BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46407_g1_i1 len=894 path=[1:0-893]

Length=894
                                                                      Score     E

ref|XP_009627635.1|  PREDICTED: uncharacterized protein LOC104118150  86.3    5e-17   
gb|AGJ98242.1|  PIG93                                                 80.9    7e-16   
ref|XP_009782717.1|  PREDICTED: uncharacterized protein LOC104231417  81.6    2e-15   
ref|XP_004495224.1|  PREDICTED: uncharacterized protein LOC101511533  81.3    3e-15   
ref|XP_006604424.1|  PREDICTED: uncharacterized protein LOC102669806  79.0    2e-14   
ref|XP_007162405.1|  hypothetical protein PHAVU_001G149300g           78.2    3e-14   
ref|XP_006576887.1|  PREDICTED: uncharacterized protein LOC102666530  77.0    7e-14   
ref|XP_007144613.1|  hypothetical protein PHAVU_007G170000g           76.6    7e-14   
ref|XP_006355869.1|  PREDICTED: uncharacterized protein LOC102579338  77.0    9e-14   
ref|XP_004247316.1|  PREDICTED: uncharacterized protein LOC101258484  76.3    1e-13   
ref|XP_006352782.1|  PREDICTED: UBX domain-containing protein 11-...  76.3    2e-13   
ref|XP_006444119.1|  hypothetical protein CICLE_v10024447mg           75.5    3e-13   
emb|CBI32355.3|  unnamed protein product                              74.3    3e-13   
gb|KDO68789.1|  hypothetical protein CISIN_1g044805mg                 74.7    4e-13   
gb|KEH23735.1|  Lipid transfer protein-like protein                   75.1    5e-13   
ref|XP_004493654.1|  PREDICTED: uncharacterized protein LOC101500505  74.7    6e-13   
ref|XP_008235264.1|  PREDICTED: protein catecholamines up             73.9    8e-13   
ref|XP_010652136.1|  PREDICTED: zinc transporter 7-B                  74.3    8e-13   
emb|CAN64249.1|  hypothetical protein VITISV_032977                   74.3    8e-13   Vitis vinifera
ref|XP_009778780.1|  PREDICTED: uncharacterized protein LOC104228079  73.9    9e-13   
ref|XP_010545083.1|  PREDICTED: RNA-binding protein 33-like           74.3    1e-12   
ref|XP_011079821.1|  PREDICTED: histidine-rich membrane protein K...  74.3    1e-12   
emb|CDP03605.1|  unnamed protein product                              73.2    3e-12   
ref|XP_008386520.1|  PREDICTED: uncharacterized protein LOC103449030  72.4    3e-12   
ref|XP_003637691.1|  AAA ATPase containing von Willebrand factor ...  72.8    3e-12   
ref|XP_011082636.1|  PREDICTED: uncharacterized protein LOC105165355  72.0    4e-12   
ref|NP_001078333.1|  protease inhibitor/seed storage/LTP family p...  73.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050664.1|  Tetratricopeptide repeat-like superfamily pr...  71.6    6e-12   
ref|XP_010039258.1|  PREDICTED: proline-rich protein 13-like          72.0    7e-12   
ref|XP_007199171.1|  hypothetical protein PRUPE_ppa021373mg           71.6    8e-12   
gb|KCW49923.1|  hypothetical protein EUGRSUZ_K03387                   72.0    8e-12   
ref|XP_009356752.1|  PREDICTED: transcription cofactor vestigial-...  72.0    9e-12   
ref|XP_010090376.1|  hypothetical protein L484_025041                 71.2    9e-12   
ref|XP_010316744.1|  PREDICTED: uncharacterized protein LOC104645827  71.2    1e-11   
gb|KDP21489.1|  hypothetical protein JCGZ_21960                       70.5    1e-11   
ref|XP_009104413.1|  PREDICTED: histidine-rich glycoprotein-like      72.8    1e-11   
ref|XP_004136185.1|  PREDICTED: uncharacterized protein LOC101206671  70.9    1e-11   
emb|CDY63338.1|  BnaA09g55630D                                        72.0    1e-11   
ref|XP_010468887.1|  PREDICTED: probable zinc transporter protein...  72.4    1e-11   
emb|CDX67917.1|  BnaA07g19570D                                        72.4    1e-11   
ref|XP_010413198.1|  PREDICTED: nonsense-mediated mRNA decay prot...  72.4    1e-11   
ref|XP_010512716.1|  PREDICTED: histidine-rich glycoprotein-like      72.4    1e-11   
ref|XP_008368867.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  70.9    2e-11   
emb|CDX79421.1|  BnaC06g18820D                                        71.6    2e-11   
ref|XP_009116975.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...  72.0    2e-11   
ref|XP_002533067.1|  conserved hypothetical protein                   69.7    3e-11   Ricinus communis
gb|EPS59564.1|  hypothetical protein M569_15243                       69.7    3e-11   
gb|KFK35474.1|  hypothetical protein AALP_AA5G288900                  70.9    5e-11   
emb|CDY64155.1|  BnaCnng43330D                                        72.4    7e-11   
ref|XP_002320394.1|  hypothetical protein POPTR_0014s13520g           68.6    8e-11   Populus trichocarpa [western balsam poplar]
gb|EAZ04978.1|  hypothetical protein OsI_27158                        68.2    9e-11   Oryza sativa Indica Group [Indian rice]
emb|CDX93936.1|  BnaC04g20950D                                        70.1    9e-11   
gb|EYU38143.1|  hypothetical protein MIMGU_mgv1a015131mg              68.6    1e-10   
emb|CDX89172.1|  BnaA04g00140D                                        70.1    1e-10   
ref|XP_011007542.1|  PREDICTED: uncharacterized protein LOC105113180  67.8    1e-10   
ref|XP_008451383.1|  PREDICTED: protein FAM76B                        67.8    1e-10   
gb|EYU46609.1|  hypothetical protein MIMGU_mgv1a014816mg              68.2    2e-10   
gb|EEE67730.1|  hypothetical protein OsJ_25410                        68.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ACG37671.1|  aspartic acid-rich protein                            67.0    3e-10   Zea mays [maize]
ref|XP_011033686.1|  PREDICTED: metal tolerance protein 1-like        66.6    4e-10   
ref|NP_001060499.1|  Os07g0655800                                     68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140718.1|  uncharacterized protein LOC100272793 precursor   68.2    6e-10   Zea mays [maize]
ref|NP_001150311.1|  AAA ATPase containing von Willebrand factor ...  68.2    7e-10   Zea mays [maize]
ref|XP_010256204.1|  PREDICTED: uncharacterized protein LOC104596643  64.7    2e-09   
ref|XP_002302826.1|  hypothetical protein POPTR_0002s22550g           64.3    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010684244.1|  PREDICTED: uncharacterized protein LOC104898831  63.9    4e-09   
gb|KHN18894.1|  hypothetical protein glysoja_028263                   63.5    5e-09   
ref|XP_006658907.1|  PREDICTED: protein PFC0760c-like                 64.3    5e-09   
ref|NP_001158897.1|  AAA ATPase containing von Willebrand factor ...  65.1    7e-09   Zea mays [maize]
ref|NP_001149735.1|  AAA ATPase containing von Willebrand factor ...  65.1    7e-09   Zea mays [maize]
ref|NP_001050142.1|  Os03g0357500                                     64.7    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465242.1|  hypothetical protein SORBIDRAFT_01g034880        64.7    1e-08   Sorghum bicolor [broomcorn]
gb|EEC75289.1|  hypothetical protein OsI_11632                        63.5    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002463297.1|  hypothetical protein SORBIDRAFT_02g041423        62.0    1e-08   Sorghum bicolor [broomcorn]
ref|NP_001152240.1|  aspartic acid-rich protein precursor             63.9    1e-08   Zea mays [maize]
ref|XP_004984320.1|  PREDICTED: protein PFC0760c-like                 64.3    1e-08   
ref|NP_001140990.1|  aspartic acid-rich protein precursor             63.9    2e-08   Zea mays [maize]
ref|XP_003557893.1|  PREDICTED: sarcoplasmic reticulum histidine-...  63.9    2e-08   
ref|XP_006375480.1|  hypothetical protein POPTR_0014s13530g           60.8    2e-08   
gb|KHN03781.1|  hypothetical protein glysoja_011010                   61.6    2e-08   
ref|XP_011033687.1|  PREDICTED: uncharacterized protein LOC105132093  61.2    3e-08   
ref|XP_010524012.1|  PREDICTED: pleckstrin homology-like domain f...  60.8    8e-08   
ref|XP_006651394.1|  PREDICTED: probable serine/threonine-protein...  58.2    3e-07   
ref|XP_002305616.2|  hypothetical protein POPTR_0004s02190g           57.0    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004958535.1|  PREDICTED: guanine nucleotide-binding protei...  60.1    5e-07   
ref|XP_008776443.1|  PREDICTED: protein catecholamines up-like        57.8    8e-07   
gb|EMT17194.1|  Putative pectinesterase 66                            59.7    9e-07   
dbj|BAK07112.1|  predicted protein                                    58.5    1e-06   
ref|XP_010942492.1|  PREDICTED: uncharacterized protein LOC105060474  52.8    3e-05   
ref|XP_010242431.1|  PREDICTED: protein catecholamines up-like        53.1    4e-05   
ref|XP_006850779.1|  hypothetical protein AMTR_s00025p00092990        49.3    5e-04   



