MVQNIATAVAALVIAFTASWQLAFIILALVPLMGVNGIIQIKF  370



>ref|XP_010045629.1| PREDICTED: ABC transporter B family member 11-like [Eucalyptus 
grandis]
 gb|KCW88640.1| hypothetical protein EUGRSUZ_A01006 [Eucalyptus grandis]
Length=1295

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNIA+ +AG++IAFTA+W LA IILA+VPL+G+ G++Q++ 
Sbjct  851  IVQNIASAIAGLVIAFTASWQLALIILALVPLIGVNGYVQVKF  893



>ref|XP_011016204.1| PREDICTED: ABC transporter B family member 21-like [Populus euphratica]
Length=1294

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+ VAG++IAFTA W LAF+IL ++PL+GL GF+Q++ 
Sbjct  850  LVQNIASAVAGLVIAFTACWQLAFVILVLLPLIGLNGFVQIKF  892



>ref|NP_193539.6| P-glycoprotein 9 [Arabidopsis thaliana]
 sp|Q9M0M2.2|AB9B_ARATH RecName: Full=ABC transporter B family member 9; Short=ABC transporter 
ABCB.9; Short=AtABCB9; AltName: Full=Multidrug resistance 
protein 9; AltName: Full=P-glycoprotein 9 [Arabidopsis 
thaliana]
 gb|AEE83988.1| P-glycoprotein 9 [Arabidopsis thaliana]
Length=1236

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAFTANWILA I+LA+ P + +QG+ Q + 
Sbjct  793  LIVQNIATVTTGLIIAFTANWILALIVLALSPFIVIQGYAQTKF  836



>ref|XP_004485975.1| PREDICTED: ABC transporter B family member 9-like [Cicer arietinum]
Length=1252

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+  G++IAFTANWILAF++L V P++ +QG +QM+ 
Sbjct  809  LIVQNISTLTTGLVIAFTANWILAFVVLIVSPMVLIQGLLQMKF  852



>ref|XP_010052120.1| PREDICTED: ABC transporter B family member 9-like [Eucalyptus 
grandis]
 gb|KCW75985.1| hypothetical protein EUGRSUZ_D00350 [Eucalyptus grandis]
Length=1272

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIAT++AG++IAF ANW+LA I+LAV PLL  QGF+Q +
Sbjct  828  LIVQNIATIIAGLLIAFIANWMLALIVLAVSPLLLAQGFIQAK  870



>ref|XP_004297068.1| PREDICTED: ABC transporter B family member 4-like [Fragaria vesca 
subsp. vesca]
Length=1301

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+AT VAG++IAF ANW LA I+L ++P++GL G+ Q+++
Sbjct  857  LLVQNLATAVAGLVIAFVANWQLALIVLVLLPMIGLSGYFQVKI  900



>ref|XP_010054273.1| PREDICTED: ABC transporter B family member 9-like [Eucalyptus 
grandis]
Length=1274

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQN+ATV+AG++IAF ANWILAFI++AV PL+  +GF+Q +
Sbjct  830  LIVQNVATVMAGLLIAFIANWILAFIVIAVSPLILAEGFIQAK  872



>gb|KCW75984.1| hypothetical protein EUGRSUZ_D00349, partial [Eucalyptus grandis]
Length=1228

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQN+ATV+AG++IAF ANWILAFI++AV PL+  +GF+Q +
Sbjct  802  LIVQNVATVMAGLLIAFIANWILAFIVIAVSPLILAEGFIQAK  844



>ref|XP_006356120.1| PREDICTED: ABC transporter B family member 11-like [Solanum tuberosum]
Length=1286

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+TV  G++IA  ANWILA I+LA++PLL LQG +Q++L
Sbjct  844  IVQNISTVATGMVIALIANWILALIMLAIMPLLALQGIIQIKL  886



>ref|XP_006386686.1| hypothetical protein POPTR_0002s18860g [Populus trichocarpa]
 gb|ERP64483.1| hypothetical protein POPTR_0002s18860g [Populus trichocarpa]
Length=1228

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+ VAG++IAF A W LAF+IL ++PL+GL GF+QM+ 
Sbjct  784  LVQNIASAVAGLVIAFVACWQLAFVILVLLPLIGLNGFIQMKF  826



>emb|CAB53646.1| multidrug resistance protein/P-glycoprotein-like [Arabidopsis 
thaliana]
Length=1222

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIATV  G+IIAFTANWILA I+LA+ P + +QG+ Q +
Sbjct  835  LIVQNIATVTTGLIIAFTANWILALIVLALSPFIVIQGYAQTK  877



>ref|XP_002301547.1| multidrug resistant ABC transporter family protein [Populus trichocarpa]
 gb|EEE80820.1| multidrug resistant ABC transporter family protein [Populus trichocarpa]
Length=1224

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+ VAG++IAF A W LAF+IL ++PL+GL GF+QM+ 
Sbjct  784  LVQNIASAVAGLVIAFVACWQLAFVILVLLPLIGLNGFIQMKF  826



>ref|XP_009604261.1| PREDICTED: ABC transporter B family member 9-like [Nicotiana 
tomentosiformis]
Length=1271

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNI+T+V G++IA  ANWILA I +A++PLL LQG++Q++L
Sbjct  829  LVQNISTIVTGLVIALIANWILALITIAIMPLLALQGYIQIKL  871



>gb|KHN45005.1| ABC transporter B family member 11 [Glycine soja]
Length=1274

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN AT +AG++IAF ++W LA IILA+VPLLGL G++Q + 
Sbjct  832  LLVQNTATAIAGLVIAFESSWQLALIILALVPLLGLNGYLQFKF  875



>ref|XP_006594002.1| PREDICTED: ABC transporter B family member 11-like [Glycine max]
Length=1274

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN AT +AG++IAF ++W LA IILA+VPLLGL G++Q + 
Sbjct  832  LLVQNTATAIAGLVIAFESSWQLALIILALVPLLGLNGYLQFKF  875



>gb|ABG56414.1| MDR-like ABC transporter [Taxus cuspidata]
Length=1316

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT++AG++I+FTANW+LA +ILA+VPLLGLQG+MQ++ 
Sbjct  874  LVVQNIATIIAGIVISFTANWLLALLILAIVPLLGLQGYMQVKF  917



>ref|XP_009360960.1| PREDICTED: ABC transporter B family member 9-like [Pyrus x bretschneideri]
Length=1278

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT++AG+II FTANW L  ++LAV PL+ LQG +Q + 
Sbjct  834  LIVQNIATIIAGLIIGFTANWKLTLVVLAVSPLMLLQGTLQAKF  877



>ref|XP_007025208.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025209.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025210.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025211.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025212.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025213.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 ref|XP_007025214.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27830.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27831.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27832.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27833.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27834.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27835.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
 gb|EOY27836.1| P-glycoprotein 9 isoform 1 [Theobroma cacao]
Length=1272

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQN++T+ AG+IIAF+ANW LA  ILAV P + LQG++QM+
Sbjct  829  LIVQNMSTIAAGLIIAFSANWRLALAILAVSPFMLLQGYLQMK  871



>ref|XP_010439908.1| PREDICTED: ABC transporter B family member 9 [Camelina sativa]
 ref|XP_010439909.1| PREDICTED: ABC transporter B family member 9 [Camelina sativa]
Length=1264

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAFTANW+LA I+LA+ P + +QG+ Q + 
Sbjct  821  LIVQNIATVATGLIIAFTANWMLALIVLALSPFIVIQGYAQTKF  864



>gb|KDO86794.1| hypothetical protein CISIN_1g000777mg [Citrus sinensis]
Length=1091

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA IIL ++PL+G+ G+ QM+ 
Sbjct  844  IVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKF  886



