BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c46097_g1_i1 len=313 path=[291:0-312]

Length=313
                                                                      Score     E

ref|XP_008345732.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   90.9    2e-19   
ref|XP_004489545.1|  PREDICTED: GDSL esterase/lipase LTL1-like        90.1    3e-19   
gb|EPS58999.1|  hypothetical protein M569_15814                       85.5    3e-19   
ref|XP_003626498.1|  GDSL esterase/lipase                             84.7    7e-19   
gb|EPS72894.1|  hypothetical protein M569_01863                       87.4    8e-19   
gb|KDP23752.1|  hypothetical protein JCGZ_23585                       85.9    1e-18   
ref|XP_006443291.1|  hypothetical protein CICLE_v10020640mg           88.2    1e-18   
ref|XP_002303095.1|  GDSL-motif lipase/hydrolase family protein       88.2    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011024535.1|  PREDICTED: GDSL esterase/lipase At4g28780        88.2    2e-18   
ref|XP_010043320.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   87.8    2e-18   
ref|XP_009777585.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  87.0    3e-18   
ref|XP_010492845.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   87.4    3e-18   
ref|XP_006340478.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   87.0    4e-18   
ref|XP_009587010.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   87.0    4e-18   
ref|XP_011076887.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   87.0    4e-18   
ref|XP_010918935.1|  PREDICTED: GDSL esterase/lipase LTL1             86.7    5e-18   
ref|XP_004494761.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   87.0    5e-18   
gb|KDP23750.1|  hypothetical protein JCGZ_23583                       84.0    5e-18   
emb|CDP03830.1|  unnamed protein product                              86.7    6e-18   
ref|XP_002325359.2|  hypothetical protein POPTR_0019s04110g           87.0    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011002019.1|  PREDICTED: GDSL esterase/lipase LTL1-like        86.7    6e-18   
gb|AFW58802.1|  hypothetical protein ZEAMMB73_832786                  83.6    7e-18   
ref|XP_011083095.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  85.9    7e-18   
gb|KHN43143.1|  GDSL esterase/lipase                                  85.5    7e-18   
gb|AEY85024.1|  zinc finger protein                                   86.3    8e-18   
gb|KDO46628.1|  hypothetical protein CISIN_1g041652mg                 86.3    9e-18   
ref|XP_006437267.1|  hypothetical protein CICLE_v10033835mg           86.3    9e-18   
gb|AAP35038.1|  putative GDSL-motif lipase                            84.0    9e-18   Vitis vinifera
ref|XP_006484791.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.9    9e-18   
ref|XP_007201335.1|  hypothetical protein PRUPE_ppa007652mg           85.9    9e-18   
ref|XP_011002017.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   85.9    9e-18   
ref|XP_009769587.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.9    1e-17   
emb|CDO99962.1|  unnamed protein product                              85.9    1e-17   
gb|KEH42418.1|  GDSL-like lipase/acylhydrolase                        85.9    1e-17   
ref|XP_009777584.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  85.9    1e-17   
ref|XP_009591832.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.9    1e-17   
ref|XP_008810066.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.9    1e-17   
ref|XP_002325361.2|  hypothetical protein POPTR_0019s04140g           85.9    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011077072.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.9    1e-17   
ref|XP_008235540.1|  PREDICTED: GDSL esterase/lipase At4g28780        85.9    1e-17   
gb|KHN14797.1|  GDSL esterase/lipase                                  83.2    1e-17   
gb|AAS75127.1|  GDSL-motif lipase                                     85.5    1e-17   Agave americana [century plant]
ref|XP_006854343.1|  hypothetical protein AMTR_s00039p00143210        85.5    1e-17   
ref|XP_004237506.1|  PREDICTED: GDSL esterase/lipase At5g33370        85.5    1e-17   
ref|XP_009766488.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   85.5    2e-17   
gb|AES82718.2|  GDSL-like lipase/acylhydrolase                        85.5    2e-17   
gb|ACR33100.1|  putative tea geometrid larvae-inducible protein       85.5    2e-17   Camellia sinensis [black tea]
ref|XP_011083094.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  85.1    2e-17   
ref|NP_194607.1|  GDSL esterase/lipase                                85.1    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AFK33443.1|  unknown                                               83.6    2e-17   
ref|XP_009631850.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   85.1    3e-17   
ref|XP_003521784.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.7    3e-17   
ref|XP_007162645.1|  hypothetical protein PHAVU_001G168200g           85.1    3e-17   
ref|XP_008443762.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  84.3    3e-17   
ref|XP_003521785.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.3    4e-17   
gb|KHN35335.1|  GDSL esterase/lipase                                  84.3    4e-17   
ref|XP_003554733.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.3    4e-17   
ref|XP_006350316.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   84.3    4e-17   
ref|XP_004247304.1|  PREDICTED: GDSL esterase/lipase At4g28780        84.3    4e-17   
gb|ACU23502.1|  unknown                                               84.3    4e-17   Glycine max [soybeans]
ref|XP_004489173.1|  PREDICTED: GDSL esterase/lipase LTL1-like        84.3    4e-17   
ref|XP_003536954.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   84.3    4e-17   
ref|XP_002265999.1|  PREDICTED: GDSL esterase/lipase At4g28780        84.3    4e-17   Vitis vinifera
ref|XP_002467122.1|  hypothetical protein SORBIDRAFT_01g020000        84.0    4e-17   Sorghum bicolor [broomcorn]
ref|XP_011077073.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  84.3    4e-17   
emb|CDY06871.1|  BnaC01g09700D                                        84.3    4e-17   
ref|XP_009129278.1|  PREDICTED: GDSL esterase/lipase At4g28780        84.3    4e-17   
ref|XP_007144437.1|  hypothetical protein PHAVU_007G156000g           84.3    4e-17   
ref|XP_009801786.1|  PREDICTED: GDSL esterase/lipase LTL1-like        84.3    4e-17   
ref|XP_002522020.1|  zinc finger protein, putative                    84.3    4e-17   Ricinus communis
ref|XP_010674245.1|  PREDICTED: GDSL esterase/lipase At5g33370        84.3    4e-17   
ref|XP_004242381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.3    4e-17   
ref|XP_006660400.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.3    4e-17   
ref|XP_008443761.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  84.0    5e-17   
gb|EYU39534.1|  hypothetical protein MIMGU_mgv1a008648mg              84.0    5e-17   
gb|ABX75139.1|  lipase                                                84.0    5e-17   Gossypium hirsutum [American cotton]
gb|EPS69813.1|  hypothetical protein M569_04951                       83.6    5e-17   
ref|XP_009589092.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   84.0    5e-17   
ref|XP_002522021.1|  zinc finger protein, putative                    84.0    5e-17   Ricinus communis
gb|ACU18148.1|  unknown                                               83.2    5e-17   Glycine max [soybeans]
gb|KHN14888.1|  GDSL esterase/lipase                                  82.8    5e-17   
gb|ACR37591.1|  unknown                                               84.0    5e-17   Zea mays [maize]
ref|XP_006352714.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.0    5e-17   
ref|XP_003535381.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.0    5e-17   
ref|XP_010069682.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   84.0    7e-17   
ref|XP_004494760.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   84.0    7e-17   
ref|XP_004292262.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   83.6    7e-17   
ref|XP_002325360.1|  hypothetical protein POPTR_0019s04130g           83.6    7e-17   Populus trichocarpa [western balsam poplar]
gb|KHN05905.1|  GDSL esterase/lipase                                  84.0    7e-17   
gb|ACG46653.1|  anther-specific proline-rich protein APG precursor    84.0    7e-17   Zea mays [maize]
ref|XP_007205392.1|  hypothetical protein PRUPE_ppa007427mg           83.6    8e-17   
ref|XP_011038450.1|  PREDICTED: GDSL esterase/lipase LTL1-like        83.6    8e-17   
ref|XP_009611210.1|  PREDICTED: GDSL esterase/lipase LTL1-like        83.6    8e-17   
emb|CBI28652.3|  unnamed protein product                              83.6    8e-17   
ref|XP_010648948.1|  PREDICTED: GDSL esterase/lipase At5g33370        83.6    8e-17   
ref|XP_009764127.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  83.6    8e-17   
ref|NP_001146251.1|  hypothetical protein precursor                   83.6    9e-17   Zea mays [maize]
ref|XP_010936081.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   83.6    9e-17   
ref|XP_002268826.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   83.6    9e-17   Vitis vinifera
ref|XP_011084724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   83.6    9e-17   
emb|CDP04257.1|  unnamed protein product                              83.2    9e-17   
emb|CBI28654.3|  unnamed protein product                              83.2    9e-17   
ref|NP_001136990.1|  uncharacterized protein LOC100217152             84.0    9e-17   Zea mays [maize]
ref|XP_010043319.1|  PREDICTED: GDSL esterase/lipase LTL1-like        83.2    1e-16   
emb|CAN66351.1|  hypothetical protein VITISV_039098                   83.2    1e-16   Vitis vinifera
gb|KCW85323.1|  hypothetical protein EUGRSUZ_B02163                   83.2    1e-16   
ref|XP_009348738.1|  PREDICTED: GDSL esterase/lipase LTL1-like        83.2    1e-16   
ref|XP_002521156.1|  zinc finger protein, putative                    83.2    1e-16   Ricinus communis
ref|XP_010433162.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   83.2    1e-16   
ref|XP_007147235.1|  hypothetical protein PHAVU_006G1073001g          82.4    1e-16   
ref|XP_011002018.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   83.2    1e-16   
tpg|DAA49762.1|  TPA: hypothetical protein ZEAMMB73_759037            83.6    1e-16   
ref|XP_003555561.1|  PREDICTED: GDSL esterase/lipase At5g33370        83.2    1e-16   
ref|XP_007030304.1|  Li-tolerant lipase 1 isoform 1                   82.8    1e-16   
gb|KHN04961.1|  GDSL esterase/lipase                                  82.8    1e-16   
ref|XP_006371114.1|  hypothetical protein POPTR_0019s04150g           83.2    1e-16   
gb|KCW61461.1|  hypothetical protein EUGRSUZ_H04197                   82.8    1e-16   
gb|KFK29417.1|  hypothetical protein AALP_AA7G132000                  82.8    1e-16   
ref|XP_010024922.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.4    2e-16   
ref|NP_001132075.1|  uncharacterized protein LOC100193489 precursor   82.8    2e-16   Zea mays [maize]
ref|XP_008370770.1|  PREDICTED: GDSL esterase/lipase LTL1-like        82.4    2e-16   
ref|XP_008345728.1|  PREDICTED: GDSL esterase/lipase LTL1-like        82.4    2e-16   
ref|XP_010438383.1|  PREDICTED: GDSL esterase/lipase At4g28780        82.4    2e-16   
ref|XP_008370782.1|  PREDICTED: GDSL esterase/lipase LTL1-like        82.4    2e-16   
gb|ACR37768.1|  unknown                                               83.2    2e-16   Zea mays [maize]
ref|NP_001237641.2|  uncharacterized LOC100500155 precursor           82.4    2e-16   
ref|XP_008218371.1|  PREDICTED: GDSL esterase/lipase LTL1-like        82.8    2e-16   
emb|CDY02631.1|  BnaC02g08040D                                        82.4    2e-16   
gb|EYU39533.1|  hypothetical protein MIMGU_mgv1a008571mg              82.4    2e-16   
ref|XP_002869473.1|  GDSL-motif lipase/hydrolase family protein       82.4    2e-16   
gb|KHN14798.1|  GDSL esterase/lipase                                  80.9    2e-16   
ref|XP_008796408.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.4    2e-16   
emb|CDY35219.1|  BnaA01g08120D                                        82.0    2e-16   
ref|XP_003580102.1|  PREDICTED: GDSL esterase/lipase LTL1             82.4    2e-16   
emb|CDP04255.1|  unnamed protein product                              82.4    2e-16   
ref|XP_010447915.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   82.4    2e-16   
ref|XP_010102184.1|  GDSL esterase/lipase                             81.3    2e-16   
ref|XP_011002016.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.4    2e-16   
ref|XP_008388753.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    2e-16   
ref|XP_007139614.1|  hypothetical protein PHAVU_008G044500g           82.4    2e-16   
gb|ACU15164.1|  unknown                                               80.5    3e-16   Glycine max [soybeans]
ref|XP_008810810.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
ref|XP_009379724.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
tpg|DAA37013.1|  TPA: hypothetical protein ZEAMMB73_160387            80.9    3e-16   
ref|XP_010102187.1|  GDSL esterase/lipase                             82.0    3e-16   
ref|XP_003573228.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
gb|KHN14896.1|  GDSL esterase/lipase                                  82.0    3e-16   
ref|XP_003554997.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
ref|XP_003554732.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
gb|ACU15087.1|  unknown                                               80.5    3e-16   Glycine max [soybeans]
ref|NP_001241754.1|  anther-specific proline-rich protein APG pre...  82.0    3e-16   
gb|EMT05671.1|  GDSL esterase/lipase                                  81.3    3e-16   
gb|KHN43145.1|  GDSL esterase/lipase                                  82.0    3e-16   
ref|XP_003626495.1|  GDSL esterase/lipase                             82.0    3e-16   
ref|XP_010263996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   82.0    3e-16   
gb|ACU17474.1|  unknown                                               80.5    3e-16   Glycine max [soybeans]
ref|NP_197344.2|  GDSL esterase/lipase                                81.6    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443286.1|  hypothetical protein CICLE_v10020709mg           80.9    4e-16   
gb|EMS53263.1|  GDSL esterase/lipase LTL1                             81.6    4e-16   
ref|XP_007030303.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  81.6    4e-16   
gb|EAY78821.1|  hypothetical protein OsI_33925                        80.9    4e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008382662.1|  PREDICTED: GDSL esterase/lipase At4g28780        81.6    4e-16   