>ref|XP_009627635.1| PREDICTED: uncharacterized protein LOC104118150 [Nicotiana tomentosiformis]
Length=159

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 86/147 (59%), Gaps = 10/147 (7%)
 Frame = +3

Query  267  FLLAFVFILCSAAVGQTHW----KAVVRPVGSRCASQISLVNHACsflmlsstpppmppr  434
             +L  VF++   +  ++ W      V RP+   CASQ +LVNHACS L  +  PPP PP 
Sbjct  9    IVLIVVFLVLHPSGSRSQWVPQPPIVTRPL---CASQFALVNHACSLLPYTPGPPPSPPL  65

Query  435  ppllsppAVDQAMPlgrhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPF  614
            PP   P          R  R    R   H  +P EE CC+WMK+VD+ C+CD+  +LPPF
Sbjct  66   PPPSPPSPPPPP---ERRHRHRHGRRHVHKETPIEEECCRWMKQVDSECICDLLVHLPPF  122

Query  615  LARPLHQYTVMVGESCFQTFQCGSVIR  695
            L+RP+HQYTV+V  SC  TF+CGS I+
Sbjct  123  LSRPVHQYTVVVDASCNVTFECGSRIK  149



>gb|AGJ98242.1| PIG93, partial [Petunia x hybrida]
Length=79

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRSNN  704
            +P EE CC+WMK VD+ CVC + A LPPFL+RPLHQYT +V  SC  TF C S IR  N
Sbjct  14   TPVEEECCRWMKTVDSECVCGLLAQLPPFLSRPLHQYTAVVDASCSVTFMCSSRIRVEN  72



>ref|XP_009782717.1| PREDICTED: uncharacterized protein LOC104231417 [Nicotiana sylvestris]
Length=160

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = +3

Query  330  VVRPVGSRCASQISLVNHACsflmlsstpppmpprppllsppAVDQAMPlgrhrrgglrr  509
            V RP+   CASQ +LVNHACS L  +  PPP PP PP   P          R  R    R
Sbjct  35   VTRPL---CASQFTLVNHACSLLPYTPGPPPSPPSPPPPPPSPPSPP---ERRHRHKHGR  88

Query  510  hrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            H  H  +P EE CC+WMK+VD+ CVCD+  +LPPFL+RP+HQY V+V  SC  TF+CGS 
Sbjct  89   HHVHKETPVEEECCRWMKQVDSECVCDLLVHLPPFLSRPVHQYNVVVDSSCNVTFECGSR  148

