BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c45971_g1_i1 len=113 path=[109:0-112]

Length=113
                                                                      Score     E

dbj|BAC85346.1|  unnamed protein product                              59.3    8e-10   Homo sapiens [man]
gb|EAW55077.1|  hCG1978892, isoform CRA_a                             56.2    5e-09   
dbj|BAC05428.1|  unnamed protein product                              56.2    1e-08   Homo sapiens [man]
gb|EAX08697.1|  hypothetical protein FLJ31846, isoform CRA_a          57.0    2e-08   
sp|Q96MD7.1|CI085_HUMAN  RecName: Full=Uncharacterized protein C9...  55.5    2e-08   Homo sapiens [man]
gb|EHH59362.1|  hypothetical protein EGM_09449                        54.3    4e-08   
gb|EHH20263.1|  hypothetical protein EGK_03078                        54.7    4e-08   
gb|EAW90130.1|  dynein heavy chain domain 3, isoform CRA_b            57.0    6e-08   
gb|EHH16588.1|  hypothetical protein EGK_11888                        53.5    8e-08   
dbj|BAC87498.1|  unnamed protein product                              53.9    8e-08   Homo sapiens [man]
dbj|BAC85949.1|  unnamed protein product                              53.9    8e-08   Homo sapiens [man]
dbj|BAF85296.1|  unnamed protein product                              56.6    9e-08   Homo sapiens [man]
ref|NP_001290199.1|  dynein heavy chain 2, axonemal isoform 2         56.6    9e-08   
gb|AAH34225.1|  DNAH2 protein                                         56.6    9e-08   Homo sapiens [man]
gb|EHH64738.1|  hypothetical protein EGM_18043                        52.8    1e-07   
dbj|BAG11332.1|  dynein heavy chain domain 3                          56.2    1e-07   
gb|EAW90129.1|  dynein heavy chain domain 3, isoform CRA_a            56.2    1e-07   
gb|EHH24166.1|  hypothetical protein EGK_07776                        53.1    2e-07   
dbj|BAG58285.1|  unnamed protein product                              55.1    2e-07   Homo sapiens [man]
ref|XP_002801242.1|  PREDICTED: putative uncharacterized protein ...  52.8    2e-07   
gb|EHH60270.1|  hypothetical protein EGM_11598                        52.4    2e-07   
gb|EHH61346.1|  hypothetical protein EGM_19342                        52.0    2e-07   
dbj|BAE89854.1|  unnamed protein product                              51.6    3e-07   
gb|AAL55794.1|AF289610_1  unknown                                     52.0    4e-07   Homo sapiens [man]
gb|EAW68953.1|  hCG1814039                                            51.6    4e-07   
dbj|BAC05317.1|  unnamed protein product                              52.4    4e-07   Homo sapiens [man]
gb|AAH12514.1|  ELP4 protein                                          53.9    7e-07   Homo sapiens [man]
gb|EHH54194.1|  hypothetical protein EGM_14979                        50.4    9e-07   
gb|EHH52072.1|  hypothetical protein EGM_12441                        50.4    1e-06   
ref|XP_004045460.1|  PREDICTED: putative uncharacterized protein ...  50.4    1e-06   
gb|EAW95971.1|  hCG1812997                                            49.7    1e-06   
dbj|BAC04333.1|  unnamed protein product                              50.4    1e-06   Homo sapiens [man]
gb|EHH23662.1|  hypothetical protein EGK_07177                        50.4    1e-06   
sp|Q8N976.1|YG039_HUMAN  RecName: Full=Putative uncharacterized p...  50.4    1e-06   Homo sapiens [man]
gb|EAW52094.1|  hCG1735644                                            50.4    1e-06   
gb|EHH53906.1|  hypothetical protein EGM_14617                        49.7    1e-06   
dbj|BAB93502.1|  OK/SW-CL.41                                          50.1    1e-06   Homo sapiens [man]
gb|EHH25035.1|  hypothetical protein EGK_08789                        49.3    2e-06   
gb|EHH27424.1|  hypothetical protein EGK_17617                        49.7    2e-06   
gb|EHH20736.1|  hypothetical protein EGK_03652                        49.7    2e-06   
gb|EAW57092.1|  hCG1995581                                            51.2    2e-06   
ref|XP_007974487.1|  PREDICTED: uncharacterized protein LOC103223591  52.0    2e-06   
gb|EHH18929.1|  hypothetical protein EGK_19508                        49.3    2e-06   
dbj|BAG61429.1|  unnamed protein product                              50.4    2e-06   Homo sapiens [man]
gb|AAF24054.1|AF090942_1  PRO0657                                     49.3    2e-06   Homo sapiens [man]
gb|AAF24018.1|AF090894_1  PRO0113                                     49.7    2e-06   Homo sapiens [man]
dbj|BAC05191.1|  unnamed protein product                              50.1    3e-06   Homo sapiens [man]
gb|EAW66197.1|  chromosome 14 open reading frame 93, isoform CRA_b    50.8    3e-06   
ref|NP_001275655.1|  elongator complex protein 4 isoform 3            52.0    3e-06   
ref|XP_009444971.1|  PREDICTED: putative uncharacterized protein ...  48.5    3e-06   
gb|EHH26203.1|  hypothetical protein EGK_16111                        49.3    3e-06   
gb|EAX11460.1|  hCG2038446                                            49.3    3e-06   
gb|EHH17738.1|  hypothetical protein EGK_14200                        48.5    3e-06   
ref|XP_009000345.1|  PREDICTED: serine/threonine-protein kinase 1...  51.6    3e-06   
gb|EAX02980.1|  hCG1820679, isoform CRA_b                             49.3    3e-06   
emb|CAM28371.1|  elongation protein 4 homolog (S. cerevisiae)         51.6    3e-06   Homo sapiens [man]
gb|EHH22084.1|  hypothetical protein EGK_05279                        49.3    4e-06   
gb|EAX02036.1|  hCG1641044, isoform CRA_a                             49.3    4e-06   
gb|EHH64058.1|  hypothetical protein EGM_17177                        48.9    4e-06   
dbj|BAC86162.1|  unnamed protein product                              49.3    5e-06   Homo sapiens [man]
ref|NP_001270190.1|  uncharacterized protein LOC101866011             48.5    5e-06   
gb|EHH49632.1|  hypothetical protein EGM_00324                        48.1    5e-06   
gb|EAW55411.1|  hCG1979495                                            48.5    5e-06   
dbj|BAC85205.1|  unnamed protein product                              48.5    6e-06   Homo sapiens [man]
ref|XP_008977846.1|  PREDICTED: LOW QUALITY PROTEIN: protein GVQW1    48.9    6e-06   
gb|EHH16986.1|  hypothetical protein EGK_13267                        48.1    7e-06   
dbj|BAC85209.1|  unnamed protein product                              48.1    7e-06   Homo sapiens [man]
ref|XP_003277840.2|  PREDICTED: ubiquitin-60S ribosomal protein L...  49.3    7e-06   
gb|EHH29075.1|  hypothetical protein EGK_09403                        47.8    8e-06   
gb|EAX02144.1|  hCG1991981                                            48.1    8e-06   
ref|XP_008957879.1|  PREDICTED: zinc finger protein ENSP000003751...  48.1    8e-06   
gb|EAW83836.1|  hCG2014340                                            48.1    9e-06   
ref|XP_004092751.1|  PREDICTED: putative uncharacterized protein ...  48.1    9e-06   
gb|EHH30617.1|  hypothetical protein EGK_20357                        47.4    1e-05   
gb|EHH60881.1|  hypothetical protein EGM_18770                        47.8    1e-05   