ref|XP_004976167.1|  PREDICTED: GDSL esterase/lipase LTL1-like        81.3    5e-16   
dbj|BAK07334.1|  predicted protein                                    81.3    5e-16   
gb|EPS65950.1|  hypothetical protein M569_08823                       80.9    5e-16   
ref|XP_004495029.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...  81.3    5e-16   
gb|KHN43144.1|  GDSL esterase/lipase                                  81.3    5e-16   
gb|ACU23610.1|  unknown                                               81.3    5e-16   Glycine max [soybeans]
gb|AAN05519.1|  putative early nodulin gene (Enod) related protein    81.6    5e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62626.1|  GDSL esterase/lipase LTL1                             81.3    6e-16   
ref|XP_004495028.1|  PREDICTED: GDSL esterase/lipase At4g28780-li...  81.3    6e-16   
ref|XP_002873894.1|  predicted protein                                80.9    6e-16   
ref|NP_001064786.1|  Os10g0463200                                     81.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08293.1|  GDSL esterase/lipase LTL1                             81.3    6e-16   
dbj|BAJ85303.1|  predicted protein                                    81.3    6e-16   
ref|XP_007030301.1|  GDSL-like Lipase/Acylhydrolase superfamily p...  81.3    6e-16   
ref|XP_007147237.1|  hypothetical protein PHAVU_006G107400g           80.9    6e-16   
ref|XP_007151673.1|  hypothetical protein PHAVU_004G066300g           81.3    7e-16   
ref|XP_006400391.1|  hypothetical protein EUTSA_v10013876mg           80.9    7e-16   
ref|XP_007151676.1|  hypothetical protein PHAVU_004G066600g           80.9    7e-16   
ref|XP_003521783.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    7e-16   
ref|XP_004237503.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    7e-16   
gb|KHN35333.1|  GDSL esterase/lipase                                  80.9    7e-16   
ref|XP_010524958.1|  PREDICTED: GDSL esterase/lipase At5g18430        81.3    7e-16   
ref|NP_001062538.1|  Os08g0565900                                     81.3    7e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EYU46367.1|  hypothetical protein MIMGU_mgv1a008634mg              80.9    7e-16   
ref|XP_006340481.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    7e-16   
ref|XP_009348740.1|  PREDICTED: GDSL esterase/lipase LTL1-like        80.9    7e-16   
ref|XP_006375868.1|  hypothetical protein POPTR_0013s04790g           80.9    7e-16   
gb|KHG28665.1|  hypothetical protein F383_15485                       80.9    7e-16   
ref|XP_002319125.1|  hypothetical protein POPTR_0013s04790g           80.9    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007151675.1|  hypothetical protein PHAVU_004G066500g           80.9    8e-16   
ref|XP_002446760.1|  hypothetical protein SORBIDRAFT_06g021990        81.3    8e-16   Sorghum bicolor [broomcorn]
gb|ABK95911.1|  unknown                                               80.9    8e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008370769.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    8e-16   
gb|KDP23751.1|  hypothetical protein JCGZ_23584                       80.9    8e-16   
gb|KHN14886.1|  GDSL esterase/lipase                                  80.9    8e-16   
ref|XP_006412910.1|  hypothetical protein EUTSA_v10025523mg           80.9    8e-16   
ref|XP_003553269.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    8e-16   
ref|XP_003553249.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.9    9e-16   
gb|ACG37655.1|  anther-specific proline-rich protein APG              80.9    9e-16   Zea mays [maize]
ref|XP_009389128.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   81.3    9e-16   
ref|XP_002319124.2|  hypothetical protein POPTR_0013s04780g           81.3    1e-15   Populus trichocarpa [western balsam poplar]
gb|KHN11576.1|  GDSL esterase/lipase                                  77.8    1e-15   
ref|XP_011038448.1|  PREDICTED: GDSL esterase/lipase At5g33370        80.5    1e-15   
ref|XP_007147234.1|  hypothetical protein PHAVU_006G107200g           80.9    1e-15   
gb|KHN14884.1|  GDSL esterase/lipase                                  80.5    1e-15   
ref|XP_006283981.1|  hypothetical protein CARUB_v10005104mg           80.5    1e-15   
ref|XP_004174057.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   77.4    1e-15   
ref|XP_006443287.1|  hypothetical protein CICLE_v10020709mg           80.5    1e-15   
ref|XP_009126251.1|  PREDICTED: GDSL esterase/lipase At5g18430        80.5    1e-15   
ref|XP_007143993.1|  hypothetical protein PHAVU_007G120000g           80.1    1e-15   
ref|XP_010454082.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   80.1    1e-15   
gb|EMT19317.1|  GDSL esterase/lipase                                  80.1    1e-15   
ref|XP_006350943.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   80.1    1e-15   
ref|NP_001141295.1|  uncharacterized protein LOC100273386 precursor   80.1    1e-15   Zea mays [maize]
ref|XP_004249922.1|  PREDICTED: GDSL esterase/lipase At5g33370        80.1    1e-15   
ref|XP_010420599.1|  PREDICTED: GDSL esterase/lipase At5g18430        79.7    2e-15   
gb|KHN48972.1|  GDSL esterase/lipase                                  80.1    2e-15   
gb|KHG28666.1|  GDSL esterase/lipase LTL1 -like protein               80.1    2e-15   
gb|EPS67986.1|  hypothetical protein M569_06783                       79.7    2e-15   
ref|XP_003542450.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   80.1    2e-15   
gb|ACU23670.1|  unknown                                               80.1    2e-15   Glycine max [soybeans]
gb|KHN47677.1|  GDSL esterase/lipase                                  79.0    2e-15   
ref|XP_007206865.1|  hypothetical protein PRUPE_ppb006257mg           79.7    2e-15   
ref|XP_008218370.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
dbj|BAK06471.1|  predicted protein                                    80.1    2e-15   
emb|CAN67727.1|  hypothetical protein VITISV_038832                   79.7    2e-15   Vitis vinifera
ref|XP_008388755.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
ref|XP_002522022.1|  zinc finger protein, putative                    79.7    2e-15   Ricinus communis
ref|XP_003554731.1|  PREDICTED: GDSL esterase/lipase LTL1-like        79.7    2e-15   
ref|XP_003521782.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...  79.7    2e-15   
ref|XP_006577328.1|  PREDICTED: GDSL esterase/lipase LTL1-like is...  80.1    2e-15   
ref|XP_003574015.1|  PREDICTED: GDSL esterase/lipase LTL1             79.7    2e-15   
ref|XP_006661836.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
gb|KHN41491.1|  GDSL esterase/lipase                                  79.7    2e-15   
ref|XP_004982954.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
ref|XP_008789479.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
ref|XP_004142546.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.3    2e-15   
ref|XP_002268296.2|  PREDICTED: GDSL esterase/lipase At5g33370        79.7    2e-15   Vitis vinifera
ref|XP_003543915.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.7    2e-15   
ref|XP_009348739.1|  PREDICTED: GDSL esterase/lipase LTL1-like        79.3    2e-15   
ref|XP_003524731.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.3    3e-15   
ref|XP_003590909.1|  GDSL esterase/lipase                             79.3    3e-15   
gb|KGN66731.1|  hypothetical protein Csa_1G665920                     79.3    3e-15   
gb|KHN35332.1|  GDSL esterase/lipase LTL1                             79.3    3e-15   
gb|KFK26081.1|  hypothetical protein AALP_AA8G200400                  79.3    3e-15   
ref|XP_003554996.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.3    3e-15   
ref|XP_009398857.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.3    3e-15   
gb|KDO52500.1|  hypothetical protein CISIN_1g017684mg                 79.0    3e-15   
ref|XP_003533553.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.0    4e-15   
gb|KHN13664.1|  GDSL esterase/lipase                                  79.0    4e-15   
ref|XP_003552505.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   79.0    4e-15   
ref|XP_003541357.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   78.6    5e-15   
ref|XP_003590908.1|  GDSL esterase/lipase                             78.6    5e-15   
ref|XP_003618755.1|  GDSL esterase/lipase                             78.6    5e-15   
gb|KDO52499.1|  hypothetical protein CISIN_1g017684mg                 78.2    6e-15   
ref|XP_002522023.1|  zinc finger protein, putative                    78.6    6e-15   Ricinus communis
ref|XP_004302114.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   78.6    6e-15   
ref|XP_003626492.1|  GDSL esterase/lipase                             78.6    7e-15   
gb|ABK25359.1|  unknown                                               78.2    7e-15   Picea sitchensis
gb|KDO52498.1|  hypothetical protein CISIN_1g017684mg                 78.2    8e-15   
ref|XP_010940685.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   78.2    8e-15   
ref|XP_006443290.1|  hypothetical protein CICLE_v10020515mg           78.6    8e-15   
ref|XP_004152806.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   78.2    8e-15   
gb|ABK22816.1|  unknown                                               77.8    8e-15   Picea sitchensis
ref|XP_006478980.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   78.2    9e-15   
gb|ACU23289.1|  unknown                                               77.8    9e-15   Glycine max [soybeans]
ref|XP_003626494.1|  GDSL esterase/lipase                             76.6    1e-14   
ref|XP_003553275.1|  PREDICTED: GDSL esterase/lipase At5g33370        77.8    1e-14   
ref|XP_006287983.1|  hypothetical protein CARUB_v10001218mg           77.8    1e-14   
ref|XP_004494759.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   77.8    1e-14   
ref|NP_001053264.1|  Os04g0507700                                     77.8    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652494.1|  PREDICTED: GDSL esterase/lipase LTL1-like        77.8    1e-14   
gb|EYU19868.1|  hypothetical protein MIMGU_mgv1a008447mg              77.8    1e-14   
ref|XP_010243647.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   77.4    2e-14   
ref|XP_009386573.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   77.0    2e-14   
ref|XP_004302115.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   77.0    2e-14   
gb|EMT04884.1|  GDSL esterase/lipase                                  76.3    3e-14   
ref|XP_009405750.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   76.6    3e-14   
ref|NP_001047441.1|  Os02g0617400                                     76.6    3e-14   
gb|EAY86703.1|  hypothetical protein OsI_08086                        76.6    3e-14   
gb|KEH21597.1|  GDSL-like lipase/acylhydrolase                        76.3    3e-14   
gb|AES61163.2|  GDSL-like lipase/acylhydrolase                        75.1    3e-14   
ref|XP_007147233.1|  hypothetical protein PHAVU_006G107100g           76.6    3e-14   
ref|XP_004495557.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   76.3    4e-14   
ref|XP_003589465.1|  GDSL esterase/lipase                             76.3    4e-14   
ref|XP_003626493.1|  GDSL esterase/lipase                             75.9    4e-14   
ref|XP_008441804.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   76.3    5e-14   
gb|AFW63009.1|  hypothetical protein ZEAMMB73_059549                  74.7    5e-14   
ref|XP_004494758.1|  PREDICTED: GDSL esterase/lipase LTL1-like        75.9    5e-14   
gb|EYU39770.1|  hypothetical protein MIMGU_mgv1a009318mg              75.5    5e-14   
ref|XP_009385316.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   75.9    5e-14   
ref|XP_003590912.1|  GDSL esterase/lipase                             74.7    5e-14   
ref|XP_004155142.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   76.3    6e-14   
gb|AFW63007.1|  hypothetical protein ZEAMMB73_059549                  75.1    6e-14   
ref|XP_009379726.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   75.5    6e-14   
gb|EYU33157.1|  hypothetical protein MIMGU_mgv1a008646mg              75.5    7e-14   
gb|KFK24279.1|  hypothetical protein AALP_AAs47157U000200             75.5    7e-14   
ref|XP_004304788.1|  PREDICTED: GDSL esterase/lipase At5g18430-like   75.5    7e-14   
gb|AFW63010.1|  hypothetical protein ZEAMMB73_059549                  73.2    8e-14   
ref|XP_004955275.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   75.9    9e-14   
gb|KCW50155.1|  hypothetical protein EUGRSUZ_K03589                   74.3    9e-14   
ref|XP_010440677.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...  74.7    9e-14   
ref|NP_001048510.1|  Os02g0816200                                     75.1    1e-13   
ref|NP_001078631.1|  GDSL esterase/lipase                             74.7    1e-13   
gb|EAY88013.1|  hypothetical protein OsI_09436                        75.5    1e-13   
emb|CDX74196.1|  BnaA03g28510D                                        74.3    1e-13   
ref|XP_008677149.1|  PREDICTED: uncharacterized protein LOC100280...  75.1    1e-13   
gb|ACG31868.1|  anther-specific proline-rich protein APG precursor    74.7    1e-13   
gb|EMT15537.1|  GDSL esterase/lipase                                  73.2    1e-13   
ref|XP_010463906.1|  PREDICTED: GDSL esterase/lipase LTL1             74.3    2e-13   
ref|XP_010413520.1|  PREDICTED: GDSL esterase/lipase LTL1             74.3    2e-13   
ref|XP_008364335.1|  PREDICTED: GDSL esterase/lipase LTL1-like        74.3    2e-13   
ref|XP_010485798.1|  PREDICTED: GDSL esterase/lipase LTL1-like        74.7    2e-13   
ref|XP_006297961.1|  hypothetical protein CARUB_v10014002mg           74.3    2e-13   
ref|XP_004953113.1|  PREDICTED: GDSL esterase/lipase LTL1-like        74.3    2e-13   
ref|XP_009134760.1|  PREDICTED: GDSL esterase/lipase LTL1             74.3    2e-13   
ref|XP_006403052.1|  hypothetical protein EUTSA_v10003456mg           74.3    2e-13   
gb|AFW63005.1|  hypothetical protein ZEAMMB73_059549                  74.3    2e-13   
ref|XP_002884438.1|  Li-tolerant lipase 1                             74.3    2e-13   
ref|NP_187079.1|  Li-tolerant lipase 1                                74.3    2e-13   
ref|XP_006408203.1|  hypothetical protein EUTSA_v10020986mg           74.3    2e-13   
gb|KFK37853.1|  hypothetical protein AALP_AA3G037800                  74.3    2e-13   
ref|XP_010435380.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   73.9    2e-13   
ref|XP_010440676.1|  PREDICTED: GDSL esterase/lipase At5g33370 is...  73.9    3e-13   
ref|NP_001146667.1|  uncharacterized protein LOC100280267 precursor   74.3    3e-13   
ref|XP_010530492.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  73.9    3e-13   
ref|NP_198322.1|  GDSL esterase/lipase                                73.9    3e-13   