Query  690  IR  695
            I+
Sbjct  149  IK  150



>ref|XP_004495224.1| PREDICTED: uncharacterized protein LOC101511533 [Cicer arietinum]
Length=173

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            S EE+ CC+W KE+D+RCVC++   LPPFL RPLHQY+V++GESC  T+ CG  I
Sbjct  119  STEEDNCCRWAKEMDSRCVCEILVRLPPFLTRPLHQYSVVIGESCVITYSCGGPI  173



>ref|XP_006604424.1| PREDICTED: uncharacterized protein LOC102669806 [Glycine max]
 gb|KHN45369.1| hypothetical protein glysoja_028376 [Glycine soja]
Length=155

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            +E+ CC+W KEVDN+CVC++   LPPFL RPLHQYT+ VGESC  T+ CG+ I
Sbjct  103  DEDNCCRWAKEVDNQCVCELLLRLPPFLIRPLHQYTLNVGESCDITYSCGAPI  155



>ref|XP_007162405.1| hypothetical protein PHAVU_001G149300g [Phaseolus vulgaris]
 gb|ESW34399.1| hypothetical protein PHAVU_001G149300g [Phaseolus vulgaris]
Length=151

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 72/131 (55%), Gaps = 4/131 (3%)
 Frame = +3

Query  312  QTHWKAVVRPVGSR----CASQISLVNHACsflmlsstpppmpprppllsppAVDQAMPl  479
            ++H +  + PV       CASQ +LVN+ACS L  S    P  P  P       ++    
Sbjct  21   ESHIRPPLIPVSKAPRPLCASQFALVNYACSRLPFSPGVQPDSPPSPDEEEGHGERHQNH  80

Query  480  grhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGES  659
                         HH +PEE  CC+W KEVD++CVC++  +LPPFL RP+HQYT+ +G++
Sbjct  81   THRHGHRHGHSHRHHQTPEENNCCRWAKEVDSQCVCEILVHLPPFLIRPVHQYTLNIGDA  140

Query  660  CFQTFQCGSVI  692
            C  T+ CG+ I
Sbjct  141  CDVTYSCGAPI  151



>ref|XP_006576887.1| PREDICTED: uncharacterized protein LOC102666530 [Glycine max]
 gb|KHN19876.1| hypothetical protein glysoja_033508 [Glycine soja]
Length=144

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 72/140 (51%), Gaps = 4/140 (3%)
 Frame = +3

Query  273  LAFVFILCSAAVGQTHWKAVVRPVGSRCASQISLVNHACsflmlsstpppmpprppllsp  452
            LA    L      ++  K + +     CASQ +LVN+ACS L  S   PP  P P   + 
Sbjct  9    LALTLFLAIVPKMESQIKPIPKTPRPLCASQFALVNYACSRLPFSPGVPPDSPSPDEEN-  67

Query  453  pAVDQAMPlgrhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLH  632
               +                  HH +P+E+ CC+W KEVD++CVC++   LPPFL RP H
Sbjct  68   ---NNHHNRSHRHGHRHGHRHRHHQTPDEDNCCRWAKEVDHQCVCELLLRLPPFLIRPSH  124

Query  633  QYTVMVGESCFQTFQCGSVI  692
            QYT+ VG SC  T+ CG+ I
Sbjct  125  QYTLKVGASCDITYSCGAPI  144



>ref|XP_007144613.1| hypothetical protein PHAVU_007G170000g [Phaseolus vulgaris]
 gb|ESW16607.1| hypothetical protein PHAVU_007G170000g [Phaseolus vulgaris]
Length=136

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            +E CC+W KE+D +CVC++   LPPFL +PLHQY++M+GESC  T+ CG  I
Sbjct  85   QENCCRWAKEIDTQCVCEVLVRLPPFLTKPLHQYSIMIGESCNVTYSCGGPI  136



>ref|XP_006355869.1| PREDICTED: uncharacterized protein LOC102579338 [Solanum tuberosum]
Length=158

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            S  EE CC+WMK+VD+ CVCD+   LP FL+RPLHQYT+MV   C  TF+CGS
Sbjct  94   SSAEENCCRWMKQVDSECVCDLLVRLPLFLSRPLHQYTIMVDPGCNITFECGS  146



>ref|XP_004247316.1| PREDICTED: uncharacterized protein LOC101258484 [Solanum lycopersicum]
Length=155

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            S  EE CC+WMK+VDN CVCD+   LP FL+RP+HQYT++V   C  TF+CGS
Sbjct  91   SSAEENCCRWMKQVDNECVCDLLVRLPLFLSRPVHQYTILVDPGCNITFECGS  143



>ref|XP_006352782.1| PREDICTED: UBX domain-containing protein 11-like [Solanum tuberosum]
Length=174

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            +P EE CC+WMK VD+ CVC + A+LP FLARP+HQYT +   +C  TF CGS  R
Sbjct  106  TPAEEECCRWMKAVDSECVCSLLAHLPTFLARPIHQYTTLAHATCSVTFTCGSSAR  161



>ref|XP_006444119.1| hypothetical protein CICLE_v10024447mg [Citrus clementina]
 ref|XP_006479752.1| PREDICTED: uncharacterized protein LOC102623449 [Citrus sinensis]
 gb|ESR57359.1| hypothetical protein CICLE_v10024447mg [Citrus clementina]
Length=160

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            +PE E CC+W+K+VD+ CVCD+   LP FLARP+H YTV+V ESC  T+ C   +R
Sbjct  104  TPEGESCCRWLKQVDDECVCDLLVRLPVFLARPVHTYTVIVDESCNVTYACSGRLR  159



>emb|CBI32355.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            S  EE CC+W+KE+D+ CVCD+ A+LP FL RP H YTV V  SC  TF CG  +R+
Sbjct  57   SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLRA  113



>gb|KDO68789.1| hypothetical protein CISIN_1g044805mg [Citrus sinensis]
Length=139