>gb|KDO86792.1| hypothetical protein CISIN_1g000777mg [Citrus sinensis]
Length=1198

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA IIL ++PL+G+ G+ QM+ 
Sbjct  844  IVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKF  886



>gb|KDO86791.1| hypothetical protein CISIN_1g000777mg [Citrus sinensis]
Length=1288

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA IIL ++PL+G+ G+ QM+ 
Sbjct  844  IVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKF  886



>ref|XP_006492413.1| PREDICTED: ABC transporter B family member 4-like [Citrus sinensis]
Length=1293

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA IIL ++PL+G+ G+ QM+ 
Sbjct  849  IVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKF  891



>gb|KDO86793.1| hypothetical protein CISIN_1g000777mg [Citrus sinensis]
Length=1178

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA IIL ++PL+G+ G+ QM+ 
Sbjct  844  IVQNISTAAAGLIIAFTASWQLALIILVMLPLIGVSGYTQMKF  886



>emb|CDY25095.1| BnaC06g18370D [Brassica napus]
Length=1206

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQNIA+V AGV+IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  758  VQNIASVTAGVVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  799



>ref|XP_010434583.1| PREDICTED: ABC transporter B family member 9-like [Camelina sativa]
Length=1264

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIATV  G+IIAFTANW+LA I+LA+ P + +QG+ Q + 
Sbjct  821  LIVQNIATVATGLIIAFTANWMLALIVLALSPFIVIQGYAQTKF  864



>ref|XP_002960296.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ37835.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1360

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+AT+ AG++IAF+A W LA +I A+VPLL LQG MQ+++
Sbjct  919  LTVQNLATIAAGLLIAFSATWELALVIFALVPLLSLQGIMQIKV  962



>ref|XP_008383571.1| PREDICTED: ABC transporter B family member 9-like, partial [Malus 
domestica]
Length=1241

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT++AG+II FTANW L  ++LAV PL+ LQG +Q + 
Sbjct  797  LIVQNIATIIAGLIIGFTANWKLTLVVLAVSPLMLLQGTLQAKF  840



>ref|XP_011040312.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
21-like [Populus euphratica]
Length=1152

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+  AG++IAFTA W LAF+IL ++PL+GL GF+Q++ 
Sbjct  708  LVQNIASAAAGLVIAFTACWQLAFVILVLLPLIGLNGFVQIKF  750



>ref|XP_002515185.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF47169.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1292

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+ VAG+IIAFT++W LAFIIL +VPL GL  ++Q++ 
Sbjct  848  MVQNIASAVAGLIIAFTSSWQLAFIILVIVPLTGLNAYVQLKF  890



>gb|AIU41629.1| ABC transporter family protein [Hevea brasiliensis]
Length=1283

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIAT VA ++IAFTA+W LAFIILA++PL+G+ G +Q++ 
Sbjct  839  MVQNIATAVAAMVIAFTASWQLAFIILALIPLIGVNGVVQVKF  881



>ref|XP_006283011.1| hypothetical protein CARUB_v10004001mg [Capsella rubella]
 gb|EOA15909.1| hypothetical protein CARUB_v10004001mg [Capsella rubella]
Length=1265

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIATV  G+IIAFTANW+LA I+LA+ P + +QG+ Q +
Sbjct  822  LIVQNIATVTTGLIIAFTANWMLALIVLALSPFIVIQGYAQTK  864



>ref|XP_002515186.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF47170.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1292

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+ VAG++IAFTA+W LAFIIL +VPL GL  ++Q+  
Sbjct  848  MVQNIASAVAGLVIAFTASWQLAFIILVIVPLTGLNAYVQLEF  890



>ref|XP_004152829.1| PREDICTED: ABC transporter B family member 4-like [Cucumis sativus]
Length=1298

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+N+A V AG++IAF A+W LAFI+LA+ PLLGL G++QM+ 
Sbjct  851  LVENLAAVTAGLVIAFVASWQLAFIVLAMFPLLGLNGYVQMKF  893



>ref|XP_011005823.1| PREDICTED: ABC transporter B family member 9 [Populus euphratica]
Length=1270

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+++ ++IAF+ANW+L  II+A+ PLL +QG+MQ + 
Sbjct  827  LIVQNISTILSALVIAFSANWMLTLIIIAISPLLFIQGYMQAKF  870



>ref|XP_007154480.1| hypothetical protein PHAVU_003G122400g [Phaseolus vulgaris]
 gb|ESW26474.1| hypothetical protein PHAVU_003G122400g [Phaseolus vulgaris]
Length=1274

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIA+ + G++IAF ++W LA IIL +VPLLGL GF+Q++ 
Sbjct  831  LLVQNIASAITGLVIAFESSWQLALIILVMVPLLGLNGFLQVKF  874



>ref|XP_004234243.1| PREDICTED: ABC transporter B family member 9-like [Solanum lycopersicum]
Length=1259

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+TV  G++IA  ANWILA I+LA++PLL LQG +Q++L
Sbjct  817  IVQNISTVATGMVIALIANWILALIMLAILPLLVLQGIIQIKL  859



>ref|XP_011040271.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
 ref|XP_011040279.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
 ref|XP_011040287.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
Length=1288

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNIATV + +IIAFTA+W LA +ILA++PL+G+ G +QM+ 
Sbjct  844  IVQNIATVTSAMIIAFTASWQLALVILALIPLIGINGVIQMKF  886



>ref|XP_002870073.1| P-glycoprotein 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46332.1| P-glycoprotein 9 [Arabidopsis lyrata subsp. lyrata]
Length=1239

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIATV  G+IIAFTANW+LA I+LA+ P + +QG+ Q +
Sbjct  796  LIVQNIATVTTGLIIAFTANWMLALIVLALSPFIVIQGYAQTK  838



>ref|XP_010449508.1| PREDICTED: ABC transporter B family member 9-like [Camelina sativa]
 ref|XP_010449509.1| PREDICTED: ABC transporter B family member 9-like [Camelina sativa]
Length=1265

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIATV  G+IIAFTANW+LA I+LA+ P + +QG+ Q +
Sbjct  822  LIVQNIATVATGLIIAFTANWMLALIVLALSPFIVIQGYAQTK  864



>ref|XP_002967417.1| hypothetical protein SELMODRAFT_87743 [Selaginella moellendorffii]
 gb|EFJ32016.1| hypothetical protein SELMODRAFT_87743 [Selaginella moellendorffii]
Length=1325

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+AT+ AG++IAF+A W LA +I A+VPLL LQG MQ+++
Sbjct  884  LTVQNLATIAAGLLIAFSATWELALVIFALVPLLSLQGIMQIKV  927



>emb|CDX67881.1| BnaA07g19210D [Brassica napus]
Length=1201

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AGV+IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  759  VQNLASVTAGVVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  800



>gb|KDP28019.1| hypothetical protein JCGZ_19099 [Jatropha curcas]
Length=1131

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN AT+VAG++IAF ANW L+FIIL ++P LGL G++Q + 
Sbjct  678  LLVQNAATLVAGLVIAFQANWQLSFIILFMIPFLGLNGYVQWKF  721



>ref|XP_010544933.1| PREDICTED: ABC transporter B family member 21-like [Tarenaya 
hassleriana]
Length=1296

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+++VVAG++IAFTA+W LAFI+LA++PL+ L GF+ M+ 
Sbjct  854  VQNLSSVVAGLVIAFTASWQLAFIVLAMLPLIALNGFVYMKF  895



>ref|XP_006369863.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP66432.1| ABC transporter family protein [Populus trichocarpa]
Length=1255

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNI+T+++ ++IAF+ANW+L  II+A+ PLL +QG+MQ + 
Sbjct  812  LIVQNISTILSALVIAFSANWMLTLIIIAISPLLFIQGYMQAKF  855