ref|XP_002868396.1|  GDSL-motif lipase/hydrolase family protein       73.6    3e-13   
ref|XP_009409705.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...  73.6    3e-13   
ref|XP_006283972.1|  hypothetical protein CARUB_v10005096mg           73.6    4e-13   
ref|XP_010038336.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   73.6    4e-13   
gb|AFW64012.1|  hypothetical protein ZEAMMB73_688590                  69.7    4e-13   
ref|XP_004513280.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   73.2    5e-13   
emb|CDX92063.1|  BnaC03g33650D                                        73.2    6e-13   
ref|XP_009124003.1|  PREDICTED: GDSL esterase/lipase LTL1-like        72.8    6e-13   
emb|CDY42916.1|  BnaC05g47350D                                        72.8    6e-13   
emb|CDY49349.1|  BnaA05g33110D                                        72.8    6e-13   
ref|XP_010558733.1|  PREDICTED: GDSL esterase/lipase LTL1             72.8    8e-13   
emb|CDY47551.1|  BnaA08g07360D                                        72.4    9e-13   
ref|XP_009108075.1|  PREDICTED: GDSL esterase/lipase At5g33370        72.4    9e-13   
ref|XP_002973035.1|  hypothetical protein SELMODRAFT_98492            72.4    9e-13   
ref|XP_008781788.1|  PREDICTED: GDSL esterase/lipase 7                72.8    1e-12   
emb|CDY12384.1|  BnaC08g08210D                                        72.4    1e-12   
ref|XP_007040555.1|  SGNH hydrolase-type esterase superfamily pro...  72.4    1e-12   
ref|XP_009796088.1|  PREDICTED: GDSL esterase/lipase At5g22810        72.0    1e-12   
ref|XP_002454777.1|  hypothetical protein SORBIDRAFT_04g037130        72.0    1e-12   
ref|XP_010528706.1|  PREDICTED: GDSL esterase/lipase LTL1-like        72.0    1e-12   
ref|XP_010925991.1|  PREDICTED: GDSL esterase/lipase 7                72.0    2e-12   
gb|ACJ84395.1|  unknown                                               70.1    2e-12   
ref|XP_010666212.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...  70.9    2e-12   
ref|XP_002964001.1|  hypothetical protein SELMODRAFT_166529           71.2    2e-12   
ref|XP_010684826.1|  PREDICTED: GDSL esterase/lipase At4g28780-like   71.6    2e-12   
ref|XP_002967924.1|  hypothetical protein SELMODRAFT_267148           71.2    2e-12   
gb|EYU23325.1|  hypothetical protein MIMGU_mgv1a007719mg              71.2    3e-12   
ref|XP_009776386.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...  69.3    3e-12   
gb|ACU23654.1|  unknown                                               70.9    4e-12   
ref|XP_006576592.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  70.5    4e-12   
gb|AFW64010.1|  hypothetical protein ZEAMMB73_688590                  70.9    4e-12   
ref|XP_003570388.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   70.9    4e-12   
ref|XP_008663512.1|  PREDICTED: GDSL esterase/lipase At4g16230-like   70.9    4e-12   
gb|KHG28969.1|  hypothetical protein F383_14762                       71.2    5e-12   
ref|XP_009625753.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...  70.5    5e-12   
ref|XP_009625752.1|  PREDICTED: GDSL esterase/lipase At5g22810 is...  70.5    5e-12   
gb|KHN18937.1|  GDSL esterase/lipase                                  70.5    5e-12   
ref|XP_008643799.1|  PREDICTED: anther-specific proline-rich prot...  70.5    5e-12   
ref|XP_003546013.1|  PREDICTED: GDSL esterase/lipase At5g45960        70.5    5e-12   
ref|XP_010666211.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...  70.5    5e-12   
ref|NP_001151440.1|  anther-specific proline-rich protein APG pre...  70.5    6e-12   
ref|XP_007142298.1|  hypothetical protein PHAVU_008G268800g           70.1    6e-12   
gb|ACU21127.1|  unknown                                               69.3    6e-12   
gb|AFW64011.1|  hypothetical protein ZEAMMB73_688590                  70.5    6e-12   
gb|EYU28037.1|  hypothetical protein MIMGU_mgv1a008421mg              70.1    7e-12   
ref|XP_002988966.1|  hypothetical protein SELMODRAFT_128884           70.1    7e-12   
ref|XP_003520948.1|  PREDICTED: GDSL esterase/lipase At5g33370-li...  69.7    9e-12   
gb|ACU23725.1|  unknown                                               69.7    9e-12   
gb|AFK33602.1|  unknown                                               69.7    9e-12   
ref|XP_003600129.1|  GDSL esterase/lipase                             69.7    9e-12   
ref|XP_004509383.1|  PREDICTED: GDSL esterase/lipase EXL3-like        69.7    9e-12   
ref|XP_006466217.1|  PREDICTED: GDSL esterase/lipase At5g08460-like   69.7    1e-11   
gb|KEH28987.1|  GDSL-like lipase/acylhydrolase                        69.3    1e-11   
ref|XP_004511507.1|  PREDICTED: GDSL esterase/lipase At5g08460-like   69.3    1e-11   
emb|CDX86830.1|  BnaA09g22200D                                        69.3    1e-11   
gb|KFK31875.1|  hypothetical protein AALP_AA6G170000                  69.3    1e-11   
ref|XP_010524116.1|  PREDICTED: GDSL esterase/lipase At2g42990        68.9    2e-11   
gb|KDO38222.1|  hypothetical protein CISIN_1g042326mg                 67.0    2e-11   
emb|CDY40864.1|  BnaC09g26010D                                        69.3    2e-11   
ref|XP_009108210.1|  PREDICTED: GDSL esterase/lipase At5g08460        69.3    2e-11   
ref|XP_006361071.1|  PREDICTED: GDSL esterase/lipase At5g45960-like   68.9    2e-11   
gb|KDP25283.1|  hypothetical protein JCGZ_20439                       68.9    2e-11   
ref|XP_006443680.1|  hypothetical protein CICLE_v10020728mg           68.9    2e-11   
ref|XP_006396987.1|  hypothetical protein EUTSA_v10028704mg           68.9    2e-11   
ref|XP_010921443.1|  PREDICTED: GDSL esterase/lipase At4g16230 is...  68.9    2e-11   
ref|XP_002448325.1|  hypothetical protein SORBIDRAFT_06g025280        68.9    2e-11   
ref|XP_010529639.1|  PREDICTED: GDSL esterase/lipase At5g08460        68.9    2e-11   
ref|XP_010921444.1|  PREDICTED: GDSL esterase/lipase At4g16230 is...  68.9    2e-11   
ref|XP_009776385.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...  68.2    2e-11   
ref|XP_006352215.1|  PREDICTED: GDSL esterase/lipase At5g41890-like   68.6    2e-11   
ref|XP_004248462.1|  PREDICTED: GDSL esterase/lipase At5g45960-like   68.6    2e-11   
ref|XP_002963776.1|  hypothetical protein SELMODRAFT_80714            68.9    2e-11   
ref|XP_009361010.1|  PREDICTED: GDSL esterase/lipase At5g55050-like   68.6    3e-11   
gb|ACU17710.1|  unknown                                               67.0    3e-11   
ref|XP_009776384.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...  68.6    3e-11   
ref|XP_002974862.1|  hypothetical protein SELMODRAFT_102199           68.6    3e-11   
ref|NP_196463.1|  GDSL esterase/lipase                                68.6    3e-11   
ref|XP_008442893.1|  PREDICTED: GDSL esterase/lipase At5g45960-like   68.6    3e-11   
ref|XP_003518328.2|  PREDICTED: GDSL esterase/lipase At2g30310-like   68.2    3e-11   
ref|XP_009776383.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...  68.2    3e-11   
gb|KHN11913.1|  GDSL esterase/lipase                                  68.2    3e-11   
ref|XP_006377451.1|  GDSL-motif lipase/hydrolase family protein       68.2    3e-11   
ref|XP_011082289.1|  PREDICTED: GDSL esterase/lipase 7                68.6    3e-11   
ref|XP_007133949.1|  hypothetical protein PHAVU_010G005800g           68.2    3e-11   
ref|XP_002451978.1|  hypothetical protein SORBIDRAFT_04g011320        68.6    3e-11   
gb|EAY89729.1|  hypothetical protein OsI_11268                        68.2    3e-11   
dbj|BAJ91997.1|  predicted protein                                    68.2    4e-11   
ref|XP_004952266.1|  PREDICTED: GDSL esterase/lipase 7-like           68.2    4e-11   
ref|NP_001170226.1|  hypothetical protein precursor                   68.2    4e-11   
ref|XP_004158854.1|  PREDICTED: GDSL esterase/lipase EXL3-like        68.2    4e-11   
ref|XP_004134848.1|  PREDICTED: GDSL esterase/lipase EXL3-like        68.2    4e-11   
dbj|BAJ90848.1|  predicted protein                                    68.2    4e-11   
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                        68.2    4e-11   
gb|KGN57733.1|  hypothetical protein Csa_3G270280                     68.2    4e-11   
ref|XP_004165065.1|  PREDICTED: GDSL esterase/lipase At1g71691-like   68.2    4e-11   
ref|XP_004145656.1|  PREDICTED: GDSL esterase/lipase At1g71691-like   68.2    4e-11   
gb|ABK23063.1|  unknown                                               65.9    4e-11   
emb|CCI55370.1|  PH01B035L11.15                                       68.6    4e-11   
ref|XP_010422022.1|  PREDICTED: uncharacterized protein At4g10930...  69.3    4e-11   
gb|EMT14508.1|  GDSL esterase/lipase                                  67.8    4e-11   
ref|XP_002874658.1|  GDSL-motif lipase/hydrolase family protein       67.8    5e-11   
ref|XP_003600128.1|  GDSL esterase/lipase                             67.8    5e-11   
gb|KCW61468.1|  hypothetical protein EUGRSUZ_H04205                   67.0    5e-11   
ref|XP_006349065.1|  PREDICTED: GDSL esterase/lipase At5g22810-like   67.4    5e-11   
gb|EMT16609.1|  GDSL esterase/lipase                                  67.8    5e-11   
ref|XP_010419187.1|  PREDICTED: GDSL esterase/lipase At3g14820-like   67.4    6e-11   
ref|XP_011096384.1|  PREDICTED: GDSL esterase/lipase At5g45960        67.4    6e-11   
ref|XP_002871337.1|  hypothetical protein ARALYDRAFT_908816           65.5    6e-11   
ref|XP_006649974.1|  PREDICTED: GDSL esterase/lipase At4g16230-like   67.4    6e-11   
ref|XP_010062556.1|  PREDICTED: GDSL esterase/lipase APG              67.4    6e-11   
ref|XP_003572819.1|  PREDICTED: GDSL esterase/lipase 7-like           67.4    6e-11   
ref|XP_006298028.1|  hypothetical protein CARUB_v10014074mg           67.4    6e-11   
ref|XP_006829180.1|  hypothetical protein AMTR_s00001p00270900        64.3    6e-11   
tpg|DAA57787.1|  TPA: hypothetical protein ZEAMMB73_753900            64.3    7e-11   
ref|NP_001049914.1|  Os03g0310000                                     67.4    7e-11   
gb|EMT10345.1|  GDSL esterase/lipase 7                                67.4    7e-11   
ref|NP_567372.1|  SGNH hydrolase-type esterase superfamily protein    67.4    7e-11   
gb|AAC33954.1|  similar to the GDSL family of lipolytic enzymes       68.2    7e-11   
ref|NP_001144279.1|  hypothetical protein precursor                   65.1    7e-11   
emb|CAB40063.1|  putative protein                                     68.2    7e-11   
ref|XP_006852535.1|  hypothetical protein AMTR_s00021p00183530        66.6    7e-11   
gb|AGT16713.1|  GDSL esterase/lipase                                  67.0    8e-11   
gb|KDO62057.1|  hypothetical protein CISIN_1g0356442mg                64.7    8e-11   
ref|XP_004485861.1|  PREDICTED: GDSL esterase/lipase At5g45960-like   67.0    8e-11   
ref|XP_009146144.1|  PREDICTED: GDSL esterase/lipase APG              67.0    8e-11   
ref|XP_008237333.1|  PREDICTED: GDSL esterase/lipase At4g16230-like   67.0    8e-11   
ref|XP_011084387.1|  PREDICTED: GDSL esterase/lipase At5g33370-like   67.0    9e-11   
ref|XP_011021005.1|  PREDICTED: GDSL esterase/lipase At2g31550-like   67.0    1e-10   
ref|XP_010266001.1|  PREDICTED: GDSL esterase/lipase EXL3-like        67.0    1e-10   
ref|XP_002967552.1|  hypothetical protein SELMODRAFT_408654           66.6    1e-10   
ref|XP_004251004.1|  PREDICTED: GDSL esterase/lipase At5g22810        66.6    1e-10   
ref|XP_010676275.1|  PREDICTED: GDSL esterase/lipase At5g08460-like   67.0    1e-10   
ref|XP_010455488.1|  PREDICTED: GDSL esterase/lipase At5g08460-like   67.0    1e-10   
ref|XP_008364881.1|  PREDICTED: GDSL esterase/lipase At5g55050-like   67.0    1e-10   
ref|XP_010436626.1|  PREDICTED: GDSL esterase/lipase At5g08460-like   67.0    1e-10   
ref|XP_010422026.1|  PREDICTED: GDSL esterase/lipase At5g08460-li...  67.4    1e-10   
ref|XP_010266003.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...  67.0    1e-10   
ref|XP_006426401.1|  hypothetical protein CICLE_v10027519mg           66.6    1e-10   
ref|XP_009600712.1|  PREDICTED: GDSL esterase/lipase At2g24560-like   66.6    1e-10   
ref|XP_009789463.1|  PREDICTED: GDSL esterase/lipase At2g24560-like   66.6    1e-10   
ref|XP_002981792.1|  hypothetical protein SELMODRAFT_421228           66.2    1e-10   
gb|KHN25636.1|  GDSL esterase/lipase                                  66.6    1e-10   
ref|XP_008239176.1|  PREDICTED: GDSL esterase/lipase At1g71691-like   67.0    1e-10   
ref|XP_006289976.1|  hypothetical protein CARUB_v10003606mg           66.6    1e-10   
ref|XP_009784175.1|  PREDICTED: GDSL esterase/lipase At5g45960-like   64.7    1e-10   
gb|EYU27351.1|  hypothetical protein MIMGU_mgv1a008471mg              66.6    1e-10   
ref|XP_003615938.1|  GDSL esterase/lipase                             66.6    1e-10   
ref|XP_003516723.2|  PREDICTED: GDSL esterase/lipase At5g08460-like   66.6    1e-10   
ref|XP_006371372.1|  GDSL-motif lipase/hydrolase family protein       66.6    1e-10   
ref|XP_010266002.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...  66.6    1e-10   
ref|XP_007210864.1|  hypothetical protein PRUPE_ppa015053mg           66.6    1e-10   
gb|KDP23988.1|  hypothetical protein JCGZ_25376                       66.2    2e-10   
tpg|DAA57788.1|  TPA: hypothetical protein ZEAMMB73_753900            64.3    2e-10   
emb|CDY30167.1|  BnaC05g36950D                                        66.2    2e-10   
ref|XP_003593693.1|  GDSL esterase/lipase                             66.2    2e-10   
ref|XP_011015230.1|  PREDICTED: GDSL esterase/lipase At1g71250-like   65.9    2e-10   
ref|XP_010545226.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...  66.2    2e-10   
ref|XP_010545227.1|  PREDICTED: GDSL esterase/lipase At5g55050-li...  66.2    2e-10   
ref|XP_002889628.1|  GDSL-motif lipase/hydrolase family protein       66.2    2e-10   
gb|EPS69683.1|  hypothetical protein M569_05083                       65.9    2e-10   
ref|XP_003526907.1|  PREDICTED: GDSL esterase/lipase At5g08460        66.2    2e-10   
ref|XP_002965163.1|  hypothetical protein SELMODRAFT_230518           65.9    2e-10   
ref|XP_010429305.1|  PREDICTED: GDSL esterase/lipase At2g23540        66.2    2e-10   
ref|XP_008780047.1|  PREDICTED: GDSL esterase/lipase At2g40250-like   64.3    2e-10   
ref|XP_002975075.1|  hypothetical protein SELMODRAFT_232422           65.9    2e-10   
ref|XP_002962248.1|  hypothetical protein SELMODRAFT_77657            65.9    2e-10   
ref|XP_010685878.1|  PREDICTED: GDSL esterase/lipase At2g30310-like   65.9    2e-10   
ref|XP_004490678.1|  PREDICTED: GDSL esterase/lipase At2g30310-like   65.9    2e-10   
ref|XP_002509978.1|  zinc finger protein, putative                    66.2    2e-10   
ref|XP_001781861.1|  predicted protein                                65.9    2e-10   
ref|XP_010680078.1|  PREDICTED: uncharacterized protein LOC104895310  67.0    2e-10   