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            +PE E CC+W+K+VD+ CVCD+   LP FLARP+H YTV+V ESC  T+ C   +R
Sbjct  83   TPEGESCCRWLKQVDDECVCDLLVRLPVFLARPVHTYTVIVDESCNVTYACSGRLR  138



>gb|KEH23735.1| Lipid transfer protein-like protein [Medicago truncatula]
Length=171

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            E+E CC+W +EVDN+CVC++   LPPFL RPLH YT+ +GE C  T+ CG  I
Sbjct  119  EQENCCRWAREVDNQCVCELLVRLPPFLVRPLHLYTLNIGEDCEITYSCGGPI  171



>ref|XP_004493654.1| PREDICTED: uncharacterized protein LOC101500505 [Cicer arietinum]
Length=161

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            +PEE+ CC+W +EVD++CVC++   LPPFL RPLH YT+ +G+ C  T+ CG  I
Sbjct  107  TPEEDNCCRWAREVDSQCVCELLVRLPPFLVRPLHVYTLAIGDDCEITYSCGGPI  161



>ref|XP_008235264.1| PREDICTED: protein catecholamines up [Prunus mume]
Length=149

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            SP E+ CC+W+ ++DN CVC++  +LP FL +P H YTV VGESC  T+ CG+ IR
Sbjct  91   SPAEDNCCRWLTQLDNECVCELLVHLPTFLLKPTHAYTVTVGESCRVTYTCGTPIR  146



>ref|XP_010652136.1| PREDICTED: zinc transporter 7-B [Vitis vinifera]
Length=160

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            S  EE CC+W+KE+D+ CVCD+ A+LP FL RP H YTV V  SC  TF CG  +R+
Sbjct  104  SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLRA  160



>emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera]
Length=160

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            S  EE CC+W+KE+D+ CVCD+ A+LP FL RP H YTV V  SC  TF CG  +R+
Sbjct  104  SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLRA  160



>ref|XP_009778780.1| PREDICTED: uncharacterized protein LOC104228079 [Nicotiana sylvestris]
Length=150

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRSNN  704
            CC+WMK +D+ CVC + A+LPPFL++P+HQYT +V  SC  TF+C S IR  N
Sbjct  91   CCRWMKSIDSECVCALLAHLPPFLSKPIHQYTAVVDASCSVTFKCSSRIRYEN  143



>ref|XP_010545083.1| PREDICTED: RNA-binding protein 33-like [Tarenaya hassleriana]
Length=179

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            E  CC+W+K++DN CVCD+  +LPP LARP+H YTV V ESC  TF CG 
Sbjct  126  EAECCKWLKQMDNECVCDLLVHLPPLLARPVHNYTVFVDESCIVTFICGG  175



>ref|XP_011079821.1| PREDICTED: histidine-rich membrane protein KE4 homolog 1 [Sesamum 
indicum]
Length=176

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            EE CC+W+KEVD+ CVC++  +LPPFL RP+H YTV V ++C  TF CGS
Sbjct  122  EEDCCRWLKEVDDVCVCELLVHLPPFLTRPVHNYTVGVDDTCNITFTCGS  171



>emb|CDP03605.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            +P E  CC W+  +D+ CVCD+   LPPFL+RP+H+YTV V +SC  TFQC S I +
Sbjct  129  TPVEASCCHWLGTIDSECVCDLLVYLPPFLSRPVHEYTVSVKDSCNVTFQCASRITT  185



>ref|XP_008386520.1| PREDICTED: uncharacterized protein LOC103449030 [Malus domestica]
Length=139

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  531  PEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            P E+ CC+W+ ++DN+CVC++ A+LP FL RP H Y+V++GE+C  T+ CG+ +R
Sbjct  82   PAEDNCCRWLTQLDNQCVCELLAHLPNFLVRPAHVYSVVIGETCTVTYTCGTPVR  136



>ref|XP_003637691.1| AAA ATPase containing von Willebrand factor type A [Medicago 
truncatula]
 gb|KEH40590.1| hypothetical protein MTR_1g032050 [Medicago truncatula]
 gb|KEH40619.1| hypothetical protein MTR_1g032400 [Medicago truncatula]
Length=156

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            +E+ CC+W + +D+RCVC++   LPPFL RPLH Y+V+ GESC  T+ CG  I
Sbjct  104  QEDNCCRWARALDSRCVCEILVRLPPFLIRPLHTYSVVFGESCTVTYSCGGPI  156



>ref|XP_011082636.1| PREDICTED: uncharacterized protein LOC105165355 [Sesamum indicum]
Length=139

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
             EE CC+W+KEVDN CVCD+  +LP FL RP+H Y V+V ++C   F+CGS
Sbjct  84   REEECCRWLKEVDNACVCDVLLHLPSFLTRPVHNYVVIVDDTCDVKFECGS  134



>ref|NP_001078333.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE80435.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
Length=250

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            CC+W+K++DN CVCD+   LPP LA+P+H YTV V ESC  TF CG  + S
Sbjct  200  CCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRLIS  250



>ref|XP_007050664.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOX94821.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=150

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (50%), Gaps = 2/143 (1%)
 Frame = +3

Query  264  PFLLAFVFILCSAAVGQTHWKAVVRPVGSRCASQISLVNHACsflmlsstpppmpprppl  443
            P L  F   L +     +     + P    CA+Q +LVN+AC+ +     PP  PP PP 
Sbjct  7    PTLFLFTIFLVALPKTLSQLPRSIPPPRPLCATQFALVNYACARVSFFPLPPRTPPPPPP  66

Query  444  lsppAVDQAMPlgrhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLAR  623
              P    Q            R     H +P+   CC+W+KEVD+ CVC++  +LP FL+R
Sbjct  67   SPPSPEGQKH--EHRHGHRHRHRHVPHETPDLHNCCRWLKEVDHECVCEVLVHLPVFLSR  124