>ref|XP_006444609.1| hypothetical protein CICLE_v10018532mg [Citrus clementina]
 gb|ESR57849.1| hypothetical protein CICLE_v10018532mg [Citrus clementina]
Length=1264

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNI+T  AG+IIAFTA+W LA I+L ++PL+G+ G+ QM+ 
Sbjct  820  IVQNISTAAAGMIIAFTASWELALIVLVMLPLIGVSGYTQMKF  862



>emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera]
Length=1789

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIATV+AG+  AF ANW+LA IIL  +PL+G+ G +Q++ 
Sbjct  809  LVVQNIATVIAGLAAAFEANWLLALIILVFLPLIGINGCIQLQF  852



>ref|XP_006840349.1| hypothetical protein AMTR_s00045p00108620 [Amborella trichopoda]
 gb|ERN02024.1| hypothetical protein AMTR_s00045p00108620 [Amborella trichopoda]
Length=1278

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L VQN+AT V GV+IAF+A W LA +ILA+ PL+GL+G+ QMR
Sbjct  837  LAVQNVATAVGGVVIAFSACWQLALLILALSPLVGLEGWTQMR  879



>gb|KGN61258.1| hypothetical protein Csa_2G074200 [Cucumis sativus]
Length=1310

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+++ATV AG++IAF A+W LA I+LA+ PLLGL GF+QM+ 
Sbjct  863  LVESLATVTAGLVIAFVASWQLALIVLAMFPLLGLNGFVQMKF  905



>ref|XP_003567027.1| PREDICTED: ABC transporter B family member 4-like [Brachypodium 
distachyon]
Length=1258

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQ I+T++AG IIA  A+W L+FIIL V+PL+GLQG+ QM+ 
Sbjct  815  LTVQIISTLIAGFIIAMVADWKLSFIILCVIPLVGLQGYAQMKF  858



>ref|XP_007214562.1| hypothetical protein PRUPE_ppa000338mg [Prunus persica]
 gb|EMJ15761.1| hypothetical protein PRUPE_ppa000338mg [Prunus persica]
Length=1270

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+ QNIAT++AG+II FTANW LA +ILAV PLL LQG +Q +
Sbjct  826  LLAQNIATILAGLIIGFTANWKLALLILAVSPLLILQGTLQTK  868



>ref|XP_007225454.1| hypothetical protein PRUPE_ppa000316mg [Prunus persica]
 gb|EMJ26653.1| hypothetical protein PRUPE_ppa000316mg [Prunus persica]
Length=1293

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+N AT +AG+ IAF ANW LAFIIL ++PLLGL G+ Q++ 
Sbjct  849  LLVENSATAIAGLCIAFVANWQLAFIILVLMPLLGLTGYAQVKF  892



>ref|XP_010666555.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010666556.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010666557.1| PREDICTED: ABC transporter B family member 11-like [Beta vulgaris 
subsp. vulgaris]
Length=1267

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L++QNI++ + G++IAF ANWILAFI+L ++PL+GL G++Q++
Sbjct  823  LLIQNISSAITGLLIAFLANWILAFIVLVLIPLVGLSGYIQIK  865



>ref|XP_008225385.1| PREDICTED: ABC transporter B family member 9 [Prunus mume]
Length=1266

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+ QN+AT++AG+II FTANW LA I+LAV PLL LQG +Q + 
Sbjct  822  LLAQNVATILAGLIIGFTANWKLALIVLAVSPLLILQGTLQTKF  865



>gb|KGN61257.1| hypothetical protein Csa_2G074190 [Cucumis sativus]
Length=1298

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+N+A V AG++IAF ++W LAFI+LA+ PLLGL G++QM+ 
Sbjct  851  LVENLAAVTAGLVIAFASSWQLAFIVLAMFPLLGLNGYVQMKF  893



>ref|XP_010916125.1| PREDICTED: ABC transporter B family member 9-like [Elaeis guineensis]
Length=1264

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQN+AT+V G++IA  ANW L+ I+L ++P L LQG+ Q+R+
Sbjct  821  LIVQNLATIVTGLVIAMVANWKLSLIVLVLIPFLSLQGYAQVRM  864



>ref|XP_004155099.1| PREDICTED: ABC transporter B family member 4-like [Cucumis sativus]
Length=1298

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+N+A V AG++IAF ++W LAFI+LA+ PLLGL G++QM+ 
Sbjct  851  LVENLAAVTAGLVIAFASSWQLAFIVLAMFPLLGLNGYVQMKF  893



>ref|XP_004303546.1| PREDICTED: ABC transporter B family member 9-like [Fragaria vesca 
subsp. vesca]
Length=1255

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI QNIAT++AG++I FTANW LA +IL V PLL +QG +Q + 
Sbjct  812  LITQNIATIIAGLVIGFTANWKLALLILGVSPLLIIQGLLQTKF  855



>ref|XP_009104372.1| PREDICTED: ABC transporter B family member 21 [Brassica rapa]
 ref|XP_009104373.1| PREDICTED: ABC transporter B family member 21 [Brassica rapa]
Length=1292

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AGV+IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  850  VQNLASVTAGVVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  891



>gb|KFK23687.1| hypothetical protein AALP_AAs50902U000500 [Arabis alpina]
Length=1051

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQ+I  VVAG++IAF ANW+LAFI+LAV P++ +QG++Q +
Sbjct  610  LIVQSITNVVAGLVIAFVANWLLAFIVLAVSPIVIIQGYLQTK  652



>ref|XP_009385387.1| PREDICTED: ABC transporter B family member 4-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=1191

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN++TV+AG +IA  ANW L+ +I+ V+PL+GLQG+ Q++ 
Sbjct  748  LLVQNLSTVIAGFLIAIIANWELSLVIIVVIPLVGLQGYAQIKF  791



>ref|XP_011090143.1| PREDICTED: ABC transporter B family member 4-like [Sesamum indicum]
Length=1232

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT VAG+II F A+W L+ I+LA++PL+GL G++ M+ 
Sbjct  786  LLVQNIATAVAGLIIGFGASWELSLIVLAMLPLIGLNGYLHMKF  829



>ref|XP_002320938.2| hypothetical protein POPTR_0014s10860g [Populus trichocarpa]
 gb|EEE99253.2| hypothetical protein POPTR_0014s10860g [Populus trichocarpa]
Length=1287

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQNIATV + +IIAFTA+W LA +ILA++PL+G+ G +QM+ 
Sbjct  844  VQNIATVTSAMIIAFTASWQLALVILALIPLIGINGVIQMKF  885



>ref|XP_010054272.1| PREDICTED: ABC transporter B family member 9-like [Eucalyptus 
grandis]
Length=1268

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQN+ATV AG++IAF ANWILAFI++AV PL+  +G +Q +
Sbjct  824  LIVQNVATVTAGLLIAFIANWILAFIVIAVSPLILAEGIIQAK  866



>ref|XP_003607429.1| ABC transporter B family member [Medicago truncatula]
 ref|XP_003607438.1| ABC transporter B family member [Medicago truncatula]
 gb|AES89626.1| ABC transporter B family protein [Medicago truncatula]
Length=1278

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+ +NIAT + G++IAF A+W LAFI+LA+ PLLGL G++Q++ 
Sbjct  834  LLAENIATSITGLVIAFEASWQLAFIVLALAPLLGLDGYVQVKF  877



>ref|XP_002273987.1| PREDICTED: ABC transporter B family member 11 [Vitis vinifera]
 ref|XP_010652340.1| PREDICTED: ABC transporter B family member 11 [Vitis vinifera]
Length=1297

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN A+ +AG+ IAF A+W LAFIILA++PL+GL G++Q++ 
Sbjct  854  VVQNAASAIAGLAIAFAASWQLAFIILALIPLIGLNGYVQIKF  896