gb|EHH15253.1|  hypothetical protein EGK_01319                        47.8    1e-05   
gb|EHH14429.1|  hypothetical protein EGK_00351                        47.0    1e-05   
gb|EAW48919.1|  hCG2028158                                            47.8    1e-05   
gb|EHH20232.1|  hypothetical protein EGK_03041                        47.4    1e-05   
gb|AAH28935.1|  C3orf64 protein                                       47.4    2e-05   Homo sapiens [man]
ref|XP_003254420.1|  PREDICTED: elongator complex protein 4 isofo...  50.1    2e-05   
gb|EAW59739.1|  hCG1817513                                            47.4    2e-05   
gb|AAG13405.1|AF285159_1  topoisomerase II alpha-4                    50.1    2e-05   Homo sapiens [man]
gb|EHH63636.1|  hypothetical protein EGM_16643                        47.0    2e-05   
ref|XP_009445351.1|  PREDICTED: transmembrane 4 L6 family member ...  48.9    2e-05   
gb|EHH50069.1|  hypothetical protein EGM_00834                        47.0    2e-05   
ref|XP_004092323.1|  PREDICTED: putative uncharacterized protein ...  47.0    2e-05   
dbj|BAC86323.1|  unnamed protein product                              47.4    2e-05   Homo sapiens [man]
ref|NP_001287848.1|  high mobility group protein HMGI-C isoform d     47.0    2e-05   
gb|EHH21096.1|  hypothetical protein EGK_04085                        47.0    2e-05   
gb|EAW69746.1|  hCG1993336                                            47.0    2e-05   
ref|XP_007985368.1|  PREDICTED: uncharacterized protein LOC103229289  48.9    2e-05   
ref|XP_003312100.1|  PREDICTED: putative calcium-sensing receptor...  47.4    2e-05   
dbj|BAB12124.1|  hypothetical protein                                 46.6    2e-05   Macaca fascicularis [crab eating macaque]
gb|AAG35479.1|AF130117_10  PRO0898                                    46.6    2e-05   Homo sapiens [man]
ref|XP_003829841.1|  PREDICTED: putative calcium-sensing receptor...  47.0    3e-05   
ref|XP_004092281.1|  PREDICTED: putative uncharacterized protein ...  46.6    3e-05   
gb|EHH19699.1|  hypothetical protein EGK_02411                        46.6    3e-05   
gb|EHH52138.1|  hypothetical protein EGM_12528                        46.6    3e-05   
ref|XP_004089135.1|  PREDICTED: methyltransferase-like protein 10...  46.2    3e-05   
gb|AAB26149.1|  X-linked retinopathy protein                          46.6    3e-05   Homo sapiens [man]
ref|XP_006719763.1|  PREDICTED: electroneutral sodium bicarbonate...  49.3    3e-05   
gb|EAX04768.1|  hCG2039105                                            46.6    3e-05   
gb|EHH60631.1|  hypothetical protein EGM_12031                        46.2    3e-05   
gb|EAW58471.1|  hCG2033684                                            47.0    3e-05   
ref|XP_008961424.1|  PREDICTED: electroneutral sodium bicarbonate...  49.3    3e-05   
dbj|BAC86569.1|  unnamed protein product                              48.5    3e-05   Homo sapiens [man]
ref|NP_001245332.1|  electroneutral sodium bicarbonate exchanger ...  49.3    3e-05   
ref|XP_004089011.1|  PREDICTED: putative uncharacterized protein ...  46.2    3e-05   
dbj|BAG61491.1|  unnamed protein product                              48.9    3e-05   Homo sapiens [man]
ref|XP_004045110.1|  PREDICTED: uncharacterized protein LOC101129799  48.1    3e-05   
gb|EHH59972.1|  hypothetical protein EGM_10210                        46.2    3e-05   
gb|EHH58869.1|  hypothetical protein EGM_08825                        45.8    3e-05   
gb|EHH20863.1|  hypothetical protein EGK_03802                        46.2    3e-05   
ref|XP_004048022.1|  PREDICTED: putative uncharacterized protein ...  46.2    4e-05   
gb|AAF22025.1|AF118094_20  PRO1900                                    46.2    4e-05   Homo sapiens [man]
gb|EAW63194.1|  hCG2040615                                            46.2    4e-05   
gb|EAW89122.1|  hCG2039054                                            45.8    4e-05   
gb|EAW92132.1|  hCG2009101                                            45.8    4e-05   
gb|EHH62571.1|  hypothetical protein EGM_20956                        46.6    4e-05   
ref|XP_004031705.1|  PREDICTED: solute carrier family 35 member F...  46.6    4e-05   
gb|EHH22373.1|  hypothetical protein EGK_05619                        45.8    4e-05   
gb|EHH18945.1|  hypothetical protein EGK_19530                        45.4    4e-05   
ref|XP_004048368.1|  PREDICTED: putative uncharacterized protein ...  45.4    5e-05   
dbj|BAC45260.1|  seven transmembrane helix receptor                   48.5    5e-05   Homo sapiens [man]
ref|XP_002799766.1|  PREDICTED: hypothetical protein LOC100428781     45.8    5e-05   
gb|EAW72125.1|  hCG1789799                                            45.8    6e-05   
gb|EHH50883.1|  hypothetical protein EGM_01778                        45.4    6e-05   
gb|EHH15935.1|  hypothetical protein EGK_02111                        45.4    6e-05   
gb|EHH55734.1|  hypothetical protein EGM_04997                        45.4    6e-05   
gb|EHH66749.1|  hypothetical protein EGM_03798                        45.1    6e-05   
gb|EHH16997.1|  hypothetical protein EGK_13278                        45.4    6e-05   
ref|XP_002800912.1|  PREDICTED: putative uncharacterized protein ...  45.4    7e-05   
ref|XP_009199962.1|  PREDICTED: putative uncharacterized protein ...  45.1    7e-05   
dbj|BAB70813.1|  unnamed protein product                              45.4    7e-05   Homo sapiens [man]
dbj|BAE89711.1|  unnamed protein product                              45.4    7e-05   
gb|EAW70079.1|  hCG2038857                                            45.4    8e-05   
gb|EHH18962.1|  hypothetical protein EGK_19562                        45.1    8e-05   
gb|EHH57573.1|  hypothetical protein EGM_07242                        45.1    9e-05   
gb|AAF22026.1|AF118094_21  PRO1902                                    45.1    9e-05   Homo sapiens [man]
ref|XP_005267863.1|  PREDICTED: uncharacterized protein C14orf105...  47.0    9e-05   
ref|XP_004092321.1|  PREDICTED: KN motif and ankyrin repeat domai...  45.8    1e-04   
gb|EHH24999.1|  hypothetical protein EGK_08749                        44.7    1e-04   
gb|EAW99058.1|  TAK1-binding protein 3, isoform CRA_b                 47.8    1e-04   
gb|EHH64557.1|  hypothetical protein EGM_17802                        44.7    1e-04   
gb|EHH31099.1|  hypothetical protein EGK_20953                        44.7    1e-04   
gb|EHH26452.1|  hypothetical protein EGK_16433                        44.7    1e-04   
ref|XP_008013785.1|  PREDICTED: tripartite motif-containing prote...  47.0    1e-04   
sp|Q86U02.1|CN165_HUMAN  RecName: Full=Putative uncharacterized p...  44.7    1e-04   Homo sapiens [man]
gb|EHH54566.1|  hypothetical protein EGM_15433                        44.3    1e-04   
ref|XP_009000758.1|  PREDICTED: metalloreductase STEAP2 isoform X3    47.4    1e-04   
gb|EHH51985.1|  hypothetical protein EGM_12341                        44.7    1e-04   
gb|EAX08724.1|  hCG2038303                                            44.3    2e-04   