Query  624  PLHQYTVMVGESCFQTFQCGSVI  692
            P H YTV+V E+C  TF CG  I
Sbjct  125  PNHDYTVIVDETCSHTFTCGGRI  147



>ref|XP_010039258.1| PREDICTED: proline-rich protein 13-like [Eucalyptus grandis]
Length=191

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            SP E+ CC+W+KEVD+ CVCD+   LP FL RP+H YTV V + C  TF CG
Sbjct  135  SPAEQDCCKWLKEVDSECVCDLLVRLPSFLTRPIHVYTVTVPDLCNVTFSCG  186



>ref|XP_007199171.1| hypothetical protein PRUPE_ppa021373mg, partial [Prunus persica]
 gb|EMJ00370.1| hypothetical protein PRUPE_ppa021373mg, partial [Prunus persica]
Length=156

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            SP E+ CC+W+ ++DN CVC++  +LP FL +P H YTV VGE C  T+ CG+ IR
Sbjct  98   SPAEDNCCRWLTQLDNECVCELLVHLPTFLLKPTHAYTVAVGEFCRVTYTCGTPIR  153



>gb|KCW49923.1| hypothetical protein EUGRSUZ_K03387 [Eucalyptus grandis]
Length=182

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            SP E+ CC+W+KEVD+ CVCD+   LP FL RP+H YTV V + C  TF CG
Sbjct  126  SPAEQDCCKWLKEVDSECVCDLLVRLPSFLTRPIHVYTVTVPDLCNVTFSCG  177



>ref|XP_009356752.1| PREDICTED: transcription cofactor vestigial-like protein 3 [Pyrus 
x bretschneideri]
Length=205

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  531  PEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            P E+ CC+W+ ++DN+CVC++  +LP FL RP H Y+V++GE+C  T+ CG+ IR
Sbjct  148  PAEDNCCRWLTQLDNQCVCELLVHLPNFLVRPAHVYSVVIGETCTVTYTCGTPIR  202



>ref|XP_010090376.1| hypothetical protein L484_025041 [Morus notabilis]
 gb|EXB39346.1| hypothetical protein L484_025041 [Morus notabilis]
Length=156

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS-VIRS  698
            EE+ CC+W+ E+D  CVC+M  +LP FL+RP+H+Y+++VG++C  T+ CG  VIR 
Sbjct  101  EEDDCCRWLYEIDTDCVCEMLVHLPDFLSRPVHEYSLIVGDTCNVTYSCGGRVIRK  156



>ref|XP_010316744.1| PREDICTED: uncharacterized protein LOC104645827 [Solanum lycopersicum]
Length=158

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            +P EE CC+WMK VD+ CVC + A+LP FL+RP+HQYT +   +C  TF C S  R
Sbjct  90   TPVEEECCRWMKAVDSECVCSLLAHLPIFLSRPIHQYTTLAHATCSVTFTCASSAR  145



>gb|KDP21489.1| hypothetical protein JCGZ_21960 [Jatropha curcas]
Length=121

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  540  EICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            E CC+W+ +VDN CVCD+   LP FLARP HQ+T+++G++C  TF C   +R
Sbjct  69   ENCCRWLSDVDNECVCDLLIRLPIFLARPAHQFTIVIGDTCTITFSCSGRVR  120



>ref|XP_009104413.1| PREDICTED: histidine-rich glycoprotein-like [Brassica rapa]
Length=250

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  T+ CG  + S
Sbjct  200  CCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRLMS  250



>ref|XP_004136185.1| PREDICTED: uncharacterized protein LOC101206671 [Cucumis sativus]
 gb|KGN44871.1| hypothetical protein Csa_7G392440 [Cucumis sativus]
Length=149

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 78/144 (54%), Gaps = 6/144 (4%)
 Frame = +3

Query  267  FLLAFVFILCSAAVGQTHWK---AVVRPVGSRCASQISLVNHACsflmlsstpppmpprp  437
             +L+ V  L      ++ W+      RP+   CASQI+L N+AC+ L  +  PPP PP  
Sbjct  7    LILSVVLFLTLITDSESQWQPPGVAPRPL---CASQITLANYACATLPYAKLPPPPPPSS  63

Query  438  pllsppAVDQAMPlgrhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFL  617
             L +      +   G H     R H     +P EE CC+W+++VD+ CVC++ + LP FL
Sbjct  64   SLSNNQDSQGSPVHGHHHGHHHRHHHKIPLTPIEENCCKWVQQVDSECVCELLSRLPAFL  123

Query  618  ARPLHQYTVMVGESCFQTFQCGSV  689
             RP+H ++V +G SC  T+ CG +
Sbjct  124  KRPIHNFSVTIGGSCNATYWCGGM  147



>emb|CDY63338.1| BnaA09g55630D [Brassica napus]
Length=227

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  TF CG
Sbjct  177  CCKWVKQMDNECVCDLLVRLPPLLAKPAHDYTVFVDESCIVTFTCG  222



>ref|XP_010468887.1| PREDICTED: probable zinc transporter protein DDB_G0283629 [Camelina 
sativa]
Length=241

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            ++ CC+W+K++DN CVCD+   LPP LA+P+H YTV V ESC  TF CG 
Sbjct  188  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGG  237



>emb|CDX67917.1| BnaA07g19570D [Brassica napus]
Length=239

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            ++ CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  T+ CG  + S
Sbjct  186  QQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRLMS  239



>ref|XP_010413198.1| PREDICTED: nonsense-mediated mRNA decay protein 2-like [Camelina 
sativa]
Length=248

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            ++ CC+W+K++DN CVCD+   LPP LA+P+H YTV V ESC  TF CG 
Sbjct  195  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGG  244



>ref|XP_010512716.1| PREDICTED: histidine-rich glycoprotein-like [Camelina sativa]
Length=259

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            ++ CC+W+K++DN CVCD+   LPP LA+P+H YTV V ESC  TF CG 
Sbjct  206  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGG  255



>ref|XP_008368867.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432449 
[Malus domestica]
Length=168