>gb|KCW75983.1| hypothetical protein EUGRSUZ_D00348, partial [Eucalyptus grandis]
Length=1272

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQN+ATV AG++IAF ANWILAFI++AV PL+  +G +Q +
Sbjct  828  LIVQNVATVTAGLLIAFIANWILAFIVIAVSPLILAEGIIQAK  870



>ref|XP_009353526.1| PREDICTED: ABC transporter B family member 9-like [Pyrus x bretschneideri]
Length=1278

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT++AG II FTANW LA I+LA+ P++ LQG  Q + 
Sbjct  834  LIVQNIATIMAGFIIGFTANWKLALIVLAISPVIILQGTFQAKF  877



>gb|KEH30666.1| ABC transporter B family protein [Medicago truncatula]
Length=1084

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+ +NIAT + G++IAF A+W LAFI+LA+ PLLGL G++Q++ 
Sbjct  834  LLAENIATSITGLVIAFEASWQLAFIVLALAPLLGLDGYVQVKF  877



>gb|KEH30667.1| ABC transporter B family protein [Medicago truncatula]
Length=1169

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+ +NIAT + G++IAF A+W LAFI+LA+ PLLGL G++Q++ 
Sbjct  725  LLAENIATSITGLVIAFEASWQLAFIVLALAPLLGLDGYVQVKF  768



>ref|XP_004155127.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
4-like [Cucumis sativus]
Length=1232

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+++ATV AG++IAF A+W LA I+LA+ PLLGL GF+QM+ 
Sbjct  785  LVESLATVTAGLVIAFVASWQLALIVLAMFPLLGLNGFVQMKF  827



>ref|XP_009385385.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=1286

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN++TV+AG +IA  ANW L+ +I+ V+PL+GLQG+ Q++ 
Sbjct  843  LLVQNLSTVIAGFLIAIIANWELSLVIIVVIPLVGLQGYAQIKF  886



>ref|XP_009360959.1| PREDICTED: ABC transporter B family member 9-like [Pyrus x bretschneideri]
Length=1278

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT++AG++I FTANW L  I+LA  PL+ LQG +Q + 
Sbjct  834  LIVQNIATIMAGLVIGFTANWKLTLIVLAASPLMLLQGTLQAKF  877



>ref|XP_009385386.1| PREDICTED: ABC transporter B family member 4-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=1259

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN++TV+AG +IA  ANW L+ +I+ V+PL+GLQG+ Q++ 
Sbjct  816  LLVQNLSTVIAGFLIAIIANWELSLVIIVVIPLVGLQGYAQIKF  859



>ref|XP_004152879.1| PREDICTED: ABC transporter B family member 4-like [Cucumis sativus]
Length=1232

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+++ATV AG++IAF A+W LA I+LA+ PLLGL GF+QM+ 
Sbjct  785  LVESLATVTAGLVIAFVASWQLALIVLAMFPLLGLNGFVQMKF  827



>emb|CBI37062.3| unnamed protein product [Vitis vinifera]
Length=1147

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN A+ +AG+ IAF A+W LAFIILA++PL+GL G++Q++ 
Sbjct  730  VVQNAASAIAGLAIAFAASWQLAFIILALIPLIGLNGYVQIKF  772



>ref|XP_004308506.1| PREDICTED: ABC transporter B family member 9-like [Fragaria vesca 
subsp. vesca]
Length=1268

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIAT++AG+ I FTANW LA II+AV PLL  QG +Q +
Sbjct  825  LIVQNIATIIAGLTIGFTANWRLALIIIAVSPLLIGQGILQTK  867



>ref|NP_191774.2| ABC transporter B family member 21 [Arabidopsis thaliana]
 sp|Q9M1Q9.2|AB21B_ARATH RecName: Full=ABC transporter B family member 21; Short=ABC transporter 
ABCB.21; Short=AtABCB21; AltName: Full=Multidrug 
resistance protein 17; AltName: Full=P-glycoprotein 21 [Arabidopsis 
thaliana]
 gb|AEE80316.1| ABC transporter B family member 21 [Arabidopsis thaliana]
Length=1296

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AG++IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  854  VQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  895



>ref|XP_006644533.1| PREDICTED: ABC transporter B family member 4-like [Oryza brachyantha]
Length=1262

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQ +A+++ G++IAFTA+W LA II+ V+PL+G QG+ Q++ 
Sbjct  819  LIVQAVASLITGLVIAFTADWRLALIIMCVIPLVGAQGYAQVKF  862



>emb|CAB71875.1| P-glycoprotein-like proetin [Arabidopsis thaliana]
Length=1292

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AG++IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  854  VQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  895



>ref|XP_011096468.1| PREDICTED: ABC transporter B family member 9 [Sesamum indicum]
Length=1261

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            LIVQNIATV+AG++IAFTANW+LA IIL V+PL+GLQGF+QMR Y
Sbjct  818  LIVQNIATVLAGLVIAFTANWLLAIIILLVLPLVGLQGFLQMRFY  862



>gb|KFK35399.1| hypothetical protein AALP_AA5G280000 [Arabis alpina]
Length=1193

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AG++IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  750  VQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  791



>ref|XP_008223526.1| PREDICTED: ABC transporter B family member 4-like [Prunus mume]
Length=1195

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+N AT +AG+ IAF ANW LA IIL ++PLLGL G+ Q++ 
Sbjct  751  LLVENSATAIAGLCIAFVANWQLALIILVLMPLLGLTGYAQVKF  794



>ref|XP_007051282.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 ref|XP_007051283.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 ref|XP_007051284.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 ref|XP_007051285.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 ref|XP_007051286.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 gb|EOX95439.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 gb|EOX95440.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 gb|EOX95441.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 gb|EOX95442.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
 gb|EOX95443.1| ATP binding cassette subfamily B4 isoform 2 [Theobroma cacao]
Length=1292

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V N+A+ VAG++IAF A+W LAFIILA++PL+G+ G++Q++ 
Sbjct  848  MVSNLASAVAGLVIAFVASWQLAFIILALIPLIGVNGYVQVKF  890



>ref|XP_007051281.1| ATP binding cassette subfamily B4 isoform 1 [Theobroma cacao]
 gb|EOX95438.1| ATP binding cassette subfamily B4 isoform 1 [Theobroma cacao]
Length=1292

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V N+A+ VAG++IAF A+W LAFIILA++PL+G+ G++Q++ 
Sbjct  848  MVSNLASAVAGLVIAFVASWQLAFIILALIPLIGVNGYVQVKF  890



>gb|KDP28337.1| hypothetical protein JCGZ_14108 [Jatropha curcas]
Length=1259

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT  A ++IAFTA+W LAFI+L +VPL+G+ G +Q++ 
Sbjct  814  LMVQNIATAGAALVIAFTASWQLAFIVLVLVPLMGVNGMIQVKF  857



>emb|CBI26020.3| unnamed protein product [Vitis vinifera]
Length=2226

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             L+VQNIATV+AG+  AF ANW+LA IIL  +PL+G+ G +Q++ 
Sbjct  1807  LVVQNIATVIAGLAAAFEANWLLALIILVFLPLIGINGCIQLQF  1850


 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN A ++AG++IAF ANW ++FIIL ++PL G  G++Q++ 
Sbjct  581  LLVQNSAAMIAGLVIAFVANWKMSFIILVLLPLFGANGYVQVKF  624



>ref|XP_006402405.1| hypothetical protein EUTSA_v10005750mg [Eutrema salsugineum]
 gb|ESQ43858.1| hypothetical protein EUTSA_v10005750mg [Eutrema salsugineum]
Length=1298

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AG++IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  856  VQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  897



>ref|XP_008349179.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
9-like [Malus domestica]
Length=1267