gb|EHH59230.1|  hypothetical protein EGM_09292                        43.9    2e-04   
dbj|BAC85380.1|  unnamed protein product                              44.7    2e-04   Homo sapiens [man]
ref|XP_004045461.1|  PREDICTED: putative uncharacterized protein ...  44.3    2e-04   
ref|XP_004060486.1|  PREDICTED: uncharacterized protein LOC101134118  45.8    2e-04   
gb|EHH53367.1|  hypothetical protein EGM_13996                        44.7    2e-04   
gb|EHH17322.1|  hypothetical protein EGK_13706                        44.3    2e-04   
gb|EHH27543.1|  hypothetical protein EGK_17760                        44.3    2e-04   
gb|AAF69609.1|AF119917_17  PRO1847                                    43.9    2e-04   Homo sapiens [man]
gb|EHH20620.1|  hypothetical protein EGK_03509                        43.9    2e-04   
sp|Q8N2A0.1|CX062_HUMAN  RecName: Full=Putative uncharacterized p...  44.7    2e-04   Homo sapiens [man]
gb|AAL55737.1|AF289553_1  unknown                                     43.9    2e-04   Homo sapiens [man]
gb|AAU43855.1|  HMGA2e'                                               44.3    2e-04   Homo sapiens [man]
gb|EAW65432.1|  hCG2038442                                            43.9    2e-04   
dbj|BAC85305.1|  unnamed protein product                              44.3    2e-04   Homo sapiens [man]
gb|EHH16041.1|  hypothetical protein EGK_11270                        44.3    2e-04   
gb|EHH16558.1|  hypothetical protein EGK_11851                        43.5    2e-04   
gb|EHH63176.1|  hypothetical protein EGM_16090                        43.5    2e-04   
gb|EHH27936.1|  hypothetical protein EGK_18253                        43.5    2e-04   
dbj|BAG59163.1|  unnamed protein product                              43.9    2e-04   Homo sapiens [man]
dbj|BAB39337.1|  hypothetical protein                                 43.9    3e-04   Macaca fascicularis [crab eating macaque]
gb|EHH55556.1|  hypothetical protein EGM_04788                        43.9    3e-04   
gb|EHH60624.1|  hypothetical protein EGM_12020                        43.9    3e-04   
ref|XP_003846764.1|  PREDICTED: putative uncharacterized protein ...  44.3    3e-04   
gb|EHH57429.1|  hypothetical protein EGM_07048                        43.5    3e-04   
ref|XP_009249894.1|  PREDICTED: acyl-CoA-binding domain-containin...  45.8    3e-04   
gb|EHH23728.1|  hypothetical protein EGK_07262                        43.5    3e-04   
gb|EHH49511.1|  hypothetical protein EGM_00180                        43.9    3e-04   
pir||I38022  hypothetical protein - human                             44.7    3e-04
gb|EAW94215.1|  hCG1820974                                            43.9    3e-04   
gb|EHH55411.1|  hypothetical protein EGM_04619                        43.1    3e-04   
ref|XP_003830704.1|  PREDICTED: putative calcium-sensing receptor...  46.2    3e-04   
gb|EHH60591.1|  hypothetical protein EGM_11981                        43.1    3e-04   
sp|Q8NGV9.1|CSRL1_HUMAN  RecName: Full=Putative calcium-sensing r...  46.2    3e-04   
gb|EAW78738.1|  hCG27718                                              46.2    3e-04   
gb|EHH63683.1|  hypothetical protein EGM_16698                        43.1    4e-04   
gb|AAF22022.1|AF118094_17  PRO1848                                    43.5    4e-04   Homo sapiens [man]
gb|EHH64004.1|  hypothetical protein EGM_17106                        43.5    4e-04   
gb|EAX00825.1|  hCG1989288                                            43.1    4e-04   
emb|CAD38576.2|  hypothetical protein                                 45.8    4e-04   Homo sapiens [man]
dbj|BAC03988.1|  unnamed protein product                              43.9    4e-04   Homo sapiens [man]
gb|EHH50766.1|  hypothetical protein EGM_01641                        43.1    4e-04   
gb|AAH67859.1|  GTF2IRD2 protein                                      45.8    4e-04   Homo sapiens [man]
ref|XP_004089607.1|  PREDICTED: putative uncharacterized protein ...  43.5    5e-04   
gb|EHH18952.1|  hypothetical protein EGK_19543                        42.7    5e-04   
dbj|BAG64901.1|  unnamed protein product                              43.9    5e-04   Homo sapiens [man]
ref|XP_004089707.1|  PREDICTED: LOW QUALITY PROTEIN: putative cal...  45.8    5e-04   
gb|EHH27277.1|  hypothetical protein EGK_17439                        42.7    5e-04   
gb|EHH64622.1|  hypothetical protein EGM_17881                        42.7    5e-04   
ref|XP_004025400.1|  PREDICTED: zinc finger protein ENSP000003751...  42.7    5e-04   
gb|EHH17143.1|  hypothetical protein EGK_13471                        42.7    5e-04   
gb|EAX06302.1|  hCG2038847                                            43.5    6e-04   
gb|AIC59745.1|  CHP                                                   42.7    6e-04   
ref|XP_008997697.1|  PREDICTED: putative uncharacterized protein ...  42.7    6e-04   
ref|XP_004065407.1|  PREDICTED: LOW QUALITY PROTEIN: general tran...  44.7    6e-04   
gb|EHH50885.1|  hypothetical protein EGM_01780                        42.7    6e-04   
dbj|BAE89837.1|  unnamed protein product                              42.4    6e-04   
gb|EHH31460.1|  hypothetical protein EGK_12542                        42.7    7e-04   
sp|Q6ZWE1.1|CC066_HUMAN  RecName: Full=Putative uncharacterized p...  42.7    7e-04   Homo sapiens [man]
gb|EAX08129.1|  hCG2038166                                            42.7    7e-04   
gb|AAQ04644.1|AF447869_1  Unknown                                     42.7    7e-04   Homo sapiens [man]
gb|EAW65398.1|  hCG2041530, isoform CRA_a                             42.4    7e-04   
dbj|BAC85220.1|  unnamed protein product                              42.7    7e-04   Homo sapiens [man]
gb|EAW65399.1|  hCG2041530, isoform CRA_b                             42.4    7e-04   
gb|EAW66730.1|  hCG1798187                                            42.4    8e-04   
gb|AAK55521.1|AF305818_1  PRO0764                                     42.7    8e-04   Homo sapiens [man]
gb|EHH30155.1|  hypothetical protein EGK_10762                        42.4    8e-04   
gb|EAX04538.1|  hCG2000782                                            42.4    8e-04   
gb|EAW59619.1|  hCG2010644                                            42.4    8e-04   
gb|EAW62946.1|  hCG2038800                                            42.4    8e-04   
ref|NP_001243297.1|  uncharacterized protein LOC100144595             42.4    9e-04   
gb|EHB03251.1|  hypothetical protein GW7_10939                        42.4    9e-04   
gb|EHH57493.1|  hypothetical protein EGM_07132                        42.4    9e-04   
gb|AAG35513.1|AF130117_46  PRO2411                                    42.0    0.001   Homo sapiens [man]
gb|EAX08465.1|  hCG1820635                                            42.4    0.001   
dbj|BAG52531.1|  unnamed protein product                              42.4    0.001   Homo sapiens [man]
ref|XP_004047977.1|  PREDICTED: putative uncharacterized protein ...  42.0    0.001   
gb|AIC61903.1|  hypothetical protein                                  37.4    0.001   