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +3

Query  531  PEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            P E+ CC+W+ ++DN CVC++  +LP FL RP H Y+V VGE+C  ++ CG+ IR
Sbjct  111  PAEDNCCKWLNQLDNECVCELLVHLPNFLIRPAHAYSVAVGETCTVSYTCGTPIR  165



>emb|CDX79421.1| BnaC06g18820D [Brassica napus]
Length=217

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIRS  698
            ++ CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  T+ CG  + S
Sbjct  164  QQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRLMS  217



>ref|XP_009116975.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc transporter cis4 
[Brassica rapa]
Length=270

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  TF CG
Sbjct  220  CCKWVKQMDNECVCDLLVRLPPLLAKPAHDYTVFVDESCIVTFTCG  265



>ref|XP_002533067.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29306.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVIR  695
            CC+W+ ++D+ C+C++   LPPFLARPLHQYTV++ ++C  T+ C   +R
Sbjct  93   CCRWLNDLDDECICELLVRLPPFLARPLHQYTVVIADACNVTYTCSGRVR  142



>gb|EPS59564.1| hypothetical protein M569_15243, partial [Genlisea aurea]
Length=150

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            EE CC+W+KE+D+ CVC++   LPPFL RP+H YTV V + C  T+QC S
Sbjct  99   EEDCCRWVKEIDDVCVCELLVRLPPFLTRPVHNYTVAVDDLCSVTYQCSS  148



>gb|KFK35474.1| hypothetical protein AALP_AA5G288900 [Arabis alpina]
Length=249

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            ++ CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  T+ CG
Sbjct  196  QQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCG  244



>emb|CDY64155.1| BnaCnng43330D [Brassica napus]
Length=612

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            CC+W+K++DN CVCD+   LPP LA+P H YTV V ESC  TF CG
Sbjct  562  CCKWVKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTFTCG  607



>ref|XP_002320394.1| hypothetical protein POPTR_0014s13520g [Populus trichocarpa]
 gb|EEE98709.1| hypothetical protein POPTR_0014s13520g [Populus trichocarpa]
Length=152

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            S  E+ CC+W+KE+D  CVCD+   LPPFL++P H YTV V E+C  T+ C
Sbjct  98   SSSEDNCCKWLKELDEECVCDVLYRLPPFLSKPTHTYTVYVAEACNVTYSC  148



>gb|EAZ04978.1| hypothetical protein OsI_27158 [Oryza sativa Indica Group]
Length=141

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            CC+W+KEV+  CVCD    LPPFL +P H+YTV VG+SC  T+ CG 
Sbjct  94   CCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  140



>emb|CDX93936.1| BnaC04g20950D [Brassica napus]
Length=260

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            ++ CC+W++++DN CVCD+   LPP L++P H YTV V +SC  TF CG 
Sbjct  207  QQDCCKWLRQIDNECVCDLLVTLPPLLSKPAHNYTVFVDDSCIVTFTCGG  256



>gb|EYU38143.1| hypothetical protein MIMGU_mgv1a015131mg [Erythranthe guttata]
Length=167

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            +PEEE CC+W+K +D+ CVC +   LPPFL RP H Y V VG  C  +F CGS
Sbjct  110  TPEEEECCRWLKNIDSVCVCKLLLYLPPFLTRPHHNYGVDVGGLCDISFNCGS  162



>emb|CDX89172.1| BnaA04g00140D [Brassica napus]
Length=268

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            ++ CC+W++++DN CVCD+   LPP L++P H YTV V +SC  TF CG 
Sbjct  215  QQDCCKWLRQIDNECVCDLLVTLPPLLSKPAHNYTVFVDDSCIVTFTCGG  264



>ref|XP_011007542.1| PREDICTED: uncharacterized protein LOC105113180 [Populus euphratica]
Length=138

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            +E+ CC+W+ +VD+ C+C++   LPPFL+RP H+YT+ + +SC  ++ CG
Sbjct  87   QEDTCCRWLNDVDDECICELLVRLPPFLSRPRHEYTIKIDDSCSVSYTCG  136



>ref|XP_008451383.1| PREDICTED: protein FAM76B [Cucumis melo]
Length=151

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 6/144 (4%)
 Frame = +3

Query  267  FLLAFVFILCSAAVGQTHWKAVV-RPVGSRCASQISLVNHACsflmlsstpppmpprppl  443
            F + F   L +   GQ    AV  RP+   CASQI+L N+AC+ L  S   PP PP   L
Sbjct  9    FSVVFFLALITDTGGQWQPPAVAPRPL---CASQIALANYACATLPYSKLLPPPPPSSSL  65

Query  444  lsppAVDQAMPlgrhrrgglrrhrghhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLAR  623
             S      +     H     R H     SP EE CC+W+++VD+ CVC++ + LP FL R
Sbjct  66   SSNHDSQGSPVHTHHHGHHHRHHHKIPLSPIEENCCKWVQQVDSECVCELLSRLPAFLKR  125

Query  624  PLHQYTVMVGE--SCFQTFQCGSV  689
            P+H ++V++G   SC  T+ CG +
Sbjct  126  PIHNFSVIIGGSLSCNATYSCGGM  149



>gb|EYU46609.1| hypothetical protein MIMGU_mgv1a014816mg [Erythranthe guttata]
Length=177

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            E  CC+W+KE+D+ CVC +   LP FL RP+H YTV+V ESC  +F CGS
Sbjct  124  EGDCCRWLKEIDDVCVCGLLVRLPAFLTRPVHNYTVVVDESCTISFACGS  173



>gb|EEE67730.1| hypothetical protein OsJ_25410 [Oryza sativa Japonica Group]
Length=272

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            CC+W+KEV+  CVCD    LPPFL +P H+YTV VG+SC  T+ CG 
Sbjct  225  CCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  271



>gb|ACG37671.1| aspartic acid-rich protein [Zea mays]
Length=160

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV+  CVC+    LPPFL +P H+YTV VG SC  T++CG V
Sbjct  113  CCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCGGV  160