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            LIVQNIAT++AG++I FTANW L  ++LAV PL+ LQG +Q +
Sbjct  823  LIVQNIATIMAGLVIGFTANWKLMLVVLAVSPLILLQGTLQXK  865



>ref|XP_007154481.1| hypothetical protein PHAVU_003G122500g [Phaseolus vulgaris]
 gb|ESW26475.1| hypothetical protein PHAVU_003G122500g [Phaseolus vulgaris]
Length=1945

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             L+VQN AT V  ++IAF A+W LAFI+LA+ PLLGL G++Q + 
Sbjct  1501  LLVQNAATAVGCLVIAFEASWQLAFIVLALAPLLGLNGYVQFKF  1544


 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN AT V  ++IAF A+W LAFI+L + PLLGL G++Q + 
Sbjct  831  LLVQNAATAVGSLVIAFEASWQLAFIVLVLAPLLGLNGYVQFKF  874



>emb|CDX89963.1| BnaA10g01190D [Brassica napus]
Length=1264

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LAFIIL ++PL+G+ G++Q++ 
Sbjct  818  LAVQNAASAASGLIIAFTASWELAFIILVMLPLIGINGYIQVKF  861



>ref|XP_009119625.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
11-like [Brassica rapa]
Length=1284

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LAFIIL ++PL+G+ G++Q++ 
Sbjct  838  LAVQNAASAASGLIIAFTASWELAFIILVMLPLIGINGYIQVKF  881



>ref|XP_008227785.1| PREDICTED: ABC transporter B family member 11-like [Prunus mume]
 ref|XP_008227786.1| PREDICTED: ABC transporter B family member 11-like [Prunus mume]
 ref|XP_008227787.1| PREDICTED: ABC transporter B family member 11-like [Prunus mume]
Length=1297

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV +IAT +AG++IAF A W LAFIILA++PL+G+ G++Q + 
Sbjct  853  IVNSIATAIAGLVIAFVACWQLAFIILALIPLIGVNGYVQAKF  895



>ref|XP_008223527.1| PREDICTED: ABC transporter B family member 4-like, partial [Prunus 
mume]
Length=946

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+V+N AT +AG+ IAF ANW LA IIL ++PLLG+ G+ Q++ 
Sbjct  731  LLVENSATAIAGLCIAFVANWQLALIILVLMPLLGVTGYAQVKF  774



>ref|XP_002876661.1| P-glycoprotein 21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52920.1| P-glycoprotein 21 [Arabidopsis lyrata subsp. lyrata]
Length=1289

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+A+V AG++IAF A+W LAFI+LA++PL+GL G++ M+ 
Sbjct  851  VQNLASVTAGLVIAFVASWQLAFIVLAMLPLIGLNGYIYMKF  892



>ref|XP_007221461.1| hypothetical protein PRUPE_ppa000313mg [Prunus persica]
 gb|EMJ22660.1| hypothetical protein PRUPE_ppa000313mg [Prunus persica]
Length=1295

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV +IAT +AG++IAF A W LAFIILA++PL+G+ G++Q + 
Sbjct  849  IVNSIATAIAGLVIAFVACWQLAFIILALIPLIGVNGYVQAKF  891



>ref|XP_008776904.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Phoenix dactylifera]
Length=1265

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QN+AT++AG +IA  ANW L+ I+L ++P L LQG+ Q++L
Sbjct  822  LIIQNLATIIAGFMIAMVANWKLSLIVLVLIPFLSLQGYAQVKL  865



>ref|NP_171753.1| P-glycoprotein 11 [Arabidopsis thaliana]
 sp|Q9FWX7.1|AB11B_ARATH RecName: Full=ABC transporter B family member 11; Short=ABC transporter 
ABCB.11; Short=AtABCB11; AltName: Full=Multidrug 
resistance protein 8; AltName: Full=P-glycoprotein 11 [Arabidopsis 
thaliana]
 gb|AAG10628.1|AC022521_6 Putative ABC transporter [Arabidopsis thaliana]
 gb|AEE27440.1| P-glycoprotein 11 [Arabidopsis thaliana]
Length=1278

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+A+  +G+IIAFTA+W LA IIL ++PL+G+ GF+Q++ 
Sbjct  832  LAVQNVASAASGLIIAFTASWELALIILVMLPLIGINGFVQVKF  875



>ref|XP_008776906.1| PREDICTED: ABC transporter B family member 9-like isoform X3 
[Phoenix dactylifera]
Length=1249

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QN+AT++AG +IA  ANW L+ I+L ++P L LQG+ Q++L
Sbjct  806  LIIQNLATIIAGFMIAMVANWKLSLIVLVLIPFLSLQGYAQVKL  849



>gb|KHG29119.1| ABC transporter B family member 21 [Gossypium arboreum]
Length=1285

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            +V N+A+ VAG++IAF A+W LAFII+ ++PLLG+ G++Q+R
Sbjct  841  MVSNLASAVAGLVIAFVASWQLAFIIIGLIPLLGVNGYVQIR  882



>ref|XP_010428797.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
3-like [Camelina sativa]
Length=1234

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQM  13
            L V+N+A  V+G+IIAFTANW LAFIIL +VP +G+ G++Q+
Sbjct  789  LSVKNVAAAVSGLIIAFTANWELAFIILVMVPFIGINGYIQI  830



>emb|CDY15249.1| BnaC05g01280D [Brassica napus]
Length=1270

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LAFIIL ++PL+G+ G++Q++ 
Sbjct  818  LAVQNAASAASGLIIAFTASWELAFIILVMLPLIGINGYIQVKF  861



>ref|XP_008776907.1| PREDICTED: ABC transporter B family member 9-like isoform X4 
[Phoenix dactylifera]
Length=1249

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QN+AT++AG +IA  ANW L+ I+L ++P L LQG+ Q++L
Sbjct  806  LIIQNLATIIAGFMIAMVANWKLSLIVLVLIPFLSLQGYAQVKL  849



>ref|XP_011005962.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
 ref|XP_011005963.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
Length=1291

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNIATV + +IIAFTA+W LA +IL ++PL+G+ G +Q++ 
Sbjct  847  IVQNIATVTSAMIIAFTASWQLALVILGLIPLIGINGVIQVKF  889



>ref|XP_008776905.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Phoenix dactylifera]
Length=1253

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QN+AT++AG +IA  ANW L+ I+L ++P L LQG+ Q++L
Sbjct  810  LIIQNLATIIAGFMIAMVANWKLSLIVLVLIPFLSLQGYAQVKL  853



>ref|XP_008776908.1| PREDICTED: ABC transporter B family member 9-like isoform X5 
[Phoenix dactylifera]
Length=1242

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+QN+AT++AG +IA  ANW L+ I+L ++P L LQG+ Q++L
Sbjct  799  LIIQNLATIIAGFMIAMVANWKLSLIVLVLIPFLSLQGYAQVKL  842



>ref|XP_010316891.1| PREDICTED: ABC transporter B family member 9-like isoform X1 
[Solanum lycopersicum]
Length=1251

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLYA  1
            LIVQN+AT + G+ IAFTANWIL+FIIL V+PL+   G  Q + + 
Sbjct  807  LIVQNMATALGGLAIAFTANWILSFIILVVLPLICAPGLFQTKFHK  852



>ref|XP_008383572.1| PREDICTED: ABC transporter B family member 9-like [Malus domestica]
Length=1278

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQNIAT++AG++I FTANW L  ++LA  PL+ LQG +Q + 
Sbjct  834  LIVQNIATIMAGLVIGFTANWKLMLVVLAXSPLILLQGTLQAKF  877



>ref|XP_002301550.2| hypothetical protein POPTR_0002s18850g [Populus trichocarpa]
 gb|EEE80823.2| hypothetical protein POPTR_0002s18850g [Populus trichocarpa]
Length=1275