>ref|XP_008345732.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Malus domestica]
Length=370

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            L+ ++  I+   S      QV EG RA FVFGDSLVD GNNNY+ S ARADS PYG+D+P
Sbjct  7    LMIYLIVIVSNYSIGPQMVQVAEGSRAFFVFGDSLVDNGNNNYLISIARADSYPYGIDFP  66

Query  282  THSPTGRFSN  311
            TH PTGRFSN
Sbjct  67   THRPTGRFSN  76



>ref|XP_004489545.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=366

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 9/71 (13%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L++  I FI+G          V+   RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY
Sbjct  12   LIIFSIVFIVGG---------VEAKSRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDY  62

Query  279  PTHSPTGRFSN  311
            PTH+PTGRFSN
Sbjct  63   PTHAPTGRFSN  73



>gb|EPS58999.1| hypothetical protein M569_15814, partial [Genlisea aurea]
Length=74

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+D+P+H PTGRFSN
Sbjct  18   EGGRAFFVFGDSLVDSGNNNYLATTARADAPPYGIDFPSHRPTGRFSN  65



>ref|XP_003626498.1| GDSL esterase/lipase [Medicago truncatula]
Length=86

 Score = 84.7 bits (208),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +3

Query  99   LLLCF-IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            L++ F IF ++G    +      D  +RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D
Sbjct  10   LMISFGIFLVIGVIVPA----DADSKQRAFFVFGDSLVDSGNNNYLVTTARADSPPYGID  65

Query  276  YPTHSPTGRFSN  311
            YPT  PTGRFSN
Sbjct  66   YPTGRPTGRFSN  77



>gb|EPS72894.1| hypothetical protein M569_01863, partial [Genlisea aurea]
Length=198

 Score = 87.4 bits (215),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 5/64 (8%)
 Frame = +3

Query  120  FILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTG  299
            F+L AS  S    +  EGR A FVFGDSLVD+GNNNY+ + ARAD+PPYG+DYPTH PTG
Sbjct  4    FVLAASLVS----RPAEGR-AFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPTHRPTG  58

Query  300  RFSN  311
            RFSN
Sbjct  59   RFSN  62



>gb|KDP23752.1| hypothetical protein JCGZ_23585 [Jatropha curcas]
Length=145

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = +3

Query  114  IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSP  293
            IF +  A+ S     QV+   RALFVFGDSLVD+GNNNY+ + ARADS PYG+DYP+H P
Sbjct  3    IFLLALATISIDVVLQVEA--RALFVFGDSLVDSGNNNYLATIARADSSPYGIDYPSHRP  60

Query  294  TGRFSN  311
            TGRFSN
Sbjct  61   TGRFSN  66



>ref|XP_006443291.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 ref|XP_006478981.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Citrus sinensis]
 gb|ESR56531.1| hypothetical protein CICLE_v10020640mg [Citrus clementina]
 gb|KDO52502.1| hypothetical protein CISIN_1g017181mg [Citrus sinensis]
Length=376

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 11/91 (12%)
 Frame = +3

Query  39   AMAIARSCPTTDEKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAG  218
            +MAIA S  +   + ++           I+G + +  +  ++ EGR A FVFGDSLVD+G
Sbjct  2    SMAIATSSASVAMRSWM----------MIIGIAFALGSIVRLAEGR-AFFVFGDSLVDSG  50

Query  219  NNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            NNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  51   NNNYLATTARADAPPYGIDFPTHRPTGRFSN  81



>ref|XP_002303095.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE82368.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=370

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  29   EAARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSN  76



>ref|XP_011024535.1| PREDICTED: GDSL esterase/lipase At4g28780 [Populus euphratica]
Length=370

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  29   EAARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSN  76



>ref|XP_010043320.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Eucalyptus grandis]
 gb|KCW85325.1| hypothetical protein EUGRSUZ_B02164 [Eucalyptus grandis]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  111  FIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHS  290
            ++  +L A+  +A      E  RA F+FGDSLVD GNNNY+ + ARADSPPYG+DYPTH 
Sbjct  10   WLALVLVAALGTALAPLRAEAARAFFIFGDSLVDNGNNNYLATTARADSPPYGIDYPTHR  69

Query  291  PTGRFSN  311
            PTGRFSN
Sbjct  70   PTGRFSN  76



>ref|XP_009777585.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Nicotiana 
sylvestris]
Length=317

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +3

Query  120  FILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTG  299
             IL  S  S + H+V+   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYP+H PTG
Sbjct  16   IILMLSLFSFSLHKVEA--RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPSHRPTG  73

Query  300  RFSN  311
            RFSN
Sbjct  74   RFSN  77



>ref|XP_010492845.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Camelina sativa]
Length=369

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V EG RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  29   VVEGGRAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTRRPTGRFSN  78



>ref|XP_006340478.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=360

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 2/53 (4%)
 Frame = +3

Query  159  QVDEG--RRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +V EG   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  15   RVVEGAAERAFFVFGDSLVDTGNNNYLATSARADSPPYGIDYPTHRPTGRFSN  67



>ref|XP_009587010.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=367

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 50/76 (66%), Gaps = 13/76 (17%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +L MV    F+ +  GA+             RA FVFGDSLVD GNNNY+ + ARADSPP
Sbjct  13   FLAMVSTATFVTYTEGAA-------------RAFFVFGDSLVDNGNNNYLATSARADSPP  59

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH PTGRFSN
Sbjct  60   YGVDYPTHRPTGRFSN  75



>ref|XP_011076887.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=369

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTHRPTGRFSN  75



>ref|XP_010918935.1| PREDICTED: GDSL esterase/lipase LTL1 [Elaeis guineensis]
Length=364

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            LL F   +L    + +   +     RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYP
Sbjct  6    LLTFFLAVLATLGTLSTMSEA----RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYP  61

Query  282  THSPTGRFSN  311
            TH PTGRFSN
Sbjct  62   THQPTGRFSN  71



>ref|XP_004494761.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=373

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 5/72 (7%)
 Frame = +3

Query  99   LLLCF-IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            L++CF IF ++G           D   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D
Sbjct  13   LVICFGIFLVVGVIVPVEG----DSKPRAFFVFGDSLVDSGNNNYLATTARADSPPYGID  68

Query  276  YPTHSPTGRFSN  311
            YPT  PTGRFSN
Sbjct  69   YPTGRPTGRFSN  80



>gb|KDP23750.1| hypothetical protein JCGZ_23583 [Jatropha curcas]
Length=134

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTHQPTGRFSN  72



>emb|CDP03830.1| unnamed protein product [Coffea canephora]
Length=368

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  28   EAARAFFVFGDSLVDNGNNNYLLTTARADSPPYGIDYPTHRPTGRFSN  75



>ref|XP_002325359.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
 gb|EEE99740.2| hypothetical protein POPTR_0019s04110g [Populus trichocarpa]
Length=405

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  108  CFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTH  287
            CFI  ILG   + A+     E R A FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPTH
Sbjct  46   CFISLILGLVITLASVIPEVEAR-AFFVFGDSLVDNGNNNYLATTARADAPPYGVDYPTH  104

Query  288  SPTGRFSN  311
              TGRFSN
Sbjct  105  RATGRFSN  112



>ref|XP_011002019.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=367

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = +3

Query  108  CFIFFILG-ASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            CFI  ILG   + S+ T +V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT
Sbjct  8    CFISLILGLVITLSSVTPEVEA--RAFFVFGDSLVDNGNNNYLVTTARADAPPYGVDYPT  65

Query  285  HSPTGRFSN  311
            H  TGRFSN
Sbjct  66   HRATGRFSN  74



>gb|AFW58802.1| hypothetical protein ZEAMMB73_832786 [Zea mays]
Length=131

 Score = 83.6 bits (205),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 8/80 (10%)
 Frame = +3

Query  72   DEKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARA  251
            D    + +++       +LGA+S+S          RA FVFGDSLVD GNNNY+ + ARA
Sbjct  2    DAALLVTVLVPAVAALLVLGAASASP--------PRAFFVFGDSLVDNGNNNYLMTTARA  53

Query  252  DSPPYGLDYPTHSPTGRFSN  311
            D+PPYG+D+PTH PTGRFSN
Sbjct  54   DAPPYGIDFPTHLPTGRFSN  73



>ref|XP_011083095.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Sesamum 
indicum]
 ref|XP_011083096.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Sesamum 
indicum]
Length=300

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  23   EGARAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTRRPTGRFSN  70



>gb|KHN43143.1| GDSL esterase/lipase [Glycine soja]
Length=279

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  28   VEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  77



>gb|AEY85024.1| zinc finger protein [Cajanus cajan]
Length=369

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD+GNN+Y+ + ARADSPPYG DYPTH PTGRFSN
Sbjct  28   EGARAFFVFGDSLVDSGNNDYLPTTARADSPPYGTDYPTHRPTGRFSN  75



>gb|KDO46628.1| hypothetical protein CISIN_1g041652mg [Citrus sinensis]
Length=368

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 9/71 (13%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            ++L  +F ++ A  + A         RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY
Sbjct  12   IVLGLVFALIVAPQAEA---------RAFFVFGDSLVDVGNNNYLATIARADAPPYGIDY  62

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  63   PTHRPTGRFSN  73



>ref|XP_006437267.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
 gb|ESR50507.1| hypothetical protein CICLE_v10033835mg [Citrus clementina]
Length=368

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 9/71 (13%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            ++L  +F ++ A  + A         RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY
Sbjct  12   IVLGLVFALIVAPQAEA---------RAFFVFGDSLVDVGNNNYLATIARADAPPYGIDY  62

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  63   PTHRPTGRFSN  73



>gb|AAP35038.1| putative GDSL-motif lipase [Vitis vinifera]
Length=175

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA F+FGDSLV+ GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  12   EAARAFFIFGDSLVEQGNNNYLATTARADSPPYGIDYPTHQATGRFSN  59



>ref|XP_006484791.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
Length=368

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 9/71 (13%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            ++L  +F ++ A  + A         RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY
Sbjct  12   IVLGLVFALIVAPQAEA---------RAFFVFGDSLVDVGNNNYLATIARADAPPYGIDY  62

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  63   PTHRPTGRFSN  73



>ref|XP_007201335.1| hypothetical protein PRUPE_ppa007652mg [Prunus persica]
 gb|EMJ02534.1| hypothetical protein PRUPE_ppa007652mg [Prunus persica]
Length=360

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PTH PTGRFSN
Sbjct  21   EAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPTHRPTGRFSN  68



>ref|XP_011002017.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Populus euphratica]
Length=364

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  27   RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTHRPTGRFSN  71



>ref|XP_009769587.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana sylvestris]
Length=369

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGR--RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L FI  ++   S +   + V +G   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DY
Sbjct  6    LSFILRVILTLSFAILQNGVIKGVEGRAFFVFGDSLVDNGNNNYLATSARADSPPYGVDY  65

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  66   PTHRPTGRFSN  76



>emb|CDO99962.1| unnamed protein product [Coffea canephora]
Length=368

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYGLDYPTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLVTSARADSPPYGLDYPTHRPTGRFSN  76



>gb|KEH42418.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  153  THQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            T +V    RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYP H PTGRFSN
Sbjct  24   TMRVQAASRAFFVFGDSLVDSGNNNYLLTTARADSPPYGIDYPGHRPTGRFSN  76



>ref|XP_009777584.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
Length=370

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = +3

Query  120  FILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTG  299
             IL  S  S + H+V+   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYP+H PTG
Sbjct  16   IILMLSLFSFSLHKVEA--RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPSHRPTG  73

Query  300  RFSN  311
            RFSN
Sbjct  74   RFSN  77



>ref|XP_009591832.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=370

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  33   RAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSN  77



>ref|XP_008810066.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=366

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTHQPTGRFSN  73



>ref|XP_002325361.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
 gb|EEE99742.2| hypothetical protein POPTR_0019s04140g [Populus trichocarpa]
Length=364

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYP+H PTGRFSN
Sbjct  27   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPSHRPTGRFSN  71



>ref|XP_011077072.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 53/80 (66%), Gaps = 12/80 (15%)
 Frame = +3

Query  72   DEKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARA  251
            + ++YL  + +L     +LG  S+           RA FVFGDSLVD GNNNY+ + ARA
Sbjct  7    NSRFYLVFLFVL-----MLGNLSTRVEA-------RAFFVFGDSLVDNGNNNYLATTARA  54

Query  252  DSPPYGLDYPTHSPTGRFSN  311
            D+PPYG+DYPTH PTGRFSN
Sbjct  55   DAPPYGIDYPTHRPTGRFSN  74



>ref|XP_008235540.1| PREDICTED: GDSL esterase/lipase At4g28780 [Prunus mume]
Length=374

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PTH PTGRFSN
Sbjct  36   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDFPTHRPTGRFSN  80



>gb|KHN14797.1| GDSL esterase/lipase [Glycine soja]
Length=155

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  96   VLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            V   C    ++ A + S    +  E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D
Sbjct  6    VFTSCIFLSLVIALAISGFNFKGSEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGID  65

Query  276  YPTHSPTGRFSN  311
            YPT  PTGRFSN
Sbjct  66   YPTRRPTGRFSN  77



>gb|AAS75127.1| GDSL-motif lipase [Agave americana]
Length=367

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTHRPTGRFSN  74



>ref|XP_006854343.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
 gb|ERN15810.1| hypothetical protein AMTR_s00039p00143210 [Amborella trichopoda]
Length=362

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 7/73 (10%)
 Frame = +3

Query  93   MVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGL  272
            + L++C +  +L    +++         RA FVFGDSLVD GNN+Y+ + ARAD+PPYG+
Sbjct  5    LALMVCLLGLVLSTQVATSEA-------RAFFVFGDSLVDNGNNDYLATTARADNPPYGI  57