>ref|XP_011033686.1| PREDICTED: metal tolerance protein 1-like [Populus euphratica]
Length=146

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 56/114 (49%), Gaps = 0/114 (0%)
 Frame = +3

Query  339  PVGSRCASQISLVNHACsflmlsstpppmpprppllsppAVDQAMPlgrhrrgglrrhrg  518
            P  S C  Q SLVNHACS ++  S P                      R  R   R    
Sbjct  29   PQRSLCMPQYSLVNHACSVILGYSLPTHPLTSDDGHGHGNGHDHGHGRRRHRHRQRHGGS  88

Query  519  hhhSPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            H+ S  E+ CC+W+KE+D  CVCD+   LP FL++P H YTV V E+C  T+ C
Sbjct  89   HNGSSSEDNCCKWLKELDEECVCDVLYRLPSFLSKPAHTYTVNVAEACNVTYSC  142



>ref|NP_001060499.1| Os07g0655800 [Oryza sativa Japonica Group]
 dbj|BAC20796.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU01905.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAF22413.1| Os07g0655800 [Oryza sativa Japonica Group]
Length=299

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            CC+W+KEV+  CVCD    LPPFL +P H+YTV VG+SC  T+ CG 
Sbjct  252  CCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  298



>ref|NP_001140718.1| uncharacterized protein LOC100272793 precursor [Zea mays]
 gb|ACF84453.1| unknown [Zea mays]
 tpg|DAA63938.1| TPA: AAA ATPase containing von Willebrand factor type A [Zea 
mays]
Length=282

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV+  CVC+    LPPFL +P H+YTV VG SC  T++CG V
Sbjct  235  CCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCGGV  282



>ref|NP_001150311.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACG38612.1| AAA ATPase containing von Willebrand factor type A [Zea mays]
Length=278

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV+  CVC+    LPPFL +P H+YTV VG SC  T++CG V
Sbjct  231  CCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCGGV  278



>ref|XP_010256204.1| PREDICTED: uncharacterized protein LOC104596643 [Nelumbo nucifera]
Length=149

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
             P EE CC+W++EVD+ CVC +F  +P FL RPLH YT+MV  +C   F+C
Sbjct  95   GPSEE-CCRWLREVDSMCVCQLFVPMPTFLRRPLHSYTIMVDHTCKVVFKC  144



>ref|XP_002302826.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa]
 gb|EEE82099.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa]
Length=139

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  534  EEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            +E+ CC+W+ +VD+ CVC +   LPPFL+R  H+YT+ + +SC  ++ CG
Sbjct  88   QEDTCCRWLNDVDDECVCQLLVRLPPFLSRTRHEYTIKIDDSCSVSYTCG  137



>ref|XP_010684244.1| PREDICTED: uncharacterized protein LOC104898831 [Beta vulgaris 
subsp. vulgaris]
Length=165

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +3

Query  540  EICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC-GSVI  692
            E CC+W+KEVD +CVCD+   LP FLA+P H +TV V + C  T+QC G V+
Sbjct  113  EECCRWLKEVDTQCVCDLLVRLPIFLAKPAHDFTVAVSDDCSVTYQCPGRVM  164



>gb|KHN18894.1| hypothetical protein glysoja_028263 [Glycine soja]
Length=148

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            + +EE CC+W KE+DN+CVC+    LPPFL RPLHQY++ +GESC  T+ CG  I
Sbjct  94   TSQEENCCRWAKEMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNATYSCGGPI  148



>ref|XP_006658907.1| PREDICTED: protein PFC0760c-like [Oryza brachyantha]
Length=188

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            CC+W+KEVD  CVC+    LPPFL +P H+YTV V ++C  T++CG 
Sbjct  141  CCRWLKEVDPACVCEALLRLPPFLTKPQHKYTVRVAKNCKLTYRCGG  187



>ref|NP_001158897.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACF84246.1| unknown [Zea mays]
 gb|ACF85356.1| unknown [Zea mays]
 tpg|DAA45451.1| TPA: AAA ATPase containing von Willebrand factor type A [Zea 
mays]
Length=254

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  207  CCRWLKEVQKECVCEALLRLPPFLVKPQHTYVVRVGRTCNITYRCGGV  254



>ref|NP_001149735.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACG36602.1| AAA ATPase containing von Willebrand factor type A [Zea mays]
Length=255

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  208  CCRWLKEVQKECVCEALLRLPPFLVKPQHTYVVRVGRTCNITYRCGGV  255



>ref|NP_001050142.1| Os03g0357500 [Oryza sativa Japonica Group]
 gb|ABF96048.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12056.1| Os03g0357500 [Oryza sativa Japonica Group]
Length=264

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++EV   CVCD    LPPFL +P H Y V VG +C  T++CG V
Sbjct  217  CCRWLQEVSKDCVCDALMRLPPFLVKPQHTYVVRVGRTCKITYRCGGV  264



>ref|XP_002465242.1| hypothetical protein SORBIDRAFT_01g034880 [Sorghum bicolor]
 gb|EER92240.1| hypothetical protein SORBIDRAFT_01g034880 [Sorghum bicolor]
Length=268

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  221  CCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGGV  268



>gb|EEC75289.1| hypothetical protein OsI_11632 [Oryza sativa Indica Group]
Length=210

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++EV   CVCD    LPPFL +P H Y V VG +C  T++CG V
Sbjct  163  CCRWLQEVSKDCVCDALMRLPPFLVKPQHTYVVRVGRTCKITYRCGGV  210



>ref|XP_002463297.1| hypothetical protein SORBIDRAFT_02g041423 [Sorghum bicolor]
 gb|EER99818.1| hypothetical protein SORBIDRAFT_02g041423 [Sorghum bicolor]
Length=121

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            CC+W+KEV+  CVC+    LPPFL RP H+YTV VG SC  +++C
Sbjct  77   CCRWLKEVEPDCVCEALLRLPPFLVRPQHKYTVKVGNSCKFSYRC  121