>dbj|BAC85346.1| unnamed protein product [Homo sapiens]
Length=153

 Score = 59.3 bits (142),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ AEITGMHHHAQL FVF VETG H+V QAG
Sbjct  31   PASASQIAEITGMHHHAQLIFVFLVETGFHHVGQAG  66



>gb|EAW55077.1| hCG1978892, isoform CRA_a [Homo sapiens]
Length=64

 Score = 56.2 bits (134),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PP SASQ A  TGM HH+QL F+FFVET S++VAQAG
Sbjct  14   PPASASQVARTTGMCHHSQLIFLFFVETRSNFVAQAG  50



>dbj|BAC05428.1| unnamed protein product [Homo sapiens]
Length=182

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQL-FFVFFVETGSHYVAQAG  113
            PP  ASQ A  TGMHHHAQ+ FF+FFVETGSHYV Q G
Sbjct  91   PPALASQVAWTTGMHHHAQIIFFLFFVETGSHYVTQTG  128



>gb|EAX08697.1| hypothetical protein FLJ31846, isoform CRA_a [Homo sapiens]
Length=265

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP + DYRH P CPA FCIF RD  S C PGW
Sbjct  225  LSLPDNWDYRHVPQCPANFCIFSRDGVSPCWPGW  258



>sp|Q96MD7.1|CI085_HUMAN RecName: Full=Uncharacterized protein C9orf85 [Homo sapiens]
Length=179

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A  TG HHHAQL FVF VE G HYV QAG
Sbjct  138  PASASRVAGTTGAHHHAQLIFVFLVEMGFHYVGQAG  173



>gb|EHH59362.1| hypothetical protein EGM_09449, partial [Macaca fascicularis]
Length=103

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  AE TG HHHAQL FVF VETG HYV QAG
Sbjct  35   PASASGVAESTGTHHHAQLIFVFLVETGFHYVGQAG  70