Query  273  DYPTHSPTGRFSN  311
            DYPTH PTGRFSN
Sbjct  58   DYPTHRPTGRFSN  70



>ref|XP_004237506.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
Length=363

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  174  RRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
             RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  25   ERAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTHRPTGRFSN  70



>ref|XP_009766488.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana sylvestris]
Length=366

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  144  SANTHQVDEGR-RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +AN     EG  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  18   TANFVTYTEGAPRAFFVFGDSLVDNGNNNYLATSARADSPPYGVDYPTHRPTGRFSN  74



>gb|AES82718.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 5/72 (7%)
 Frame = +3

Query  99   LLLCF-IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            L++ F IF ++G    +      D  +RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D
Sbjct  10   LMISFGIFLVIGVIVPA----DADSKQRAFFVFGDSLVDSGNNNYLVTTARADSPPYGID  65

Query  276  YPTHSPTGRFSN  311
            YPT  PTGRFSN
Sbjct  66   YPTGRPTGRFSN  77



>gb|ACR33100.1| putative tea geometrid larvae-inducible protein [Camellia sinensis]
Length=367

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 51/74 (69%), Gaps = 9/74 (12%)
 Frame = +3

Query  90   CMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYG  269
            CMVL L  +         SA   Q +   RA FVFGDSLVD+GNN+Y+ + ARAD+PPYG
Sbjct  10   CMVLCLVLVL-------GSALAPQAEA--RAFFVFGDSLVDSGNNDYLATTARADNPPYG  60

Query  270  LDYPTHSPTGRFSN  311
            +DYPTH PTGRFSN
Sbjct  61   IDYPTHRPTGRFSN  74



>ref|XP_011083094.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Sesamum 
indicum]
Length=363

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  23   EGARAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTRRPTGRFSN  70



>ref|NP_194607.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SVU5.1|GDL67_ARATH RecName: Full=GDSL esterase/lipase At4g28780; AltName: Full=Extracellular 
lipase At4g28780; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA22974.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 emb|CAB81466.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 gb|AAM64722.1| Proline-rich APG-like protein [Arabidopsis thaliana]
 gb|AAO22802.1| putative proline-rich APG protein [Arabidopsis thaliana]
 gb|AAO42459.1| putative proline-rich APG protein [Arabidopsis thaliana]
 gb|AEE85543.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=367

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            LL +I   +  S +     Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYP
Sbjct  5    LLTWIIMTVALSVTLFLMPQQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYP  64

Query  282  THSPTGRFSN  311
            T  PTGRFSN
Sbjct  65   TGRPTGRFSN  74



>gb|AFK33443.1| unknown [Lotus japonicus]
Length=210

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  42   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  86



>ref|XP_009631850.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nicotiana tomentosiformis]
Length=380

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 7/66 (11%)
 Frame = +3

Query  114  IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSP  293
            +F ILG + S A         RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   
Sbjct  28   LFLILGVAISQAEA-------RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRA  80

Query  294  TGRFSN  311
            TGRFSN
Sbjct  81   TGRFSN  86



>ref|XP_003521784.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN35334.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 6/74 (8%)
 Frame = +3

Query  90   CMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYG  269
            CMV   C+I+ +LG            E +RA FVFGDSLVD GNNN++ + ARAD+PPYG
Sbjct  4    CMVYA-CYIYIVLGILVLKG-----AEAQRAFFVFGDSLVDNGNNNFLATTARADAPPYG  57

Query  270  LDYPTHSPTGRFSN  311
            +D+PT  PTGRFSN
Sbjct  58   IDFPTGRPTGRFSN  71



>ref|XP_007162645.1| hypothetical protein PHAVU_001G168200g [Phaseolus vulgaris]
 gb|ESW34639.1| hypothetical protein PHAVU_001G168200g [Phaseolus vulgaris]
Length=393

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  53   EASRAFYVFGDSLVDSGNNNYLATPARADSPPYGIDYPTHLPTGRFSN  100



>ref|XP_008443762.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Cucumis 
melo]
Length=329

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +3

Query  96   VLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            V +L  +  IL A ++ A      E  RA FVFGDSLVD GNNNY+ + ARADS PYG+D
Sbjct  7    VAILGVVLAILAALTAQA------EAGRAFFVFGDSLVDNGNNNYLATTARADSYPYGID  60

Query  276  YPTHSPTGRFSN  311
            +PTH PTGRFSN
Sbjct  61   FPTHRPTGRFSN  72



>ref|XP_003521785.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  23   VEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  72



>gb|KHN35335.1| GDSL esterase/lipase [Glycine soja]
Length=349

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  7    VEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  56



>ref|XP_003554733.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  28   VEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  77



>ref|XP_006350316.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Solanum tuberosum]
Length=363

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNN++ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  27   RAFFVFGDSLVDNGNNNFLATTARADSPPYGVDYPTHRPTGRFSN  71



>ref|XP_004247304.1| PREDICTED: GDSL esterase/lipase At4g28780 [Solanum lycopersicum]
Length=367

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNN++ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDNGNNNFLATTARADSPPYGVDYPTHRPTGRFSN  75



>gb|ACU23502.1| unknown [Glycine max]
Length=370

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  28   VEAKARAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  77



>ref|XP_004489173.1| PREDICTED: GDSL esterase/lipase LTL1-like [Cicer arietinum]
Length=370

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +V+   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  27   RVEARPRAFFVFGDSLVDNGNNNYLHTNARADSPPYGIDYPTHRPTGRFSN  77



>ref|XP_003536954.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Glycine max]
Length=367

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = +3

Query  87   LCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPY  266
            + M+L L  +  ++       NT  V E  R  FVFGDSLVD+GNNNY+ + ARADSPPY
Sbjct  7    VLMILTLVVVTLLI-------NTKSV-ESARTFFVFGDSLVDSGNNNYLPTTARADSPPY  58

Query  267  GLDYPTHSPTGRFSN  311
            G+DYPT  PTGRFSN
Sbjct  59   GIDYPTRRPTGRFSN  73



>ref|XP_002265999.1| PREDICTED: GDSL esterase/lipase At4g28780 [Vitis vinifera]
 emb|CBI37236.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 6/71 (8%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L +  +  +LG  +  A      E  RA F+FGDSLV+ GNNNY+ + ARADSPPYG+DY
Sbjct  11   LTVALVVAVLGTVAPHA------EAARAFFIFGDSLVEQGNNNYLATTARADSPPYGIDY  64

Query  279  PTHSPTGRFSN  311
            PTH  TGRFSN
Sbjct  65   PTHQATGRFSN  75



>ref|XP_002467122.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
 gb|EER94120.1| hypothetical protein SORBIDRAFT_01g020000 [Sorghum bicolor]
Length=352

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  7    ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  54



>ref|XP_011077073.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g33370-like 
[Sesamum indicum]
Length=368

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTHRPTGRFSN  75



>emb|CDY06871.1| BnaC01g09700D [Brassica napus]
Length=361

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 9/69 (13%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            LC   F++   +++A         RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT
Sbjct  9    LCVTLFLMPQQTNAA---------RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  59

Query  285  HSPTGRFSN  311
              PTGRFSN
Sbjct  60   GRPTGRFSN  68



>ref|XP_009129278.1| PREDICTED: GDSL esterase/lipase At4g28780 [Brassica rapa]
Length=361

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 49/69 (71%), Gaps = 9/69 (13%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            LC   F++   +++A         RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT
Sbjct  9    LCVTLFLMPQQTNAA---------RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  59

Query  285  HSPTGRFSN  311
              PTGRFSN
Sbjct  60   GRPTGRFSN  68



>ref|XP_007144437.1| hypothetical protein PHAVU_007G156000g [Phaseolus vulgaris]
 gb|ESW16431.1| hypothetical protein PHAVU_007G156000g [Phaseolus vulgaris]
Length=366

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  R   VFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH+PTGRFSN
Sbjct  24   EAARTFLVFGDSLVDSGNNNYLPTTARADSPPYGIDYPTHTPTGRFSN  71



>ref|XP_009801786.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana sylvestris]
Length=361

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  25   RAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRPTGRFSN  69



>ref|XP_002522020.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40424.1| zinc finger protein, putative [Ricinus communis]
Length=364

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  117  FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPT  296
              ILG   +  +   V E R A FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT  PT
Sbjct  8    MMILGLVLTLGSVAHVTEAR-AFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPT  66

Query  297  GRFSN  311
            GRFSN
Sbjct  67   GRFSN  71



>ref|XP_010674245.1| PREDICTED: GDSL esterase/lipase At5g33370 [Beta vulgaris subsp. 
vulgaris]
Length=365

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  165  DEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
              G RALFVFGDSLVD+GNNN++ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  24   QNGPRALFVFGDSLVDSGNNNFLATTARADSPPYGIDYPTHIATGRFSN  72



>ref|XP_004242381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=361

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  25   RAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRPTGRFSN  69



>ref|XP_006660400.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Oryza brachyantha]
Length=367

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +  RALFVFGDSLVD+GNNNY+ + ARADSPPYGLDYPTH  TGRFSN
Sbjct  25   QAARALFVFGDSLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSN  72



>ref|XP_008443761.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Cucumis 
melo]
Length=366

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 50/72 (69%), Gaps = 6/72 (8%)
 Frame = +3

Query  96   VLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            V +L  +  IL A ++ A      E  RA FVFGDSLVD GNNNY+ + ARADS PYG+D
Sbjct  7    VAILGVVLAILAALTAQA------EAGRAFFVFGDSLVDNGNNNYLATTARADSYPYGID  60

Query  276  YPTHSPTGRFSN  311
            +PTH PTGRFSN
Sbjct  61   FPTHRPTGRFSN  72



>gb|EYU39534.1| hypothetical protein MIMGU_mgv1a008648mg [Erythranthe guttata]
Length=367

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSN  74



>gb|ABX75139.1| lipase [Gossypium hirsutum]
Length=367

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +3

Query  117  FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPT  296
            + ILG   + ++T QV+   RA FVFGDSLVD GNNNY+ + ARADSPPYG+D P+  PT
Sbjct  9    WLILGVLMAISST-QVEAAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDTPSRHPT  67

Query  297  GRFSN  311
            GRFSN
Sbjct  68   GRFSN  72



>gb|EPS69813.1| hypothetical protein M569_04951, partial [Genlisea aurea]
Length=337

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  2    RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSN  46



>ref|XP_009589092.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Nicotiana tomentosiformis]
Length=363

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  27   RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPTHRPTGRFSN  71



>ref|XP_002522021.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40425.1| zinc finger protein, putative [Ricinus communis]
Length=368

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+D+PTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTHRPTGRFSN  75



>gb|ACU18148.1| unknown [Glycine max]
Length=264

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  30   EAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSN  77



>gb|KHN14888.1| GDSL esterase/lipase [Glycine soja]
Length=212

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  67   PTHRPTGRFSN  77



>gb|ACR37591.1| unknown [Zea mays]
Length=369

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  28   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  75



>ref|XP_006352714.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRPTGRFSN  72



>ref|XP_003535381.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  96   VLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            V   C    ++ A + S    +  E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D
Sbjct  6    VFTSCIFLSLVMALAISGFNFKGAEAARAFFVFGDSLVDNGNNNYLATTARADAPPYGID  65

Query  276  YPTHSPTGRFSN  311
            YPT  PTGRFSN
Sbjct  66   YPTRRPTGRFSN  77



>ref|XP_010069682.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Eucalyptus grandis]
 gb|KCW58101.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
 gb|KCW58102.1| hypothetical protein EUGRSUZ_H00825 [Eucalyptus grandis]
Length=374

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD+GNNNY+ + ARADSPP G+DYPTH PTGRFSN
Sbjct  33   EAARAFFVFGDSLVDSGNNNYLVTTARADSPPNGIDYPTHRPTGRFSN  80



>ref|XP_004494760.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cicer arietinum]
Length=371

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 8/79 (10%)
 Frame = +3

Query  75   EKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARAD  254
            + YY+ +V     I F++  S+    T   +   RA FVFGDSLVD GNNNY+ + ARAD
Sbjct  8    QSYYIHVV-----IIFMVAMSTGFKGT---EAAPRAFFVFGDSLVDNGNNNYLATTARAD  59

Query  255  SPPYGLDYPTHSPTGRFSN  311
            +PPYG+DYPT  PTGRFSN
Sbjct  60   APPYGIDYPTRRPTGRFSN  78



>ref|XP_004292262.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Fragaria vesca 
subsp. vesca]
Length=357

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+D+PTH PTG FSN
Sbjct  18   EAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTHRPTGHFSN  65



>ref|XP_002325360.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
 gb|EEE99741.1| hypothetical protein POPTR_0019s04130g [Populus trichocarpa]
Length=367

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            ++G   + A T       RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGR
Sbjct  12   LIGLVVAMATTFVPQAEARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGR  71

Query  303  FSN  311
            FSN
Sbjct  72   FSN  74



>gb|KHN05905.1| GDSL esterase/lipase [Glycine soja]
Length=379

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = +3

Query  87   LCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPY  266
            + M+L L  +  ++       NT  V E  R  FVFGDSLVD+GNNNY+ + ARADSPPY
Sbjct  19   VLMILTLVVVTLLI-------NTKSV-ESARTFFVFGDSLVDSGNNNYLPTTARADSPPY  70

Query  267  GLDYPTHSPTGRFSN  311
            G+DYPT  PTGRFSN
Sbjct  71   GIDYPTGRPTGRFSN  85



>gb|ACG46653.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=392

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  51   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  98



>ref|XP_007205392.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
 gb|EMJ06591.1| hypothetical protein PRUPE_ppa007427mg [Prunus persica]
Length=368

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 52/77 (68%), Gaps = 8/77 (10%)
 Frame = +3

Query  84   YLCMVLLLCF-IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSP  260
            YL +  L  F +   LG  SS A      EGR A FVFGDSLVD GNNNY+ + ARADSP
Sbjct  6    YLALGSLAIFGLAMALGTLSSQA------EGR-AFFVFGDSLVDNGNNNYLATTARADSP  58

Query  261  PYGLDYPTHSPTGRFSN  311
            PYG+DYPT  PTGRFSN
Sbjct  59   PYGIDYPTGRPTGRFSN  75



>ref|XP_011038450.1| PREDICTED: GDSL esterase/lipase LTL1-like [Populus euphratica]
Length=368

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +3

Query  108  CFI-FFILGASSSSAN-THQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            CFI   ILG  ++ A  T QV+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYP
Sbjct  8    CFISLLILGLVATLAGVTPQVEA--RAFFVFGDSLVDNGNNNYLATTARADAPPYGVDYP  65

Query  282  THSPTGRFSN  311
            T   TGRFSN
Sbjct  66   TRRATGRFSN  75



>ref|XP_009611210.1| PREDICTED: GDSL esterase/lipase LTL1-like [Nicotiana tomentosiformis]
Length=369