>ref|NP_001152240.1| aspartic acid-rich protein precursor [Zea mays]
 gb|ACG46563.1| aspartic acid-rich protein [Zea mays]
Length=252

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  205  CCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGGV  252



>ref|XP_004984320.1| PREDICTED: protein PFC0760c-like [Setaria italica]
Length=273

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  226  CCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCQITYRCGGV  273



>ref|NP_001140990.1| aspartic acid-rich protein precursor [Zea mays]
 gb|ACF85117.1| unknown [Zea mays]
 gb|AFW88333.1| aspartic acid-rich protein [Zea mays]
Length=258

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV   CVC+    LPPFL +P H Y V VG +C  T++CG V
Sbjct  211  CCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGGV  258



>ref|XP_003557893.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein-like [Brachypodium distachyon]
Length=280

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++EV   CVCD    LPPFL +P H+Y V VG +C   ++CG V
Sbjct  233  CCRWLQEVQKDCVCDALLRLPPFLVKPQHKYVVRVGRTCRIVYRCGGV  280



>ref|XP_006375480.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa]
 gb|ERP53277.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa]
Length=89

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            E+ CC+W+ +VD  CVC++   LPPFL++P H+YTV + +SC  ++ C
Sbjct  42   EQNCCRWLSDVDPECVCELLVRLPPFLSKPHHEYTVKINDSCSVSYSC  89



>gb|KHN03781.1| hypothetical protein glysoja_011010 [Glycine soja]
Length=148

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  528  SPEEEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSVI  692
            + +EE CC+W +E+DN+CVC+    LPPFL RPLHQY++ +GESC  T+ CG  I
Sbjct  94   TSQEENCCRWAREMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNVTYSCGGPI  148



>ref|XP_011033687.1| PREDICTED: uncharacterized protein LOC105132093 [Populus euphratica]
Length=156

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            EE CC+W+ +VD  CVC +   LPPFL++P H+YTV + +SC  ++ C
Sbjct  109  EENCCRWLSDVDPECVCQLLVRLPPFLSKPHHEYTVKINDSCSVSYSC  156



>ref|XP_010524012.1| PREDICTED: pleckstrin homology-like domain family A member 1 
[Tarenaya hassleriana]
 ref|XP_010524013.1| PREDICTED: pleckstrin homology-like domain family A member 1 
[Tarenaya hassleriana]
Length=193

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCG  683
            E  CC+W+K++DN CVCD+  +LPP LARP+H YTV V ESC  TF CG
Sbjct  140  EAECCKWLKQMDNECVCDLLLHLPPLLARPVHDYTVFVDESCIVTFSCG  188



>ref|XP_006651394.1| PREDICTED: probable serine/threonine-protein kinase fhkB-like 
[Oryza brachyantha]
Length=127

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++EV   CVCD    L P L +P H Y V VG +C  T++CG +
Sbjct  80   CCRWLQEVSKDCVCDALLRLAPVLVKPQHTYVVRVGRTCRITYRCGGI  127



>ref|XP_002305616.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa]
 gb|EEE86127.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa]
Length=84

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  537  EEICCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            EE CC+W+  +D  CVC +   LP FL++P HQYT+ V  SC  T+ C
Sbjct  35   EENCCKWLGALDKECVCGLLHRLPVFLSKPAHQYTLYVSNSCNITYAC  82



>ref|XP_004958535.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog 
[Setaria italica]
Length=276

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+KEV+  CVC     LP FL +P H+YTV VG SC   ++CG  
Sbjct  229  CCRWLKEVEPDCVCQALLRLPSFLVKPQHKYTVRVGHSCKFIYRCGGT  276



>ref|XP_008776443.1| PREDICTED: protein catecholamines up-like [Phoenix dactylifera]
Length=180

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+ EVD  CVC+    +PPFL +  H Y + VG++C   + CG +
Sbjct  133  CCRWLAEVDEACVCEALLRMPPFLVKAKHTYIIKVGKTCKHEYNCGGI  180



>gb|EMT17194.1| Putative pectinesterase 66 [Aegilops tauschii]
Length=411

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGS  686
            CC+W+KEV+  CVC+   +LP FL +P H+YT+ VG++C  T++CG 
Sbjct  361  CCRWLKEVEPGCVCESLLHLPMFLVKPQHKYTLRVGKTCEVTYRCGG  407



>dbj|BAK07112.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++EV   CVC+    LPPFL +P H+Y V VG +C   ++ G V
Sbjct  233  CCRWLQEVQKDCVCEALLRLPPFLVKPQHKYVVRVGRTCRIVYRRGGV  280



>ref|XP_010942492.1| PREDICTED: uncharacterized protein LOC105060474 [Elaeis guineensis]
Length=148

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W+ EVD  CVC+    +PPF  +  H Y + VG++C   + C  +
Sbjct  101  CCRWLAEVDEACVCEALLRMPPFFIKAKHTYIIKVGKTCKHEYNCRGI  148



>ref|XP_010242431.1| PREDICTED: protein catecholamines up-like [Nelumbo nucifera]
Length=189

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQC  680
            CC+W++E+D+ CVC +   LP FL R  H YTV V +SC   F+C
Sbjct  141  CCRWVRELDSTCVCQLMVQLPLFLRRSPHTYTVRVEDSCQVKFEC  185



>ref|XP_006850779.1| hypothetical protein AMTR_s00025p00092990 [Amborella trichopoda]
 gb|ERN12360.1| hypothetical protein AMTR_s00025p00092990 [Amborella trichopoda]
Length=142

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  546  CCQWMKEVDNRCVCDMFANLPPFLARPLHQYTVMVGESCFQTFQCGSV  689
            CC+W++++DN CVC +   LP FL++P    T+   E C  T++C  V
Sbjct  95   CCRWLRQIDNACVCHVLNRLPVFLSKPSSSITLTPDEYCSVTYRCPRV  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1826707812600