>gb|EHH20263.1| hypothetical protein EGK_03078, partial [Macaca mulatta]
Length=161

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRHAPPCP  FCIF RDR SLC PGW
Sbjct  128  LSLLSSWDYRHAPPCPFNFCIFSRDRVSLCWPGW  161



>gb|EAW90130.1| dynein heavy chain domain 3, isoform CRA_b, partial [Homo sapiens]
Length=759

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  714  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  749



>gb|EHH16588.1| hypothetical protein EGK_11888, partial [Macaca mulatta]
Length=94

 Score = 53.5 bits (127),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITGMHHHAQL FVF VE G H+V QAG
Sbjct  39   PASASGVAGITGMHHHAQLIFVFLVEMGFHHVGQAG  74



>dbj|BAC87498.1| unnamed protein product [Homo sapiens]
Length=138

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    TSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            TSASQ A ITGMHHHAQL FVF VE G H V QAG
Sbjct  42   TSASQVAGITGMHHHAQLIFVFLVEMGFHCVGQAG  76



>dbj|BAC85949.1| unnamed protein product [Homo sapiens]
Length=138

 Score = 53.9 bits (128),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  9    TSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            TSASQ A ITGMHHHAQL FVF VE G H V QAG
Sbjct  42   TSASQVAGITGMHHHAQLIFVFLVEMGFHCVGQAG  76



>dbj|BAF85296.1| unnamed protein product [Homo sapiens]
Length=872

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  827  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  862



>ref|NP_001290199.1| dynein heavy chain 2, axonemal isoform 2 [Homo sapiens]
Length=872

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  827  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  862



>gb|AAH34225.1| DNAH2 protein [Homo sapiens]
Length=872

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  827  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  862



>gb|EHH64738.1| hypothetical protein EGM_18043, partial [Macaca fascicularis]
Length=82

 Score = 52.8 bits (125),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG+HHHAQL FVF VET  H+V QAG
Sbjct  36   PASASQVAGITGIHHHAQLIFVFLVETAFHHVGQAG  71



>dbj|BAG11332.1| dynein heavy chain domain 3 [synthetic construct]
Length=790

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  745  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  780



>gb|EAW90129.1| dynein heavy chain domain 3, isoform CRA_a [Homo sapiens]
Length=790

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  109  AWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            AWAT   PVS KNTK SWAWW  PV+SA+WE EVGG
Sbjct  745  AWATWQNPVSAKNTKISWAWWHKPVVSATWEGEVGG  780



>gb|EHH24166.1| hypothetical protein EGK_07776, partial [Macaca mulatta]
Length=179

 Score = 53.1 bits (126),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P S S+ A ITG HHHAQL FVF VE G H+V QAG
Sbjct  138  PASDSRVAGITGTHHHAQLIFVFLVEMGFHHVGQAG  173



>dbj|BAG58285.1| unnamed protein product [Homo sapiens]
Length=368

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            PAWAT   P+STKNTK S AWWC PV+ A+WEAE GG
Sbjct  322  PAWATWRNPISTKNTKLSQAWWCAPVVPATWEAEAGG  358



>ref|XP_002801242.1| PREDICTED: putative uncharacterized protein CXorf62-like [Macaca 
mulatta]
Length=115

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG +HHAQL FVF VETG H+V QAG
Sbjct  48   PASASQVAGITGANHHAQLIFVFLVETGFHHVGQAG  83



>gb|EHH60270.1| hypothetical protein EGM_11598, partial [Macaca fascicularis]
Length=94

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG HHHA L FVF VETG H+V QAG
Sbjct  31   PASASQVAGITGAHHHAWLIFVFLVETGFHHVGQAG  66



>gb|EHH61346.1| hypothetical protein EGM_19342, partial [Macaca fascicularis]
Length=96

 Score = 52.0 bits (123),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG HHHA+L FVF VETG H+V QAG
Sbjct  37   PASASRVAGITGSHHHARLIFVFLVETGFHHVGQAG  72



>dbj|BAE89854.1| unnamed protein product [Macaca fascicularis]
Length=65

 Score = 51.6 bits (122),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPCP  FCIF RD  S C PGW
Sbjct  31   LSLPSSWDYRHTPPCPGKFCIFSRDGVSRCWPGW  64



>gb|AAL55794.1|AF289610_1 unknown [Homo sapiens]
Length=118

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            PAW T   PVSTKNT+   AWW MPVISA+WE EVGG
Sbjct  72   PAWPTWRSPVSTKNTRVGQAWWSMPVISATWETEVGG  108



>gb|EAW68953.1| hCG1814039, partial [Homo sapiens]
Length=110

 Score = 51.6 bits (122),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P S S+ A ITG HHHA+L FVF VE G HYV QAG
Sbjct  17   PASVSRVAGITGAHHHARLIFVFLVEMGFHYVGQAG  52



>dbj|BAC05317.1| unnamed protein product [Homo sapiens]
Length=190

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  QPGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
             PGQH E LSL KIQK AG GG+ L SQLLGRL+WED
Sbjct  66   MPGQHGETLSLLKIQKLAGCGGSHLYSQLLGRLKWED  102



>gb|AAH12514.1| ELP4 protein [Homo sapiens]
 gb|ABM82394.1| elongation protein 4 homolog (S. cerevisiae) [synthetic construct]
 gb|ABM85577.1| elongation protein 4 homolog (S. cerevisiae) [synthetic construct]
Length=535

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG HHHAQL FVF VE G H+V QAG
Sbjct  403  PASASLVAGITGAHHHAQLIFVFLVEMGFHHVGQAG  438



>gb|EHH54194.1| hypothetical protein EGM_14979, partial [Macaca fascicularis]
Length=98

 Score = 50.4 bits (119),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITGMHHH QL FVF VE   H+V QAG
Sbjct  34   PASASQVAGITGMHHHTQLIFVFLVEKVFHHVGQAG  69



>gb|EHH52072.1| hypothetical protein EGM_12441, partial [Macaca fascicularis]
Length=97

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SAS+ A ITG+HHH QL FVF VETG H+V QAG
Sbjct  43   SASRVAGITGVHHHTQLIFVFLVETGFHHVGQAG  76