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IVQNIATV + +IIAFTA+W LA +IL ++PL+G+ G +Q++ 
Sbjct  831  IVQNIATVTSAMIIAFTASWQLALVILGLIPLIGINGVIQVKF  873



>ref|XP_004233863.1| PREDICTED: ABC transporter B family member 9-like isoform X2 
[Solanum lycopersicum]
Length=1241

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            LIVQN+AT + G+ IAFTANWIL+FIIL V+PL+   G  Q + +
Sbjct  797  LIVQNMATALGGLAIAFTANWILSFIILVVLPLICAPGLFQTKFH  841



>gb|EMT10003.1| ABC transporter B family member 11 [Aegilops tauschii]
Length=689

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQ+IA+++AG +IAF A+W LA II  V+PLLG QG+ Q + 
Sbjct  246  LIVQSIASLIAGFVIAFMADWRLALIITCVIPLLGAQGYAQAKF  289



>gb|KDP28336.1| hypothetical protein JCGZ_14107 [Jatropha curcas]
Length=954

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNI + +AG+IIAFTA+W LAFI++ ++PL+G+ G+++++ 
Sbjct  744  LVQNIVSAIAGLIIAFTASWQLAFIVVVLIPLIGINGYVEVKF  786



>ref|XP_008223623.1| PREDICTED: ABC transporter B family member 11-like [Prunus mume]
 ref|XP_008223624.1| PREDICTED: ABC transporter B family member 11-like [Prunus mume]
Length=1293

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+V+N AT +AG+ IAF ANW LA IIL ++PLLGL G+ Q++
Sbjct  849  LLVENSATAIAGLCIAFVANWKLALIILVLMPLLGLTGYAQVK  891



>ref|XP_002275143.2| PREDICTED: ABC transporter B family member 11-like [Vitis vinifera]
 ref|XP_010649698.1| PREDICTED: ABC transporter B family member 11-like [Vitis vinifera]
 ref|XP_010649699.1| PREDICTED: ABC transporter B family member 11-like [Vitis vinifera]
Length=1294

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN A ++AG++IAF ANW ++FIIL ++PL G  G++Q++ 
Sbjct  850  LLVQNSAAMIAGLVIAFVANWKMSFIILVLLPLFGANGYVQVKF  893



>ref|XP_008441862.1| PREDICTED: ABC transporter B family member 4-like [Cucumis melo]
 ref|XP_008441863.1| PREDICTED: ABC transporter B family member 4-like [Cucumis melo]
 ref|XP_008441864.1| PREDICTED: ABC transporter B family member 4-like [Cucumis melo]
Length=1297

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +V+N+A V AG+++AF ++W LA I+LA+ PLLGL G++QM+ 
Sbjct  851  LVENLAAVTAGLVVAFVSSWQLALIVLAMFPLLGLNGYVQMKF  893



>ref|NP_171754.1| P-glycoprotein 12 [Arabidopsis thaliana]
 sp|Q9FWX8.2|AB12B_ARATH RecName: Full=ABC transporter B family member 12; Short=ABC transporter 
ABCB.12; Short=AtABCB12; AltName: Full=Multidrug 
resistance protein 16; AltName: Full=P-glycoprotein 12 [Arabidopsis 
thaliana]
 gb|AEE27441.1| P-glycoprotein 12 [Arabidopsis thaliana]
Length=1273

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LA IIL ++PL+G+ GF+Q++ 
Sbjct  827  LAVQNAASAASGLIIAFTASWELALIILVMLPLIGINGFLQVKF  870



>ref|XP_007224072.1| hypothetical protein PRUPE_ppa015389mg [Prunus persica]
 gb|EMJ25271.1| hypothetical protein PRUPE_ppa015389mg [Prunus persica]
Length=1293

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+V+N AT +AG+ IAF ANW LA IIL ++PLLGL G+ Q++
Sbjct  849  LLVENSATAIAGLCIAFVANWQLALIILVLMPLLGLTGYAQVK  891



>ref|XP_002320939.2| hypothetical protein POPTR_0014s10870g [Populus trichocarpa]
 gb|EEE99254.2| hypothetical protein POPTR_0014s10870g [Populus trichocarpa]
Length=1293

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQNIA+  AG++IAFTA W LA IIL ++PL+GL G +Q++ 
Sbjct  849  MVQNIASATAGLVIAFTACWQLALIILVLIPLVGLNGIIQIKF  891



>ref|XP_002977745.1| ATP-binding cassette transporter [Selaginella moellendorffii]
 gb|EFJ21083.1| ATP-binding cassette transporter [Selaginella moellendorffii]
Length=1246

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN +TVVAG++IAFTA+W LA ++LA+VP+L + G +Q+RL
Sbjct  804  LAVQNGSTVVAGLVIAFTADWQLALLVLAMVPVLSIVGLLQVRL  847



>gb|KHN45006.1| ABC transporter B family member 11 [Glycine soja]
Length=1267

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT V G++IAF A+W LA I+LA+ PLL L G++Q + 
Sbjct  823  LLVQNIATAVGGLVIAFEASWQLALIMLALAPLLVLNGYVQFKF  866



>ref|XP_006594001.1| PREDICTED: ABC transporter B family member 21-like [Glycine max]
Length=1267

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQNIAT V G++IAF A+W LA I+LA+ PLL L G++Q + 
Sbjct  823  LLVQNIATAVGGLVIAFEASWQLALIMLALAPLLVLNGYVQFKF  866



>ref|XP_011080373.1| PREDICTED: ABC transporter B family member 4-like isoform X2 
[Sesamum indicum]
Length=1275

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            ++VQNI+T +AG+II F A+W L+ IIL ++PL+GL G++ M+ 
Sbjct  828  ILVQNISTAIAGLIIGFGASWELSLIILVMLPLIGLNGYLHMKF  871



>gb|AAG10627.1|AC022521_5 Putative ABC transporter [Arabidopsis thaliana]
Length=1229

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LA IIL ++PL+G+ GF+Q++ 
Sbjct  783  LAVQNAASAASGLIIAFTASWELALIILVMLPLIGINGFLQVKF  826



>ref|XP_004298257.1| PREDICTED: ABC transporter B family member 11-like [Fragaria 
vesca subsp. vesca]
Length=1213

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L V N +T +AG IIAF ANW LAFI+L ++PLLG+ G+ QM +
Sbjct  769  LAVMNTSTAIAGFIIAFMANWQLAFIMLFMLPLLGISGYFQMEI  812



>ref|XP_011080370.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011080371.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Sesamum indicum]
 ref|XP_011080372.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Sesamum indicum]
Length=1281

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            ++VQNI+T +AG+II F A+W L+ IIL ++PL+GL G++ M+ 
Sbjct  834  ILVQNISTAIAGLIIGFGASWELSLIILVMLPLIGLNGYLHMKF  877



>ref|XP_006303137.1| hypothetical protein CARUB_v10008098mg, partial [Capsella rubella]
 gb|EOA36035.1| hypothetical protein CARUB_v10008098mg, partial [Capsella rubella]
Length=1325

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LA IIL ++PL+G+ GF+Q++ 
Sbjct  879  LAVQNAASAASGLIIAFTASWELALIILVMLPLIGINGFVQVKF  922



>ref|XP_002275169.3| PREDICTED: ABC transporter B family member 11-like [Vitis vinifera]
Length=1202

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQNIATV+AG+  AF ANW+LA IIL  +PL+G+ G +Q++
Sbjct  757  LVVQNIATVIAGLAAAFEANWLLALIILVFLPLIGINGCIQLQ  799



>ref|XP_011040252.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
 ref|XP_011040254.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
 ref|XP_011040261.1| PREDICTED: ABC transporter B family member 11-like [Populus euphratica]
Length=1293