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +3

Query  147  ANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            A++ QV+   RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYP+H PTGRFSN
Sbjct  24   ASSLQVEA--RAFFVFGDSLVDNGNNNYLITSARADSPPYGIDYPSHRPTGRFSN  76



>emb|CBI28652.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  30   RAFFVFGDSLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSN  74



>ref|XP_010648948.1| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
 emb|CAN67726.1| hypothetical protein VITISV_038831 [Vitis vinifera]
Length=369

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNDYLVTTARADSPPYGIDYPTHRPTGRFSN  76



>ref|XP_009764127.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764128.1| PREDICTED: GDSL esterase/lipase At5g33370-like isoform X2 [Nicotiana 
sylvestris]
Length=378

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 46/66 (70%), Gaps = 7/66 (11%)
 Frame = +3

Query  114  IFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSP  293
            +F ILG + S           RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   
Sbjct  26   LFLILGVAISQTEA-------RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRA  78

Query  294  TGRFSN  311
            TGRFSN
Sbjct  79   TGRFSN  84



>ref|NP_001146251.1| hypothetical protein precursor [Zea mays]
 gb|ACL53571.1| unknown [Zea mays]
 tpg|DAA48526.1| TPA: hypothetical protein ZEAMMB73_975942 [Zea mays]
Length=384

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYGLDYPTH  TGRFSN
Sbjct  41   RAFFVFGDSLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSN  85



>ref|XP_010936081.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Elaeis guineensis]
Length=368

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  114  IFFILGASSSSANTHQVD-EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHS  290
            +FF L A      T  V  E  RA FVFGDSLVD GNNNY+ + ARAD PPYG+DYPTH 
Sbjct  9    VFFSLIAGLVVLGTLPVSSEAARAFFVFGDSLVDNGNNNYLATTARADRPPYGIDYPTHQ  68

Query  291  PTGRFSN  311
             TGRFSN
Sbjct  69   ATGRFSN  75



>ref|XP_002268826.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Vitis vinifera]
Length=368

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSN  75



>ref|XP_011084724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Sesamum indicum]
Length=367

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLVTTARADAPPYGIDYPTHRPTGRFSN  74



>emb|CDP04257.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTHSPTGRFSN
Sbjct  27   RAFFVFGDSLVDNGNNNYLVTTARADTPPYGIDFPTHSPTGRFSN  71



>emb|CBI28654.3| unnamed protein product [Vitis vinifera]
Length=362

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  25   RAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSN  69



>ref|NP_001136990.1| uncharacterized protein LOC100217152 [Zea mays]
 gb|ACF83028.1| unknown [Zea mays]
 tpg|DAA49763.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=406

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  65   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  112



>ref|XP_010043319.1| PREDICTED: GDSL esterase/lipase LTL1-like [Eucalyptus grandis]
 gb|KCW85324.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=365

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDNGNNNYLATTARADLPPYGIDYPTHRPTGRFSN  72



>emb|CAN66351.1| hypothetical protein VITISV_039098 [Vitis vinifera]
Length=354

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  17   RAFFVFGDSLVDSGNNNYLVTSARADSPPYGIDYPTHRATGRFSN  61



>gb|KCW85323.1| hypothetical protein EUGRSUZ_B02163 [Eucalyptus grandis]
Length=367

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDNGNNNYLATTARADLPPYGIDYPTHRPTGRFSN  72



>ref|XP_009348738.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   RAFFVFGDSLVDTGNNNYLATSARADSPPYGIDYPTRRPTGRFSN  68



>ref|XP_002521156.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF41307.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARAD PPYG+DYP+H PTGRFSN
Sbjct  28   EAARAFFVFGDSLVDNGNNNYLATPARADCPPYGIDYPSHQPTGRFSN  75



>ref|XP_010433162.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 9/69 (13%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            LC    +L   +++A         RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT
Sbjct  15   LCLTLILLPQQTNAA---------RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  65

Query  285  HSPTGRFSN  311
              PTGRFSN
Sbjct  66   GRPTGRFSN  74



>ref|XP_007147235.1| hypothetical protein PHAVU_006G1073001g, partial [Phaseolus vulgaris]
 gb|ESW19229.1| hypothetical protein PHAVU_006G1073001g, partial [Phaseolus vulgaris]
Length=288

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            L C+I  +LG S       +  E +RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYP
Sbjct  7    LACYII-VLGVSVV---CWKGAEAQRAFFVFGDSLVDNGNNNYLATSARADAPPYGIDYP  62

Query  282  THSPTGRFSN  311
            T   TGRFSN
Sbjct  63   TRRATGRFSN  72



>ref|XP_011002018.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +3

Query  117  FFILG-ASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSP  293
            + +LG A   +A  H+ D   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   
Sbjct  12   WVVLGLAVVLAAIVHRADA--RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRQA  69

Query  294  TGRFSN  311
            TGRFSN
Sbjct  70   TGRFSN  75



>tpg|DAA49762.1| TPA: hypothetical protein ZEAMMB73_759037 [Zea mays]
Length=406

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  65   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  112



>ref|XP_003555561.1| PREDICTED: GDSL esterase/lipase At5g33370 [Glycine max]
Length=371

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  30   EAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSN  77



>ref|XP_007030304.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030305.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10806.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
 gb|EOY10807.1| Li-tolerant lipase 1 isoform 1 [Theobroma cacao]
Length=367

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  117  FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPT  296
            + ILG   +  N     E  RA FVFGDSLVD GNNNY+ + ARAD+ PYG+DYPTH  T
Sbjct  10   WMILGLLLTLGNVAPQAEAARAFFVFGDSLVDNGNNNYLATTARADAYPYGIDYPTHRAT  69

Query  297  GRFSN  311
            GRFSN
Sbjct  70   GRFSN  74



>gb|KHN04961.1| GDSL esterase/lipase [Glycine soja]
Length=355

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  14   EAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPTRRPTGRFSN  61



>ref|XP_006371114.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
 gb|ERP48911.1| hypothetical protein POPTR_0019s04150g [Populus trichocarpa]
Length=395

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +3

Query  117  FFILG-ASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSP  293
            + +LG A   +A  H+ D   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   
Sbjct  39   WVVLGLAVVLAAIVHRADA--RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRQA  96

Query  294  TGRFSN  311
            TGRFSN
Sbjct  97   TGRFSN  102



>gb|KCW61461.1| hypothetical protein EUGRSUZ_H04197 [Eucalyptus grandis]
Length=373

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  32   EAARAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTGQPTGRFSN  79



>gb|KFK29417.1| hypothetical protein AALP_AA7G132000 [Arabis alpina]
Length=367

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 9/69 (13%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            LC   F++          Q+D  R A +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPT
Sbjct  15   LCITLFLM--------PQQIDAAR-AFYVFGDSLVDSGNNNYLVTTARADSPPYGIDYPT  65

Query  285  HSPTGRFSN  311
              PTGRFSN
Sbjct  66   GRPTGRFSN  74



>ref|XP_010024922.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Eucalyptus grandis]
Length=352

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  11   EAARAFFVFGDSLVDNGNNNYLVTTARADSPPYGIDYPTGQPTGRFSN  58



>ref|NP_001132075.1| uncharacterized protein LOC100193489 precursor [Zea mays]
 ref|XP_008661412.1| PREDICTED: uncharacterized protein LOC100193489 isoform X1 [Zea 
mays]
 gb|ACF80762.1| unknown [Zea mays]
 gb|AFW58801.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 8/65 (12%)
 Frame = +3

Query  117  FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPT  296
              +LGA+S+S          RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PT
Sbjct  17   LLVLGAASASP--------PRAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHLPT  68

Query  297  GRFSN  311
            GRFSN
Sbjct  69   GRFSN  73



>ref|XP_008370770.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   RAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSN  68



>ref|XP_008345728.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   RAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSN  68



>ref|XP_010438383.1| PREDICTED: GDSL esterase/lipase At4g28780 [Camelina sativa]
Length=363

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  20   QQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  70



>ref|XP_008370782.1| PREDICTED: GDSL esterase/lipase LTL1-like [Malus domestica]
Length=361

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   RAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPTRRPTGRFSN  68



>gb|ACR37768.1| unknown [Zea mays]
Length=438

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH PTGRFSN
Sbjct  28   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRPTGRFSN  75



>ref|NP_001237641.2| uncharacterized LOC100500155 precursor [Glycine max]
Length=364

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L+ C I   L  S S A+  Q     RA FVFGDSLVD+GNN+++ + ARAD+PPYG+D+
Sbjct  5    LVCCIIVTSLFMSLSFASAQQ----GRAFFVFGDSLVDSGNNDFLATTARADAPPYGIDF  60

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  61   PTHRPTGRFSN  71



>ref|XP_008218371.1| PREDICTED: GDSL esterase/lipase LTL1-like [Prunus mume]
Length=405

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 52/92 (57%), Gaps = 20/92 (22%)
 Frame = +3

Query  93   MVLLLCFIFF-------------------ILGASSSSANTHQVDEGRRALFVFGDSLVDA  215
            +V L CF+ F                   I G + +        EGR A FVFGDSLVD 
Sbjct  22   IVFLFCFVTFKTNDASMASASSLALGSLAIFGLAMALGTLSSQAEGR-AFFVFGDSLVDN  80

Query  216  GNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            GNNNY+ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  81   GNNNYLATTARADAPPYGIDYPTRRPTGRFSN  112



>emb|CDY02631.1| BnaC02g08040D [Brassica napus]
Length=369

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V E  RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+P+  PTGRFSN
Sbjct  29   VAEAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPSRRPTGRFSN  78



>gb|EYU39533.1| hypothetical protein MIMGU_mgv1a008571mg [Erythranthe guttata]
Length=369

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 10/80 (13%)
 Frame = +3

Query  72   DEKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARA  251
            + ++YL  V +L   F  L             EG+ A FVFGDSLVD GNNNY+ + ARA
Sbjct  7    NSRFYLIFVFVLALEFNYLCNHV---------EGK-AFFVFGDSLVDNGNNNYLATTARA  56

Query  252  DSPPYGLDYPTHSPTGRFSN  311
            D+PPYG+D+PTH PTGRFSN
Sbjct  57   DAPPYGIDFPTHRPTGRFSN  76



>ref|XP_002869473.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45732.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=357

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  14   QQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  64



>gb|KHN14798.1| GDSL esterase/lipase [Glycine soja]
Length=195

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  12   RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDFPTHRPTGRFSN  56



>ref|XP_008796408.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=371

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  114  IFFILGASSSSANTHQVD-EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHS  290
            +FF L A      T  V  E  RA FVFGDSLVD GNNNY+ + ARAD PPYG+DYPT  
Sbjct  12   LFFSLIAGLVVVGTLPVSSEAARAFFVFGDSLVDNGNNNYLATTARADRPPYGIDYPTGR  71

Query  291  PTGRFSN  311
            PTGRFSN
Sbjct  72   PTGRFSN  78



>emb|CDY35219.1| BnaA01g08120D [Brassica napus]
Length=346

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  3    QQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  53



>ref|XP_003580102.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=375

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  37   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDYPTHLPTGRFSN  81



>emb|CDP04255.1| unnamed protein product [Coffea canephora]
Length=369

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA F+FGDSLVD GNNNY+ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  31   RAFFIFGDSLVDNGNNNYLLTSARADAPPYGIDYPTHRPTGRFSN  75



>ref|XP_010447915.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Camelina sativa]
Length=367

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   QQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  74



>ref|XP_010102184.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB93127.1| GDSL esterase/lipase [Morus notabilis]
Length=218

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 8/77 (10%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            ++   L +  +  +LG+ S+ A         RA FVFGDSLVD GNNNY+ + ARAD+PP
Sbjct  6    FMASSLKIFSLVMVLGSFSTQAEA-------RAFFVFGDSLVDNGNNNYLATTARADAPP  58

Query  264  YGLDY-PTHSPTGRFSN  311
            YG+DY PTH PTGRFSN
Sbjct  59   YGIDYAPTHRPTGRFSN  75



>ref|XP_011002016.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Populus euphratica]
Length=368

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            ++G   + A T       RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGR
Sbjct  13   LIGLVVAMATTFVPQAEARAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTRRPTGR  72

Query  303  FSN  311
            FSN
Sbjct  73   FSN  75



>ref|XP_008388753.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008350647.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=363

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  26   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSN  70



>ref|XP_007139614.1| hypothetical protein PHAVU_008G044500g [Phaseolus vulgaris]
 gb|ESW11608.1| hypothetical protein PHAVU_008G044500g [Phaseolus vulgaris]
Length=370

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARA++PPYG+DYPTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDNGNNNYLQTVARANAPPYGIDYPTHRPTGRFSN  75



>gb|ACU15164.1| unknown [Glycine max]
Length=191

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLITWNNIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGIDYPTHRATGRFSN  81



>ref|XP_008810810.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=365

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  105  LCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            L   FF+ G ++    T  +    RA FVFGDSLVD GNNN++ + ARAD PPYG+DYPT
Sbjct  6    LLITFFLAGLAA--LGTLSMMSEARAFFVFGDSLVDNGNNNFLLTTARADLPPYGIDYPT  63

Query  285  HSPTGRFSN  311
            H PTGRFSN
Sbjct  64   HRPTGRFSN  72



>ref|XP_009379724.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Pyrus x bretschneideri]
Length=363

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  26   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTGRPTGRFSN  70



>tpg|DAA37013.1| TPA: hypothetical protein ZEAMMB73_160387 [Zea mays]
Length=221

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = +3

Query  75   EKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARAD  254
            +   +    L+  +  +LG+ S SA         RA FVFGDSLVD GNNNY+ + ARAD
Sbjct  2    DALLVTTTFLVPVVALLLGSGSGSAAALP-----RAFFVFGDSLVDNGNNNYLMTTARAD  56

Query  255  SPPYGLDYPTHSPTGRFSN  311
            +PPYG+D+PTH  TGRFSN
Sbjct  57   APPYGIDFPTHMATGRFSN  75



>ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB93130.1| GDSL esterase/lipase [Morus notabilis]
Length=367

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  120  FILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTG  299
             +LGA   + ++       RA FVFGDSLVD GNNNY+ + ARAD+ PYG+DYPTH PTG
Sbjct  11   IVLGALVITLSSFGFQAEARAFFVFGDSLVDNGNNNYLATTARADNYPYGIDYPTHRPTG  70

Query  300  RFSN  311
            RFSN
Sbjct  71   RFSN  74



>ref|XP_003573228.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Brachypodium 
distachyon]
Length=375

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +  G R  FVFGDSLVD+GNNNY+ + ARADSPPYGLDYPTH  TGRFSN
Sbjct  28   IGTGPRPFFVFGDSLVDSGNNNYLLTTARADSPPYGLDYPTHRATGRFSN  77