>ref|XP_004045460.1| PREDICTED: putative uncharacterized protein encoded by LINC00596-like 
[Gorilla gorilla gorilla]
Length=100

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP   DYR+ PPCPA FCIF RDR S C PGW
Sbjct  66   LSLPSRWDYRYVPPCPANFCIFSRDRVSPCWPGW  99



>gb|EAW95971.1| hCG1812997 [Homo sapiens]
Length=60

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQL-FFVFFVETGSHYVAQAG  113
            PPTS    A ITG+ HH  L FFV FVETGSHYV+ AG
Sbjct  22   PPTSVPHVAWITGLCHHTWLTFFVIFVETGSHYVSHAG  59



>dbj|BAC04333.1| unnamed protein product [Homo sapiens]
Length=129

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG++HHA L FVF VE G HY+ QAG
Sbjct  51   PASASRIAGITGVYHHAWLLFVFLVEMGFHYIGQAG  86



>gb|EHH23662.1| hypothetical protein EGK_07177, partial [Macaca mulatta]
Length=105

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG+ HHAQL FVF VETG H+V QAG
Sbjct  39   PVSASRVAGITGVSHHAQLVFVFLVETGFHHVGQAG  74



>sp|Q8N976.1|YG039_HUMAN RecName: Full=Putative uncharacterized protein FLJ38264 [Homo 
sapiens]
Length=141

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PT ASQ  EITG HHH +L FVF VETG H+V  AG
Sbjct  18   PTLASQVGEITGTHHHTRLIFVFLVETGFHHVGHAG  53



>gb|EAW52094.1| hCG1735644 [Homo sapiens]
Length=141

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PT ASQ  EITG HHH +L FVF VETG H+V  AG
Sbjct  18   PTLASQVGEITGTHHHTRLIFVFLVETGFHHVGHAG  53



>gb|EHH53906.1| hypothetical protein EGM_14617, partial [Macaca fascicularis]
Length=80

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG H+HAQL F+F V+TG H+V QAG
Sbjct  22   PASASQVAGITGAHYHAQLIFLFLVKTGFHHVGQAG  57



>dbj|BAB93502.1| OK/SW-CL.41 [Homo sapiens]
Length=109

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PTSAS+ A ITGM HH QL F+F VE G H+V QAG
Sbjct  30   PTSASRVAGITGMQHHTQLIFLFLVEMGFHHVGQAG  65



>gb|EHH25035.1| hypothetical protein EGK_08789, partial [Macaca mulatta]
Length=62

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPCP  FCIF RDR S C  GW
Sbjct  22   LSLPSSWDYRHTPPCPTNFCIFSRDRVSPCWSGW  55



>gb|EHH27424.1| hypothetical protein EGK_17617, partial [Macaca mulatta]
Length=78

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HHAQL FVF VE G H+V QAG
Sbjct  17   PASASQVAGITGKCHHAQLIFVFLVEMGFHHVGQAG  52



>gb|EHH20736.1| hypothetical protein EGK_03652, partial [Macaca mulatta]
Length=103

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA+Q A ITG  HHA+L F+FFVETG H+V QAG
Sbjct  38   PASATQVAGITGPRHHARLIFLFFVETGFHHVGQAG  73



>gb|EAW57092.1| hCG1995581, partial [Homo sapiens]
Length=230

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQA  110
            PP SAS+ A ITG+HHHA+L FVF VE G H+V QA
Sbjct  124  PPISASRVAGITGVHHHARLIFVFLVEMGFHHVGQA  159



>ref|XP_007974487.1| PREDICTED: uncharacterized protein LOC103223591 [Chlorocebus 
sabaeus]
Length=321

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITGMHHHA+L FV  VETG H V QAG
Sbjct  93   PASASRVAVITGMHHHARLMFVLLVETGFHRVDQAG  128



>gb|EHH18929.1| hypothetical protein EGK_19508, partial [Macaca mulatta]
Length=66

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PPC A FCIF RDR SLC PGW
Sbjct  27   LSLPSSWDYRCVPPCQANFCIFSRDRVSLCWPGW  60



>dbj|BAG61429.1| unnamed protein product [Homo sapiens]
Length=196

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ   ITG  HHAQL FVF VE G HYV QAG
Sbjct  157  SASQVGGITGARHHAQLIFVFLVEMGFHYVGQAG  190



>gb|AAF24054.1|AF090942_1 PRO0657 [Homo sapiens]
Length=81

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  QPGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            +PGQH E  SL KIQK AGHGG CL SQ+LGRLR E+
Sbjct  12   RPGQHGEIPSLLKIQKLAGHGGMCLQSQILGRLREEN  48



>gb|AAF24018.1|AF090894_1 PRO0113 [Homo sapiens]
Length=121

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ AE T  HHHAQL F+FFVE G  +VAQAG
Sbjct  17   PISASQVAETTEKHHHAQLIFIFFVEMGFCHVAQAG  52



>dbj|BAC05191.1| unnamed protein product [Homo sapiens]
Length=179

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITGM HHA L F++ VE G H+V+QAG
Sbjct  110  PVSASQVARITGMRHHAWLIFLYLVEMGFHHVSQAG  145



>gb|EAW66197.1| chromosome 14 open reading frame 93, isoform CRA_b [Homo sapiens]
Length=228

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITGM HHA L FVF VETG H+V QAG
Sbjct  43   PVSASRVAGITGMCHHAGLIFVFLVETGFHHVGQAG  78



>ref|NP_001275655.1| elongator complex protein 4 isoform 3 [Homo sapiens]
 gb|EAW68238.1| elongation protein 4 homolog (S. cerevisiae), isoform CRA_b [Homo 
sapiens]
Length=535

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG HHH QL FVF VE G H+V QAG
Sbjct  403  PASASLVAGITGAHHHTQLIFVFLVEMGFHHVGQAG  438



>ref|XP_009444971.1| PREDICTED: putative uncharacterized protein encoded by LINC00596, 
partial [Pan troglodytes]
Length=57

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRH PP PA FCIF RDR SLC PGW
Sbjct  22   LSLLSSRDYRHPPPRPANFCIFSRDRVSLCWPGW  55



>gb|EHH26203.1| hypothetical protein EGK_16111, partial [Macaca mulatta]
Length=119

