BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46231_g1_i1 len=137 path=[305:0-136]

Length=137
                                                                      Score     E

gb|ADI18106.1|  hypothetical protein                                  50.8    4e-07   
ref|WP_004984915.1|  retrotransposon protein                          48.9    3e-06   
ref|WP_003946936.1|  retrotransposon protein                          48.5    4e-06   
ref|WP_004990864.1|  retrotransposon protein                          48.5    4e-06   
gb|EDX22401.1|  retrotransposon protein                               48.1    5e-06   Streptomyces sp. Mg1
ref|WP_003957150.1|  MULTISPECIES: hypothetical protein               45.1    8e-05   
ref|WP_007264784.1|  hypothetical protein                             45.1    8e-05   
ref|WP_004986318.1|  hypothetical protein                             45.1    9e-05   
gb|ADI18017.1|  hypothetical protein                                  45.1    1e-04   
gb|EDY45008.1|  hypothetical protein SSBG_02845                       44.7    1e-04   Streptomyces sp. SPB074
emb|CDG37541.1|  hypothetical protein CTHBC1_2972                     44.7    3e-04   
gb|ADI19199.1|  hypothetical protein                                  43.9    3e-04   
gb|ADI18413.1|  hypothetical protein                                  43.9    3e-04   
gb|ADI17624.1|  hypothetical protein                                  43.1    5e-04   



>gb|ADI18106.1| hypothetical protein [uncultured Acidobacteriales bacterium HF0200_23L05]
Length=47

 Score = 50.8 bits (120),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  CGIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
             GIRSL+ F  LV  LVHPVLY RR   EA+P++IS RT +
Sbjct  4    VGIRSLVGFSKLVGPLVHPVLYHRRRPPEAAPKSISRRTGH  44



>ref|WP_004984915.1| retrotransposon protein [Streptomyces ghanaensis]
 gb|EFE67886.1| retrotransposon protein [Streptomyces ghanaensis ATCC 14672]
Length=50

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    IAGSPRNSLRASLGC*PAEVEHWMN*SPYQGIEFNQTPNAA  124
            IAGSPRN+ R S+ C   EVEHW+   PY+  + +QTPNA 
Sbjct  9    IAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAG  49



>ref|WP_003946936.1| retrotransposon protein [Streptomyces sp. e14]
 gb|EFE80055.1| retrotransposon protein [Streptomyces albus J1074]
 gb|EFE81976.1| retrotransposon protein [Streptomyces albus J1074]
 gb|EFF89936.1| hypothetical protein SSTG_00254 [Streptomyces sp. e14]
 gb|EFH28879.1| retrotransposon protein [Streptomyces sviceus ATCC 29083]
Length=54

 Score = 48.5 bits (114),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    IAGSPRNSLRASLGC*PAEVEHWMN*SPYQGIEFNQTPNAA  124
            IAGSPRN+ R S+ C   EVEHW+   PY+  + +QTPNA 
Sbjct  13   IAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAG  53



>ref|WP_004990864.1| retrotransposon protein, partial [Streptomyces ghanaensis]
 gb|EFE70734.1| LOW QUALITY PROTEIN: retrotransposon protein [Streptomyces ghanaensis 
ATCC 14672]
Length=53

 Score = 48.5 bits (114),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    IAGSPRNSLRASLGC*PAEVEHWMN*SPYQGIEFNQTPNAA  124
            IAGSPRN+ R S+ C   EVEHW+   PY+  + +QTPNA 
Sbjct  12   IAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAG  52



>gb|EDX22401.1| retrotransposon protein [Streptomyces sp. Mg1]
Length=56

 Score = 48.1 bits (113),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    IAGSPRNSLRASLGC*PAEVEHWMN*SPYQGIEFNQTPNAA  124
            IAGSPRN+ R S+ C   EVEHW+   PY+  + +QTPNA 
Sbjct  15   IAGSPRNAFRCSVVCFLPEVEHWIGDGPYRVTDLSQTPNAG  55