>gb|KHN14896.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  67   PTHRPTGRFSN  77



>ref|XP_003554997.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  67   PTHRPTGRFSN  77



>ref|XP_003554732.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSN  72



>gb|ACU15087.1| unknown [Glycine max]
Length=205

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 4/71 (6%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L+ C I   L  S S A+  Q     RA F FGDSLVD+GNN+++ + ARAD+PPYG+D+
Sbjct  5    LVCCIIVTSLFTSLSFASAQQ----GRAFFAFGDSLVDSGNNDFLATTARADAPPYGIDF  60

Query  279  PTHSPTGRFSN  311
            PTH PTGRFSN
Sbjct  61   PTHRPTGRFSN  71



>ref|NP_001241754.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG35356.1| anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = +3

Query  117  FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPT  296
              +LG+ ++SA+        RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PT
Sbjct  17   LLVLGSGAASASP------PRAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHLPT  70

Query  297  GRFSN  311
            GRFSN
Sbjct  71   GRFSN  75



>gb|EMT05671.1| GDSL esterase/lipase [Aegilops tauschii]
Length=320

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  23   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHQATGRFSN  70



>gb|KHN43145.1| GDSL esterase/lipase [Glycine soja]
Length=365

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSN  72



>ref|XP_003626495.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES82713.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 9/79 (11%)
 Frame = +3

Query  75   EKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARAD  254
            + YY+ +V++L     ++  +S    T      +RA FVFGDSLVD GNNNY+ + ARAD
Sbjct  8    QSYYINVVIIL-----MVALTSCFKGT----VAQRAFFVFGDSLVDNGNNNYLATTARAD  58

Query  255  SPPYGLDYPTHSPTGRFSN  311
            +PPYG+DYPT  PTGRFSN
Sbjct  59   APPYGIDYPTRRPTGRFSN  77



>ref|XP_010263996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Nelumbo nucifera]
Length=368

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLATTARADSYPYGIDYPTHRPTGRFSN  73



>gb|ACU17474.1| unknown [Glycine max]
Length=213

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLITWNNIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGIDYPTHRATGRFSN  81



>ref|NP_197344.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q5PNZ0.1|GDL77_ARATH RecName: Full=GDSL esterase/lipase At5g18430; AltName: Full=Extracellular 
lipase At5g18430; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAV85662.1| At5g18430 [Arabidopsis thaliana]
 gb|AAW78593.1| At5g18430 [Arabidopsis thaliana]
 gb|AED92562.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=362

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V EGR A FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  23   VVEGR-AFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPTRRPTGRFSN  71



>ref|XP_006443286.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 gb|ESR56526.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
Length=301

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSN  76



>gb|EMS53263.1| GDSL esterase/lipase LTL1 [Triticum urartu]
Length=366

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  23   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHQATGRFSN  70



>ref|XP_007030303.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10805.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=367

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +3

Query  99   LLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY  278
            L++   + +LG   +++ T    E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+D 
Sbjct  4    LVVVASWIVLGLVMATSTTKV--EAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDT  61

Query  279  PTHSPTGRFSN  311
            P+  PTGRFSN
Sbjct  62   PSRRPTGRFSN  72



>gb|EAY78821.1| hypothetical protein OsI_33925 [Oryza sativa Indica Group]
Length=322

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARAD PPYG+D+P+H PTGRFSN
Sbjct  17   EGARAFFVFGDSLVDNGNNNYLLTSARADMPPYGIDHPSHRPTGRFSN  64



>ref|XP_008382662.1| PREDICTED: GDSL esterase/lipase At4g28780 [Malus domestica]
Length=368

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +3

Query  186  FVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PTH PTGRFSN
Sbjct  34   FVFGDSLVDSGNNNYLATTARADSPPYGIDFPTHRPTGRFSN  75



>ref|XP_004976167.1| PREDICTED: GDSL esterase/lipase LTL1-like [Setaria italica]
Length=363

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  26   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSN  70



>dbj|BAK07334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  29   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDYPTHRATGRFSN  76



>gb|EPS65950.1| hypothetical protein M569_08823, partial [Genlisea aurea]
Length=340

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +A FVFGDSLVD GNNNY+ + ARADSPPYG+D+P+H PTGRFSN
Sbjct  4    KAFFVFGDSLVDNGNNNYLATTARADSPPYGIDHPSHRPTGRFSN  48



>ref|XP_004495029.1| PREDICTED: GDSL esterase/lipase At4g28780-like isoform X2 [Cicer 
arietinum]
Length=367

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARA+SPPYG+DYPT  PTGRFSN
Sbjct  27   ESARAFFVFGDSLVDNGNNNYLPTTARANSPPYGIDYPTRRPTGRFSN  74



>gb|KHN43144.1| GDSL esterase/lipase [Glycine soja]
Length=363

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E +RA FVFGDSLVD GNNN++ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  23   EAQRAFFVFGDSLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSN  70



>gb|ACU23610.1| unknown [Glycine max]
Length=363

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E +RA FVFGDSLVD GNNN++ + ARAD+PPYG+DYPT  PTGRFSN
Sbjct  23   EAQRAFFVFGDSLVDNGNNNFLATTARADAPPYGIDYPTGRPTGRFSN  70



>gb|AAN05519.1| putative early nodulin gene (Enod) related protein [Oryza sativa 
Japonica Group]
 gb|EAZ16343.1| hypothetical protein OsJ_31806 [Oryza sativa Japonica Group]
Length=383

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARAD PPYG+D+P+H PTGRFSN
Sbjct  17   EGARAFFVFGDSLVDNGNNNYLLTSARADMPPYGIDHPSHRPTGRFSN  64



>gb|EMS62626.1| GDSL esterase/lipase LTL1 [Triticum urartu]
Length=368

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSN  73



>ref|XP_004495028.1| PREDICTED: GDSL esterase/lipase At4g28780-like isoform X1 [Cicer 
arietinum]
Length=368

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARA+SPPYG+DYPT  PTGRFSN
Sbjct  27   ESARAFFVFGDSLVDNGNNNYLPTTARANSPPYGIDYPTRRPTGRFSN  74



>ref|XP_002873894.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50153.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  10   RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPTRRPTGRFSN  54



>ref|NP_001064786.1| Os10g0463200 [Oryza sativa Japonica Group]
 gb|AAP54162.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26700.1| Os10g0463200 [Oryza sativa Japonica Group]
Length=390

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARAD PPYG+D+P+H PTGRFSN
Sbjct  24   EGARAFFVFGDSLVDNGNNNYLLTSARADMPPYGIDHPSHRPTGRFSN  71



>gb|EMT08293.1| GDSL esterase/lipase LTL1 [Aegilops tauschii]
Length=369

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSN  74



>dbj|BAJ85303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSN  73



>ref|XP_007030301.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY10803.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=370

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DYP+  PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPSRRPTGRFSN  76



>ref|XP_007147237.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
 gb|ESW19231.1| hypothetical protein PHAVU_006G107400g [Phaseolus vulgaris]
Length=365

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V+   RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   TGRFSN
Sbjct  23   VEAKSRAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTGKATGRFSN  72



>ref|XP_007151673.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
 gb|ESW23667.1| hypothetical protein PHAVU_004G066300g [Phaseolus vulgaris]
Length=370

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY PTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSN  76



>ref|XP_006400391.1| hypothetical protein EUTSA_v10013876mg [Eutrema salsugineum]
 gb|ESQ41844.1| hypothetical protein EUTSA_v10013876mg [Eutrema salsugineum]
Length=368

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  33   RAFFVFGDSLVDSGNNNYLLTTARADSPPYGIDFPTRRPTGRFSN  77



>ref|XP_007151676.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
 gb|ESW23670.1| hypothetical protein PHAVU_004G066600g [Phaseolus vulgaris]
Length=370

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY PTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYSPTHRPTGRFSN  76



>ref|XP_003521783.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=365

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  28   RAFFVFGDSLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSN  72



>ref|XP_004237503.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum lycopersicum]
Length=367

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLVTSARADSPPYGIDYPTHRATGRFSN  74



>gb|KHN35333.1| GDSL esterase/lipase, partial [Glycine soja]
Length=368

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+DYPTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNDFLVTTARADAPPYGIDYPTHRPTGRFSN  75



>ref|XP_010524958.1| PREDICTED: GDSL esterase/lipase At5g18430 [Tarenaya hassleriana]
Length=377

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  38   RAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDFPTRRPTGRFSN  82



>ref|NP_001062538.1| Os08g0565900 [Oryza sativa Japonica Group]
 dbj|BAC56011.1| putative GDSL-motif lipase/hydrolase protein [Oryza sativa Japonica 
Group]
 dbj|BAD10334.1| putative GDSL-motif lipase/hydrolase protein [Oryza sativa Japonica 
Group]
 dbj|BAF24452.1| Os08g0565900 [Oryza sativa Japonica Group]
 gb|EAZ08052.1| hypothetical protein OsI_30317 [Oryza sativa Indica Group]
 gb|EAZ43693.1| hypothetical protein OsJ_28320 [Oryza sativa Japonica Group]
Length=387

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  44   RAFFVFGDSLVDSGNNNYLMTTARADSPPYGVDYPTHRATGRFSN  88



>gb|EYU46367.1| hypothetical protein MIMGU_mgv1a008634mg [Erythranthe guttata]
Length=367

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARADSPPYG+D P H P+GRFSN
Sbjct  27   EGGRAFFVFGDSLVDNGNNNYLLTTARADSPPYGIDSPDHRPSGRFSN  74



>ref|XP_006340481.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=367

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYPTH  TGRFSN
Sbjct  30   RAFFVFGDSLVDNGNNNYLLTSARADSPPYGIDYPTHRATGRFSN  74



>ref|XP_009348740.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=361

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+DYP   PTGRFSN
Sbjct  24   RAFFVFGDSLVDNGNNNYLATSARADSPPYGIDYPNRQPTGRFSN  68



>ref|XP_006375868.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 ref|XP_006375869.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53665.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|ERP53666.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=372

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +3

Query  147  ANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            A  HQ D   RA  VFGDSLVD+GNNNY+ + ARADS PYG+DYPTH  TGRFSN
Sbjct  27   AIVHQADA--RAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSN  79



>gb|KHG28665.1| hypothetical protein F383_15485 [Gossypium arboreum]
Length=369

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            L+ ++  +L  + + + T    E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+D P
Sbjct  7    LVSWLVLVLTLAMAVSKTQV--EAARAFFVFGDSLVDNGNNNYLATTARADSPPYGIDSP  64

Query  282  THSPTGRFSN  311
            +  PTGRFSN
Sbjct  65   SRRPTGRFSN  74



>ref|XP_002319125.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
 gb|EEE95048.1| hypothetical protein POPTR_0013s04790g [Populus trichocarpa]
Length=368

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +3

Query  147  ANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            A  HQ D   RA  VFGDSLVD+GNNNY+ + ARADS PYG+DYPTH  TGRFSN
Sbjct  23   AIVHQADA--RAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSN  75



>ref|XP_007151675.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
 gb|ESW23669.1| hypothetical protein PHAVU_004G066500g [Phaseolus vulgaris]
Length=370

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY PTH PTGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYAPTHRPTGRFSN  76



>ref|XP_002446760.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
 gb|EES11088.1| hypothetical protein SORBIDRAFT_06g021990 [Sorghum bicolor]
Length=395

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDNGNNNYLMTTARADAPPYGIDFPTHMPTGRFSN  76



>gb|ABK95911.1| unknown [Populus trichocarpa]
Length=368

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +3

Query  147  ANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            A  HQ D   RA  VFGDSLVD+GNNNY+ + ARADS PYG+DYPTH  TGRFSN
Sbjct  23   AIVHQADA--RAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHQATGRFSN  75



>ref|XP_008370769.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
 ref|XP_008345729.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  25   RAFFVFGDSLVDSGNNDYLATTARADSYPYGIDYPTHRPTGRFSN  69



>gb|KDP23751.1| hypothetical protein JCGZ_23584 [Jatropha curcas]
Length=367

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLATTARADSPPYGIDFPTRRPTGRFSN  73



>gb|KHN14886.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY PTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPTHRPTGRFSN  77



>ref|XP_006412910.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
 gb|ESQ54363.1| hypothetical protein EUTSA_v10025523mg [Eutrema salsugineum]
Length=367

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  24   QETNAARAFYVFGDSLVDSGNNNYLVTTARADSPPYGIDYPTGRPTGRFSN  74



>ref|XP_003553269.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=371

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            P+H PTGRFSN
Sbjct  67   PSHRPTGRFSN  77



>ref|XP_003553249.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            P+H PTGRFSN
Sbjct  67   PSHRPTGRFSN  77



>gb|ACG37655.1| anther-specific proline-rich protein APG [Zea mays]
Length=367

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +3

Query  87   LCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPY  266
            L    L+  +  +LG+ S SA         RA FVFGDSLVD GNNNY+ + ARAD+PPY
Sbjct  5    LVTTFLVPVVALLLGSGSGSAAPLP-----RAFFVFGDSLVDNGNNNYLMTTARADAPPY  59

Query  267  GLDYPTHSPTGRFSN  311
            G+D+PTH  TGRFSN
Sbjct  60   GIDFPTHMATGRFSN  74



>ref|XP_009389128.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=430

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 49/70 (70%), Gaps = 6/70 (9%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYP  281
            ++  I  +LG  SS +      E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D P
Sbjct  12   VVVTILAVLGGCSSPS------EAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDTP  65

Query  282  THSPTGRFSN  311
            +H P+GRFSN
Sbjct  66   SHRPSGRFSN  75



>ref|XP_002319124.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
 gb|EEE95047.2| hypothetical protein POPTR_0013s04780g [Populus trichocarpa]
Length=419

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +3

Query  108  CFI-FFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPT  284
            CFI   ILG   + A      E R A FVFGDSLVD GNNNY+ + ARAD+PPYG+DYPT
Sbjct  59   CFISLLILGLVVTLAGVIPQVEAR-AFFVFGDSLVDNGNNNYLATTARADAPPYGVDYPT  117

Query  285  HSPTGRFSN  311
               TGRFSN
Sbjct  118  RRATGRFSN  126



>gb|KHN11576.1| GDSL esterase/lipase [Glycine soja]
Length=135

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARA++PPYG+DYPTH  TGRFSN
Sbjct  32   RAFFVFGDSLVDNGNNNYLQTIARANAPPYGIDYPTHRATGRFSN  76



>ref|XP_011038448.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
 ref|XP_011038449.1| PREDICTED: GDSL esterase/lipase At5g33370 [Populus euphratica]
Length=368

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +3

Query  147  ANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            A  HQ D   RA  VFGDSLVD+GNNNY+ + ARADS PYG+DYPTH  TGRFSN
Sbjct  23   AIVHQADA--RAFLVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHRATGRFSN  75