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG+HHH  L F+F VETG H+V QAG
Sbjct  22   PASASRVAGITGVHHHDWLIFIFLVETGLHHVGQAG  57



>gb|EAX11460.1| hCG2038446, partial [Homo sapiens]
Length=135

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG  HHAQL FVF VETG H+V QAG
Sbjct  76   PASASPVAGITGACHHAQLIFVFLVETGFHHVVQAG  111



>gb|EHH17738.1| hypothetical protein EGK_14200, partial [Macaca mulatta]
Length=58

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PTSAS+ A ITG++HH QL FVF+V+T  H+V QAG
Sbjct  8    PTSASRVAGITGVYHHTQLIFVFWVKTWFHHVGQAG  43



>ref|XP_009000345.1| PREDICTED: serine/threonine-protein kinase 17A isoform X2 [Callithrix 
jacchus]
Length=375

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  PGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            PGQH E LSL KIQK A HGG  L SQLLGRLRW++
Sbjct  312  PGQHGETLSLLKIQKLARHGGTHLWSQLLGRLRWKN  347



>gb|EAX02980.1| hCG1820679, isoform CRA_b [Homo sapiens]
Length=143

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S+LSL  S D+RH PPCPA FCIF RD  S C PGW
Sbjct  101  SYLSLLSSWDHRHTPPCPANFCIFSRDGVSPCWPGW  136



>emb|CAM28371.1| elongation protein 4 homolog (S. cerevisiae) [Homo sapiens]
Length=531

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG HHH QL FVF VE G H+V QAG
Sbjct  403  PASASLVAGITGAHHHTQLIFVFLVEMGFHHVGQAG  438



>gb|EHH22084.1| hypothetical protein EGK_05279, partial [Macaca mulatta]
Length=134

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HHAQL F+F VE G H+V QAG
Sbjct  67   PASASQVAGITGTCHHAQLIFIFLVEMGFHHVGQAG  102



>gb|EAX02036.1| hCG1641044, isoform CRA_a [Homo sapiens]
 gb|EAX02037.1| hCG1641044, isoform CRA_a [Homo sapiens]
Length=184

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SHLSLP S DYR  PP PA FCIF R+  S C PGW
Sbjct  148  SHLSLPSSWDYRRPPPHPANFCIFSREGVSPCWPGW  183



>gb|EHH64058.1| hypothetical protein EGM_17177, partial [Macaca fascicularis]
Length=104

 Score = 48.9 bits (115),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG++HHA L F F VETG H+V QAG
Sbjct  33   PASASQVAGITGVYHHAWLIFAFLVETGFHHVGQAG  68



>dbj|BAC86162.1| unnamed protein product [Homo sapiens]
Length=183

 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PPT ASQ A   G HHH +  FVFF ETG H VAQAG
Sbjct  14   PPTLASQVAGTIGTHHHVRPIFVFFKETGCHCVAQAG  50



>ref|NP_001270190.1| uncharacterized protein LOC101866011 [Macaca fascicularis]
 dbj|BAE91654.1| unnamed protein product [Macaca fascicularis]
Length=115

 Score = 48.5 bits (114),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A I G +HHAQL FVF VETG  +V QAG
Sbjct  48   PASASQVAGIAGANHHAQLIFVFLVETGFRHVGQAG  83



>gb|EHH49632.1| hypothetical protein EGM_00324, partial [Macaca fascicularis]
Length=65

 Score = 48.1 bits (113),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S+LSLP + DYRH+PP PA FCIF  D  S C PGW
Sbjct  29   SYLSLPSNWDYRHSPPHPANFCIFSTDGVSPCWPGW  64



>gb|EAW55411.1| hCG1979495 [Homo sapiens]
Length=122

 Score = 48.5 bits (114),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    SSHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCP  106
            SSHL L  S DYRH PP  A FCIFCRD  SLCCP
Sbjct  53   SSHLILLSSWDYRHTPPHLAKFCIFCRDGVSLCCP  87



>dbj|BAC85205.1| unnamed protein product [Homo sapiens]
Length=128

 Score = 48.5 bits (114),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SAS+ + ITG  HHAQLFFVF VETG H++ QAG
Sbjct  57   SASRVSGITGSRHHAQLFFVFLVETGFHHIGQAG  90



>ref|XP_008977846.1| PREDICTED: LOW QUALITY PROTEIN: protein GVQW1, partial [Callithrix 
jacchus]
Length=190

 Score = 48.9 bits (115),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PP  A FCIF RD  SLC PGW
Sbjct  139  LSLPSSWDYRHMPPYSANFCIFSRDGVSLCWPGW  172



>gb|EHH16986.1| hypothetical protein EGK_13267, partial [Macaca mulatta]
Length=90

 Score = 48.1 bits (113),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG+HHH +L F F  ETG H+V QAG
Sbjct  22   PASASRVAGITGIHHHTRLIFAFLAETGFHHVGQAG  57



>dbj|BAC85209.1| unnamed protein product [Homo sapiens]
Length=121

 Score = 48.1 bits (113),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG H HA+L FVF VETG H+V QAG
Sbjct  40   PASASHVAGITGAHRHARLVFVFLVETGFHHVGQAG  75



>ref|XP_003277840.2| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform 1 
[Nomascus leucogenys]
Length=205

 Score = 49.3 bits (116),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P S S+ A ITG  HHAQL FVF VETG  +V QAG
Sbjct  23   PASGSRVAGITGARHHAQLIFVFLVETGFRHVGQAG  58



>gb|EHH29075.1| hypothetical protein EGK_09403, partial [Macaca mulatta]
Length=80

 Score = 47.8 bits (112),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG  HH QL FVF +ETG H+V QAG
Sbjct  22   PASASRVAGITGTCHHTQLIFVFLIETGFHHVGQAG  57



>gb|EAX02144.1| hCG1991981 [Homo sapiens]
Length=136

 Score = 48.1 bits (113),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQA  110
            PTSAS+ A ITGM HHA L FVF VETG  +V QA
Sbjct  58   PTSASRVAGITGMRHHAWLIFVFLVETGFRHVGQA  92



>ref|XP_008957879.1| PREDICTED: zinc finger protein ENSP00000375192-like [Pan paniscus]
 ref|XP_008957880.1| PREDICTED: zinc finger protein ENSP00000375192-like [Pan paniscus]
 dbj|BAC86222.1| unnamed protein product [Homo sapiens]
Length=164