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQNIA+  AG++IAFTA W LA IIL ++PL+GL G +Q++ 
Sbjct  850  VQNIASATAGLVIAFTACWQLALIILVLIPLVGLNGIIQIKF  891



>ref|XP_002519336.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF43200.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1266

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L++QN AT +AG++IAF ANW +A +IL ++PL+GL G++Q++
Sbjct  822  LLIQNTATGIAGLVIAFHANWQIALVILVLLPLMGLSGYVQLK  864



>emb|CDY48003.1| BnaA04g26870D [Brassica napus]
Length=1192

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  749  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  791



>ref|XP_009417764.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417765.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417766.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=1276

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN AT+VAG+ IAF+A W LA IILA+ PL+GL G++Q++ 
Sbjct  835  LAVQNAATLVAGLAIAFSACWQLALIILALAPLVGLNGWIQLKF  878



>ref|XP_006414519.1| hypothetical protein EUTSA_v10024241mg [Eutrema salsugineum]
 gb|ESQ55972.1| hypothetical protein EUTSA_v10024241mg [Eutrema salsugineum]
Length=1216

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLYA  1
            LIV+ I  V AG+IIAF ANW LAFI+L V P++  QG++Q +L +
Sbjct  773  LIVETITNVAAGLIIAFVANWKLAFIVLFVSPVIVFQGYLQTKLLS  818



>ref|XP_008360230.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
11-like [Malus domestica]
Length=1796

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  135   IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             +VQN+AT +AG+ IAF ANW LA  I+ ++PLLG+ G+ Q + 
Sbjct  1353  LVQNLATAIAGLHIAFVANWQLALKIIVLLPLLGVNGYFQFKF  1395



>emb|CDM83833.1| unnamed protein product [Triticum aestivum]
Length=1250

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            +IVQ+ A ++ G +IAFTA+W LA II  V+PL+G QG+ Q++ +
Sbjct  807  IIVQSTAAIITGFVIAFTADWRLALIITCVIPLVGAQGYAQVKFF  851



>gb|EMT22893.1| ABC transporter B family member 4 [Aegilops tauschii]
Length=1160

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRLY  4
            +IVQ+ A ++ G +IAFTA+W LA II  V+PL+G QG+ Q++ +
Sbjct  717  IIVQSTAAIITGFVIAFTADWRLALIITCVIPLVGAQGYAQVKFF  761



>ref|XP_002314333.2| hypothetical protein POPTR_0010s00540g [Populus trichocarpa]
 gb|EEF00504.2| hypothetical protein POPTR_0010s00540g [Populus trichocarpa]
Length=1293

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            ++VQN+ T V  + IAF A W LAFI+LAV+PLLG+ GF+Q + 
Sbjct  848  MLVQNLGTAVVALFIAFQACWQLAFIMLAVLPLLGVNGFIQQKF  891



>ref|XP_009417767.1| PREDICTED: ABC transporter B family member 21-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=1187

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN AT+VAG+ IAF+A W LA IILA+ PL+GL G++Q++ 
Sbjct  835  LAVQNAATLVAGLAIAFSACWQLALIILALAPLVGLNGWIQLKF  878



>ref|XP_010271028.1| PREDICTED: ABC transporter B family member 21-like [Nelumbo nucifera]
Length=1305

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN AT +AG+IIAF ANW LA I LA++P++G  G++Q + 
Sbjct  860  LVQNTATAIAGLIIAFEANWQLALIFLALLPMIGTNGWIQTKF  902



>gb|EMS48422.1| ABC transporter B family member 4 [Triticum urartu]
Length=1125

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQ I+T+V GV+IA  A+W LAFII+ V+PL+G+QG+  ++ 
Sbjct  679  LMVQIISTLVTGVVIAMIADWKLAFIIICVIPLVGIQGYANVKF  722



>ref|XP_002979534.1| hypothetical protein SELMODRAFT_177681 [Selaginella moellendorffii]
 gb|EFJ19423.1| hypothetical protein SELMODRAFT_177681 [Selaginella moellendorffii]
Length=1245

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN +TVVAG++IAFTA+W LA +IL +VP+L + G +Q+RL
Sbjct  803  LAVQNGSTVVAGLVIAFTADWQLALLILGMVPVLSIVGLLQVRL  846



>ref|XP_009142463.1| PREDICTED: ABC transporter B family member 4 [Brassica rapa]
 ref|XP_009142464.1| PREDICTED: ABC transporter B family member 4 [Brassica rapa]
 ref|XP_009142465.1| PREDICTED: ABC transporter B family member 4 [Brassica rapa]
 ref|XP_009142466.1| PREDICTED: ABC transporter B family member 4 [Brassica rapa]
Length=1287

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  844  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  886



>ref|XP_009363069.1| PREDICTED: ABC transporter B family member 11 [Pyrus x bretschneideri]
 ref|XP_009363070.1| PREDICTED: ABC transporter B family member 11 [Pyrus x bretschneideri]
Length=1296

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV +IAT +AG++IAF   W LAFIILA++PL+G+ G++Q + 
Sbjct  852  IVNSIATAIAGLVIAFITCWQLAFIILALIPLIGVNGYVQAKF  894



>gb|KFK30733.1| hypothetical protein AALP_AA6G020200 [Arabis alpina]
Length=3091

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             L V+N A+ V+G+IIAF A+W LA IIL ++PL+G+ G++Q++ 
Sbjct  1547  LSVKNAASAVSGLIIAFAASWRLALIILVMIPLIGINGYLQIKF  1590


 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138   LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
             L V+N A+ V G+IIAF+A+W +A IIL ++PL G+ G++Q++L
Sbjct  2646  LSVKNTASAVTGMIIAFSASWEVAVIILVMIPLTGINGYVQLKL  2689



>emb|CDX80072.1| BnaA05g00840D [Brassica napus]
Length=1198

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  755  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  797



>ref|XP_006397891.1| hypothetical protein EUTSA_v10001285mg [Eutrema salsugineum]
 gb|ESQ39344.1| hypothetical protein EUTSA_v10001285mg [Eutrema salsugineum]
Length=1287

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  844  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  886



>ref|XP_008353913.1| PREDICTED: ABC transporter B family member 11-like [Malus domestica]
Length=960

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV +IAT +AG+IIAF A+W LA I+LA++PL+G  G++Q + 
Sbjct  516  IVNSIATGIAGLIIAFIASWQLALIVLALIPLIGFGGYVQAKF  558



>gb|KDO72233.1| hypothetical protein CISIN_1g040099mg [Citrus sinensis]
Length=1236

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQN AT V G++IAF A W LA ++LA+ PLLG+ G +QM+
Sbjct  811  LLVQNTATAVVGLVIAFKACWQLALLVLAIFPLLGITGHIQMK  853



>ref|XP_003567026.1| PREDICTED: ABC transporter B family member 4-like isoform X2 
[Brachypodium distachyon]
Length=1262

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQ I+T++ G IIA  A+W L+FIIL V+PL+GLQG+ Q++ 
Sbjct  819  LTVQIISTLITGFIIAVVADWKLSFIILCVIPLVGLQGYAQVKF  862



>emb|CDY27510.1| BnaC04g51510D [Brassica napus]
Length=1199

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  756  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  798



>ref|XP_009142574.1| PREDICTED: ABC transporter B family member 4 [Brassica rapa]
Length=1284

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  841  MVQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  883



>ref|XP_010999324.1| PREDICTED: ABC transporter B family member 4-like [Populus euphratica]
Length=1292

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            ++VQ++ T V  ++IAF A+W LAFI+LA++PLLG+ GF+Q + 
Sbjct  847  MLVQSLGTAVVALLIAFQASWQLAFIMLALLPLLGINGFIQQKF  890



>ref|XP_010232190.1| PREDICTED: ABC transporter B family member 4-like isoform X1 
[Brachypodium distachyon]
Length=1288