>ref|WP_003957150.1| MULTISPECIES: hypothetical protein [Streptomyces]
 gb|EDY51531.1| hypothetical protein SSCG_04411 [Streptomyces clavuligerus ATCC 
27064]
 gb|EFD66349.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gb|EFD68584.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gb|EFD68877.1| conserved hypothetical protein [Streptomyces lividans TK24]
 gb|EFF91831.1| hypothetical protein SSTG_02150 [Streptomyces sp. e14]
 gb|EFF93462.1| hypothetical protein SSTG_03781 [Streptomyces sp. e14]
Length=67

 Score = 45.1 bits (105),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
            GIRSL +    V  + +PVLYLR+   +A+P+ ISGRTSY
Sbjct  25   GIRSLAKVSNPVGPIAYPVLYLRQETHDAAPKCISGRTSY  64



>ref|WP_007264784.1| hypothetical protein [Streptomyces sp. C]
 gb|EDX25830.1| hypothetical protein SSAG_05517 [Streptomyces sp. Mg1]
 gb|EFL15840.1| conserved hypothetical protein [Streptomyces sp. C]
 gb|EFL16482.1| conserved hypothetical protein [Streptomyces sp. C]
Length=67

 Score = 45.1 bits (105),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
            GIRSL +    V  + +PVLYLR+   +A+P+ ISGRTSY
Sbjct  25   GIRSLAKVSNPVGPIAYPVLYLRQETHDAAPKCISGRTSY  64



>ref|WP_004986318.1| hypothetical protein [Streptomyces ghanaensis]
 gb|EFE68557.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
Length=67

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
            GIRSL +    V  + +PVLYLR+   +A+P+ ISGRTSY
Sbjct  25   GIRSLAKVSNPVGPIAYPVLYLRQETHDAAPKCISGRTSY  64



>gb|ADI18017.1| hypothetical protein [uncultured delta proteobacterium HF0200_19J16]
 gb|ADI18198.1| hypothetical protein [uncultured delta proteobacterium HF0200_39N20]
Length=68

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -2

Query  124  CGIRSLIEFDTLVWALVHPVLYLRRSASE  38
             GIRSL+ F TLV ALVHPVLYLRRS + 
Sbjct  24   AGIRSLVGFGTLVGALVHPVLYLRRSITR  52



>gb|EDY45008.1| hypothetical protein SSBG_02845 [Streptomyces sp. SPB74]
 gb|EFK98586.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gb|EFK98967.1| conserved hypothetical protein [Streptomyces sp. SPB78]
 gb|EFL02129.1| conserved hypothetical protein [Streptomyces sp. SPB78]
Length=67

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
            GIRSL +    V  + +PVLYLR+   +A+P+ ISGRTSY
Sbjct  25   GIRSLAKVSNPVRPIAYPVLYLRQETHDAAPKCISGRTSY  64



>emb|CDG37541.1| hypothetical protein CTHBC1_2972 [Ruminiclostridium thermocellum 
BC1]
Length=157

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASEASPQAISGRTSY  2
            GI+SL  F   V  L   VLYLR++  EASP+AISGRTSY
Sbjct  25   GIQSLRGFGNPVRPLAQSVLYLRQTLLEASPKAISGRTSY  64



>gb|ADI19199.1| hypothetical protein [uncultured delta proteobacterium HF0130_20J24]
Length=68

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASE  38
            GIRSL+ F TLV ALVHPVLYLRRS + 
Sbjct  25   GIRSLVGFGTLVRALVHPVLYLRRSITR  52



>gb|ADI18413.1| hypothetical protein [uncultured delta proteobacterium HF4000_08N17]
Length=68

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  121  GIRSLIEFDTLVWALVHPVLYLRRSASE  38
            GIRSL+ F TLV ALVHPVLYLRRS + 
Sbjct  25   GIRSLVGFGTLVRALVHPVLYLRRSITR  52



>gb|ADI17624.1| hypothetical protein [uncultured delta proteobacterium HF0130_19C20]
Length=68

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = -2

Query  124  CGIRSLIEFDTLVWALVHPVLYLRRSASE  38
             GIRSL+ F TLV ALVHP LYLRRS + 
Sbjct  24   AGIRSLVGFGTLVGALVHPALYLRRSITR  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510661775884