>ref|XP_007147234.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
 gb|ESW19228.1| hypothetical protein PHAVU_006G107200g [Phaseolus vulgaris]
Length=389

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 11/81 (14%)
 Frame = +3

Query  84   YLCMVLLLCFIF-----FILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCAR  248
            ++ M  +L F+F      ++   S SA      +  RA FVFGDSLVD+GNN+++ + AR
Sbjct  22   FVAMTNVLVFVFCAIISLVVAPDSVSA------QPTRAFFVFGDSLVDSGNNDFLATTAR  75

Query  249  ADSPPYGLDYPTHSPTGRFSN  311
            AD+PPYG+D+P+H PTGRFSN
Sbjct  76   ADAPPYGIDFPSHRPTGRFSN  96



>gb|KHN14884.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +3

Query  102  LLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-  278
            +L  +  ++G   S      V+   RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY 
Sbjct  12   ILSLVLLVVGIIVSG-----VEARPRAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYP  66

Query  279  PTHSPTGRFSN  311
            P+H PTGRFSN
Sbjct  67   PSHRPTGRFSN  77



>ref|XP_006283981.1| hypothetical protein CARUB_v10005104mg [Capsella rubella]
 gb|EOA16879.1| hypothetical protein CARUB_v10005104mg [Capsella rubella]
Length=364

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  159  QVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            Q     RA FVFGDSLVD+GNNNY+ + ARADSPPYG+D+PT  PTGRFSN
Sbjct  21   QQTNAARAFFVFGDSLVDSGNNNYLVTTARADSPPYGIDHPTGRPTGRFSN  71



>ref|XP_004174057.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Cucumis sativus]
Length=127

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            ILG   + A      E  R+ FVFGDSLVD GNNNY+ + ARADS PYG+D+PTH PTGR
Sbjct  9    ILGVVLALAALTAQAEAGRSFFVFGDSLVDNGNNNYLATTARADSYPYGIDFPTHRPTGR  68

Query  303  FSN  311
            FSN
Sbjct  69   FSN  71



>ref|XP_006443287.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 ref|XP_006478978.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Citrus sinensis]
 gb|ESR56527.1| hypothetical protein CICLE_v10020709mg [Citrus clementina]
 gb|KDO52496.1| hypothetical protein CISIN_1g017552mg [Citrus sinensis]
Length=369

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  32   RAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSN  76



>ref|XP_009126251.1| PREDICTED: GDSL esterase/lipase At5g18430 [Brassica rapa]
 emb|CDY53245.1| BnaA02g04090D [Brassica napus]
Length=370

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+D+P+  PTGRFSN
Sbjct  32   EAARAFFVFGDSLVDSGNNNYLVTTARADAPPYGIDFPSRRPTGRFSN  79



>ref|XP_007143993.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
 gb|ESW15987.1| hypothetical protein PHAVU_007G120000g [Phaseolus vulgaris]
Length=366

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+++ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  29   RAFFVFGDSLVDSGNNDFLATTARADAPPYGIDFPTHRPTGRFSN  73



>ref|XP_010454082.1| PREDICTED: GDSL esterase/lipase At5g18430-like [Camelina sativa]
Length=368

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V EGR A FVFGDSLVD+GNNNY+ + ARADSPPYG+D PT  PTGRFSN
Sbjct  29   VVEGR-AFFVFGDSLVDSGNNNYLVTTARADSPPYGIDSPTRRPTGRFSN  77



>gb|EMT19317.1| GDSL esterase/lipase [Aegilops tauschii]
Length=369

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  186  FVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            FVFGDSLVD+GNNNY+ + ARADSPPYGLDYPTH  TGRFSN
Sbjct  33   FVFGDSLVDSGNNNYLATTARADSPPYGLDYPTHRATGRFSN  74



>ref|XP_006350943.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Solanum tuberosum]
Length=364

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   TGRFSN
Sbjct  26   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSN  70



>ref|NP_001141295.1| uncharacterized protein LOC100273386 precursor [Zea mays]
 gb|ACF86005.1| unknown [Zea mays]
 tpg|DAA37014.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = +3

Query  75   EKYYLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARAD  254
            +   +    L+  +  +LG+ S SA         RA FVFGDSLVD GNNNY+ + ARAD
Sbjct  2    DALLVTTTFLVPVVALLLGSGSGSAAALP-----RAFFVFGDSLVDNGNNNYLMTTARAD  56

Query  255  SPPYGLDYPTHSPTGRFSN  311
            +PPYG+D+PTH  TGRFSN
Sbjct  57   APPYGIDFPTHMATGRFSN  75



>ref|XP_004249922.1| PREDICTED: GDSL esterase/lipase At5g33370 [Solanum lycopersicum]
 gb|AEJ88779.1| cutin-deficient 1 protein [Solanum lycopersicum]
Length=362

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADSPPYG+DYPT   TGRFSN
Sbjct  24   RAFFVFGDSLVDSGNNNYLATTARADSPPYGIDYPTRRATGRFSN  68



>ref|XP_010420599.1| PREDICTED: GDSL esterase/lipase At5g18430 [Camelina sativa]
Length=353

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  162  VDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            V EGR A FVFGDSLVD+GNNNY+ + ARADSPPYG+D PT  PTGRFSN
Sbjct  14   VVEGR-AFFVFGDSLVDSGNNNYLVTTARADSPPYGIDSPTRRPTGRFSN  62



>gb|KHN48972.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  R  +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  31   ESARTFYVFGDSLVDSGNNNYLPTTARADSPPYGIDYPTGRPTGRFSN  78



>gb|KHG28666.1| GDSL esterase/lipase LTL1 -like protein [Gossypium arboreum]
Length=365

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            I G   +  N     E  RA FVFGDSLVD GNNNY+ + ARAD+ PYG+DYPTH  TGR
Sbjct  10   IFGLLFTLGNVGPQAEAARAFFVFGDSLVDNGNNNYLATTARADAYPYGIDYPTHRATGR  69

Query  303  FSN  311
            FSN
Sbjct  70   FSN  72



>gb|EPS67986.1| hypothetical protein M569_06783, partial [Genlisea aurea]
Length=353

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  165  DEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            D   RA FVFGDSLVD GNNN++ + ARAD+ PYG+DYPTH PTGRFSN
Sbjct  14   DAANRAFFVFGDSLVDNGNNNFLLTTARADNVPYGIDYPTHRPTGRFSN  62



>ref|XP_003542450.1| PREDICTED: GDSL esterase/lipase At4g28780-like [Glycine max]
Length=372

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  R  +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  31   ESARTFYVFGDSLVDSGNNNYLPTTARADSPPYGIDYPTGRPTGRFSN  78



>gb|ACU23670.1| unknown [Glycine max]
Length=372

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  R  +VFGDSLVD+GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  31   ESARTFYVFGDSLVDSGNNNYLPTTARADSPPYGIDYPTGRPTGRFSN  78



>gb|KHN47677.1| GDSL esterase/lipase [Glycine soja]
Length=280

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD GNNNY+ + ARAD+PPYG+DY P+H PTGRFSN
Sbjct  29   RAFFVFGDSLVDNGNNNYLATTARADAPPYGIDYPPSHRPTGRFSN  74



>ref|XP_007206865.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
 gb|EMJ08064.1| hypothetical protein PRUPE_ppb006257mg [Prunus persica]
Length=363

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  26   RAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSN  70



>ref|XP_008218370.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Prunus mume]
Length=363

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  26   RAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHRPTGRFSN  70



>dbj|BAK06471.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=373

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  171  GRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            G R  FVFGDSLVD+GNNNY+ + ARADS PYGLDYPTH  TGRFSN
Sbjct  32   GPRPFFVFGDSLVDSGNNNYLATTARADSAPYGLDYPTHRATGRFSN  78



>emb|CAN67727.1| hypothetical protein VITISV_038832 [Vitis vinifera]
 emb|CBI28653.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  30   RAFFVFGDSLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFSN  74



>ref|XP_008388755.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Malus domestica]
Length=362

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARAD+ PYG+DYPTH PTGRFSN
Sbjct  25   RAFFVFGDSLVDSGNNDYLATTARADNYPYGIDYPTHRPTGRFSN  69



>ref|XP_002522022.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40426.1| zinc finger protein, putative [Ricinus communis]
Length=369

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARADS PYG+DYPTH  TGRFSN
Sbjct  31   RAFFVFGDSLVDSGNNNYLATTARADSYPYGIDYPTHRATGRFSN  75



>ref|XP_003554731.1| PREDICTED: GDSL esterase/lipase LTL1-like [Glycine max]
 gb|KHN43146.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLMIWNKIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGVDYPTHRATGRFSN  81



>ref|XP_003521782.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X1 [Glycine 
max]
Length=376

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLITWNNIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGIDYPTHRATGRFSN  81



>ref|XP_006577328.1| PREDICTED: GDSL esterase/lipase LTL1-like isoform X2 [Glycine 
max]
Length=382

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLITWNNIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGIDYPTHRATGRFSN  81



>ref|XP_003574015.1| PREDICTED: GDSL esterase/lipase LTL1 [Brachypodium distachyon]
Length=374

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+D+PTH  TGRFSN
Sbjct  31   ECARAFFVFGDSLVDNGNNNYLMTSARADSPPYGIDFPTHRATGRFSN  78



>ref|XP_006661836.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Oryza brachyantha]
Length=385

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            EG RA FVFGDSLVD GNNNY+ + ARAD PPYG+D+PTH  TGRFSN
Sbjct  24   EGARAFFVFGDSLVDNGNNNYLLTSARADMPPYGIDHPTHRATGRFSN  71



>gb|KHN41491.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY P+H PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSN  77



>ref|XP_004982954.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Setaria italica]
Length=363

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARADSPPYG+D+PTH  TGRFSN
Sbjct  21   ECARAFFVFGDSLVDNGNNNYLMTTARADSPPYGIDFPTHRATGRFSN  68



>ref|XP_008789479.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Phoenix dactylifera]
Length=364

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  EGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            E  RA FVFGDSLVD GNNNY+ + ARAD+PPYG+D PT  PTGRFSN
Sbjct  24   EAARAFFVFGDSLVDNGNNNYLATTARADAPPYGIDSPTRRPTGRFSN  71



>ref|XP_004142546.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Cucumis sativus]
Length=365

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            ILG   + A      E  R+ FVFGDSLVD GNNNY+ + ARADS PYG+D+PTH PTGR
Sbjct  9    ILGVVLALAALTAQAEAGRSFFVFGDSLVDNGNNNYLATTARADSYPYGIDFPTHRPTGR  68

Query  303  FSN  311
            FSN
Sbjct  69   FSN  71



>ref|XP_002268296.2| PREDICTED: GDSL esterase/lipase At5g33370 [Vitis vinifera]
Length=384

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD+GNN+Y+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  47   RAFFVFGDSLVDSGNNDYLFTTARADSPPYGIDYPTGRPTGRFSN  91



>ref|XP_003543915.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY P+H PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSN  77



>ref|XP_009348739.1| PREDICTED: GDSL esterase/lipase LTL1-like [Pyrus x bretschneideri]
Length=362

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA FVFGDSLVD GNN+Y+ + ARADS PYG+DYPTH PTGRFSN
Sbjct  25   RAFFVFGDSLVDNGNNDYLATTARADSYPYGIDYPTHLPTGRFSN  69



>ref|XP_003524731.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
 gb|KHN42753.1| GDSL esterase/lipase [Glycine soja]
Length=372

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY P+H PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSN  77



>ref|XP_003590909.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES61160.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=367

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  174  RRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            +RA FVFGDS+ D GNNN++ + ARAD+PPYG+D+PTH PTGRFSN
Sbjct  29   KRAFFVFGDSVADNGNNNFLTTTARADAPPYGIDFPTHEPTGRFSN  74



>gb|KGN66731.1| hypothetical protein Csa_1G665920 [Cucumis sativus]
Length=357

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  123  ILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGR  302
            ILG   + A      E  R+ FVFGDSLVD GNNNY+ + ARADS PYG+D+PTH PTGR
Sbjct  9    ILGVVLALAALTAQAEAGRSFFVFGDSLVDNGNNNYLATTARADSYPYGIDFPTHRPTGR  68

Query  303  FSN  311
            FSN
Sbjct  69   FSN  71



>gb|KHN35332.1| GDSL esterase/lipase LTL1 [Glycine soja]
Length=376

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +3

Query  84   YLCMVLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPP  263
            +LC+++L+ +   ++    + A         RA FVFGDSLVD GNNNY+ + ARADS P
Sbjct  15   FLCLLVLITWNNIVVVVPQAEA---------RAFFVFGDSLVDNGNNNYLFTTARADSYP  65

Query  264  YGLDYPTHSPTGRFSN  311
            YG+DYPTH  TGRFSN
Sbjct  66   YGVDYPTHRATGRFSN  81



>gb|KFK26081.1| hypothetical protein AALP_AA8G200400 [Arabis alpina]
Length=368

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
            RA +VFGDSLVD+GNNNY+ + ARAD+PPYG+D+PT  PTGRFSN
Sbjct  33   RAFYVFGDSLVDSGNNNYLVTTARADAPPYGIDFPTRRPTGRFSN  77



>ref|XP_003554996.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Glycine max]
Length=370

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  RALFVFGDSLVDAGNNNYIGSCARADSPPYGLDY-PTHSPTGRFSN  311
            RA FVFGDSLVD+GNNNY+ + ARAD+PPYG+DY P+H PTGRFSN
Sbjct  32   RAFFVFGDSLVDSGNNNYLATTARADAPPYGIDYPPSHRPTGRFSN  77



>ref|XP_009398857.1| PREDICTED: GDSL esterase/lipase At5g33370-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +3

Query  96   VLLLCFIFFILGASSSSANTHQVDEGRRALFVFGDSLVDAGNNNYIGSCARADSPPYGLD  275
            +LL  ++ F+    SSS  +       RA FVFGDSLVD+GNNNY+ + ARAD+ PYG+D
Sbjct  5    LLLFAYVTFLAVFGSSSTPSEA-----RAFFVFGDSLVDSGNNNYLATTARADNIPYGID  59

Query  276  YPTHSPTGRFSN  311
             P+H PTGRFSN
Sbjct  60   SPSHRPTGRFSN  71



>gb|KDO52500.1| hypothetical protein CISIN_1g017684mg [Citrus sinensis]
Length=337

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +3

Query  183  LFVFGDSLVDAGNNNYIGSCARADSPPYGLDYPTHSPTGRFSN  311
             FVFGDSLVD GNNNY+ + ARADSPPYG+DYPT  PTGRFSN
Sbjct  33   FFVFGDSLVDNGNNNYLATTARADSPPYGIDYPTRRPTGRFSN  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512023305854