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQ I+T++ G IIA  A+W L+FIIL V+PL+GLQG+ Q++ 
Sbjct  845  LTVQIISTLITGFIIAVVADWKLSFIILCVIPLVGLQGYAQVKF  888



>ref|XP_009353437.1| PREDICTED: ABC transporter B family member 11-like [Pyrus x bretschneideri]
Length=1280

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L+VQN+AT +AG+ IAF ANW L  II+ ++PL G+ G+ Q + 
Sbjct  847  LVVQNLATAIAGLHIAFVANWQLTLIIIVLLPLFGVNGYFQFKF  890



>ref|XP_006418332.1| hypothetical protein EUTSA_v10006577mg [Eutrema salsugineum]
 gb|ESQ36685.1| hypothetical protein EUTSA_v10006577mg [Eutrema salsugineum]
Length=1283

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN A+  +G+IIAFTA+W LA IIL ++PL+G+ G++Q++ 
Sbjct  837  LAVQNAASAASGLIIAFTASWELALIILVMLPLIGINGYIQVKF  880



>ref|XP_010457237.1| PREDICTED: ABC transporter B family member 11 isoform X2 [Camelina 
sativa]
Length=1287

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+A+  +G+IIAFTA W LA IIL ++PL+G+ G++Q++ 
Sbjct  841  LAVQNVASAASGLIIAFTACWELALIILVMLPLIGINGYVQVKF  884



>ref|XP_010457236.1| PREDICTED: ABC transporter B family member 11 isoform X1 [Camelina 
sativa]
Length=1293

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            L VQN+A+  +G+IIAFTA W LA IIL ++PL+G+ G++Q++ 
Sbjct  841  LAVQNVASAASGLIIAFTACWELALIILVMLPLIGINGYVQVKF  884



>ref|XP_007214672.1| hypothetical protein PRUPE_ppa020815mg [Prunus persica]
 gb|EMJ15871.1| hypothetical protein PRUPE_ppa020815mg [Prunus persica]
Length=1252

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV++IAT  AG+ I FTA W LAFI+LA++PL+G+ G++Q + 
Sbjct  808  IVESIATAAAGLFIGFTACWQLAFILLALIPLIGINGYVQAKF  850



>ref|XP_007213163.1| hypothetical protein PRUPE_ppa026713mg [Prunus persica]
 gb|EMJ14362.1| hypothetical protein PRUPE_ppa026713mg [Prunus persica]
Length=1252

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  135  IVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            IV++IAT  AG+ I FTA W LAFI+LA++PL+G+ G++Q + 
Sbjct  808  IVESIATAAAGLFIGFTACWQLAFILLALIPLIGINGYVQAKF  850



>gb|EMS56139.1| ABC transporter B family member 4 [Triticum urartu]
Length=1255

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQ+ A ++ G +IAFTA+W LA II  V+PL+G QG+ Q++ 
Sbjct  812  LIVQSTAALITGFVIAFTADWRLALIITCVIPLVGAQGYAQVKF  855



>ref|XP_002882100.1| P-glycoprotein 4, P-glycoprotein4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58359.1| P-glycoprotein 4, P-glycoprotein4 [Arabidopsis lyrata subsp. 
lyrata]
Length=1286

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  844  VQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  885



>ref|NP_182223.1| auxin efflux transmembrane transporter MDR4 [Arabidopsis thaliana]
 sp|O80725.1|AB4B_ARATH RecName: Full=ABC transporter B family member 4; Short=ABC transporter 
ABCB.4; Short=AtABCB4; AltName: Full=Multidrug resistance 
protein 4; AltName: Full=P-glycoprotein 4 [Arabidopsis 
thaliana]
 gb|AAC34225.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC10785.1| auxin efflux transmembrane transporter MDR4 [Arabidopsis thaliana]
Length=1286

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+++++AG+IIAF A W LAF++LA++PL+ L GF+ M+ 
Sbjct  844  VQNLSSILAGLIIAFLACWQLAFVVLAMLPLIALNGFLYMKF  885



>ref|XP_006488718.1| PREDICTED: ABC transporter B family member 11-like [Citrus sinensis]
Length=1218

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L+VQN AT V G++IAF A W LA ++LA+ PLLG+ G +QM+
Sbjct  778  LLVQNTATAVVGLVIAFKACWQLALLVLAIFPLLGITGHIQMK  820



>ref|XP_010424672.1| PREDICTED: ABC transporter B family member 3 [Camelina sativa]
Length=1248

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQM  13
            L V+N+A  V+G+IIAFTANW LA IIL ++PL G+ G++Q+
Sbjct  803  LSVKNVAAAVSGLIIAFTANWELAVIILVMIPLTGINGYVQI  844



>ref|XP_003569618.2| PREDICTED: ABC transporter B family member 11-like [Brachypodium 
distachyon]
Length=1309

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            +IVQ+IAT++ G  IAF+A+W LA +I  V+PL+G QG+ Q++ 
Sbjct  866  IIVQSIATLITGFAIAFSADWRLALVITCVIPLVGAQGYAQVKF  909



>gb|EMT32504.1| ABC transporter B family member 4 [Aegilops tauschii]
Length=1302

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQ+ A ++ G +IAFTA+W LA II  V+PL+G QG+ Q++ 
Sbjct  860  LIVQSTAALITGFVIAFTADWRLALIITCVIPLVGAQGYAQVKF  903



>ref|XP_002458359.1| hypothetical protein SORBIDRAFT_03g032000 [Sorghum bicolor]
 gb|EES03479.1| hypothetical protein SORBIDRAFT_03g032000 [Sorghum bicolor]
Length=1219

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LI+Q+IAT+  G +IAF A+W LA II  V+PL+G QG+ Q++ 
Sbjct  773  LIMQSIATLTTGFVIAFAADWRLALIITCVIPLVGAQGYAQVKF  816



>dbj|BAB85651.1| multidrug resistance protein 1 homolog [Triticum aestivum]
Length=1262

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            LIVQ+ A ++ G +IAFTA+W LA II  V+PL+G QG+ Q++ 
Sbjct  820  LIVQSTAALITGFVIAFTADWRLALIITCVIPLVGAQGYAQVKF  863



>gb|AEY84034.1| ABCB2, partial [Triticum aestivum]
Length=78

 Score = 48.9 bits (115),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  138  LIVQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMR  10
            L VQ I+T++ G +IA  A+W L+ IIL V+PL+GLQG+ Q++
Sbjct  1    LTVQIISTLITGFVIAMIADWKLSLIILCVIPLVGLQGYAQVK  43



>ref|XP_010507941.1| PREDICTED: ABC transporter B family member 4-like [Camelina sativa]
 ref|XP_010507942.1| PREDICTED: ABC transporter B family member 4-like [Camelina sativa]
 ref|XP_010507943.1| PREDICTED: ABC transporter B family member 4-like [Camelina sativa]
Length=1286

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+++++AG+IIAF A W L+F++LA++PL+ L GF+ M+ 
Sbjct  844  VQNLSSILAGLIIAFLACWQLSFVVLAMLPLIALNGFLYMKF  885



>ref|XP_010518387.1| PREDICTED: ABC transporter B family member 4 [Camelina sativa]
 ref|XP_010518388.1| PREDICTED: ABC transporter B family member 4 [Camelina sativa]
 ref|XP_010518389.1| PREDICTED: ABC transporter B family member 4 [Camelina sativa]
Length=1286

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  132  VQNIATVVAGVIIAFTANWILAFIILAVVPLLGLQGFMQMRL  7
            VQN+++++AG+IIAF A W L+F++LA++PL+ L GF+ M+ 
Sbjct  844  VQNLSSILAGLIIAFLACWQLSFVVLAMLPLIALNGFLYMKF  885



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522019619212