 Score = 48.1 bits (113),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITGM HHA+L FVF VE G H+V +AG
Sbjct  47   PASASRVAGITGMCHHARLIFVFLVEMGFHHVGEAG  82



>gb|EAW83836.1| hCG2014340 [Homo sapiens]
Length=132

 Score = 48.1 bits (113),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +2

Query  14   SLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SLP S DYRH PP P  FCIF RD  S C PGW
Sbjct  47   SLPSSWDYRHLPPSPGNFCIFSRDGVSPCWPGW  79



>ref|XP_004092751.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Nomascus leucogenys]
Length=149

 Score = 48.1 bits (113),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HHA L F F VETG H+V QAG
Sbjct  66   PASASQVAGITGTRHHAWLIFKFLVETGFHHVGQAG  101



>gb|EHH30617.1| hypothetical protein EGK_20357, partial [Macaca mulatta]
 gb|EHH60789.1| hypothetical protein EGM_18650, partial [Macaca fascicularis]
Length=61

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SHLSLP S DYR APP  A FCIF  DR S C PGW
Sbjct  25   SHLSLPSSRDYRCAPPYLANFCIFSEDRVSPCWPGW  60



>gb|EHH60881.1| hypothetical protein EGM_18770, partial [Macaca fascicularis]
Length=99

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH+QL FVF +E G H V QAG
Sbjct  34   PASASQVAGITGACHHSQLIFVFLLEMGFHRVGQAG  69



>gb|EHH15253.1| hypothetical protein EGK_01319, partial [Macaca mulatta]
Length=113

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG+HHH  L FVF VE G H V QAG
Sbjct  37   PASASRTAGITGVHHHTWLIFVFLVEIGFHVVDQAG  72



>gb|EHH14429.1| hypothetical protein EGK_00351, partial [Macaca mulatta]
Length=65

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S+LSLP + DYRH PP PA FCIF  D  S C PGW
Sbjct  29   SYLSLPSNWDYRHPPPHPANFCIFSTDGVSPCWPGW  64



>gb|EAW48919.1| hCG2028158, partial [Homo sapiens]
Length=136

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPC A FCIF + R S C PGW
Sbjct  32   LSLPSSWDYRHVPPCLANFCIFSKGRVSPCWPGW  65



>gb|EHH20232.1| hypothetical protein EGK_03041, partial [Macaca mulatta]
Length=95

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PTSAS+ A  TG  HHA L FVF VETG H+V QAG
Sbjct  35   PTSASRVAGTTGTPHHAWLIFVFLVETGFHHVGQAG  70



>gb|AAH28935.1| C3orf64 protein [Homo sapiens]
 gb|AIC63728.1| C3orf64, partial [synthetic construct]
Length=135

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  15   ASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            ASQ A ITG+HHHAQL FVF +ET  H+V QAG
Sbjct  20   ASQVAGITGVHHHAQLIFVFLIETEFHHVGQAG  52



>ref|XP_003254420.1| PREDICTED: elongator complex protein 4 isoform 3 [Nomascus leucogenys]
Length=535

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA   A ITG HHHAQL F+F VE G H+V QAG
Sbjct  403  PASACLIAGITGAHHHAQLIFLFLVEMGFHHVGQAG  438



>gb|EAW59739.1| hCG1817513 [Homo sapiens]
Length=128

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DY + PP PA FCIF RD  S CCPGW
Sbjct  74   LSLPSSWDYSYTPPHPANFCIFSRDGVSPCCPGW  107



>gb|AAG13405.1|AF285159_1 topoisomerase II alpha-4 [Homo sapiens]
Length=581

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A I G  HH QL FVF VETG H+V QAG
Sbjct  378  PASASRVAGIAGGCHHTQLIFVFLVETGFHHVGQAG  413



>gb|EHH63636.1| hypothetical protein EGM_16643, partial [Macaca fascicularis]
Length=91

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH  L FVF VETG H++ QAG
Sbjct  35   PASASQVAGITGARHHDWLIFVFLVETGFHHLGQAG  70



>ref|XP_009445351.1| PREDICTED: transmembrane 4 L6 family member 19 isoform X1 [Pan 
troglodytes]
Length=299

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH QL FVF VETG H V+Q G
Sbjct  258  PASASQVAGITGTCHHTQLIFVFLVETGFHNVSQDG  293



>gb|EHH50069.1| hypothetical protein EGM_00834, partial [Macaca fascicularis]
Length=86

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ A ITG  HHAQL FVF VE G H+V QAG
Sbjct  19   SASQVAGITGARHHAQLIFVFLVEMGFHHVGQAG  52



>ref|XP_004092323.1| PREDICTED: putative uncharacterized protein C3orf66-like [Nomascus 
leucogenys]
Length=95

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCR-DRFSLCCPGW  112
            L+L  S DYRH PPCPA FCIF R D  SLC PGW
Sbjct  47   LNLLSSWDYRHVPPCPANFCIFSRQDGVSLCHPGW  81



>dbj|BAC86323.1| unnamed protein product [Homo sapiens]
Length=156

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG+ +HAQL FVF VE G H+V QAG
Sbjct  83   PASASQLAGTTGVRNHAQLIFVFLVEMGFHHVGQAG  118



>ref|NP_001287848.1| high mobility group protein HMGI-C isoform d [Homo sapiens]
Length=147

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +2

Query  32   DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            DYRH PP PA FCIF RDR S C PGW
Sbjct  114  DYRHPPPHPANFCIFSRDRVSPCWPGW  140



>gb|EHH21096.1| hypothetical protein EGK_04085, partial [Macaca mulatta]
Length=104

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITGM HH  L FVF VE G H+V Q G
Sbjct  40   PASASQVAGITGMCHHTWLIFVFLVEMGFHHVGQTG  75



>gb|EAW69746.1| hCG1993336 [Homo sapiens]
Length=119

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG  HHA+L FVF VE G H+VAQAG
Sbjct  65   PASASQVAGTTGACHHARLIFVFLVEMGFHHVAQAG  100



>ref|XP_007985368.1| PREDICTED: uncharacterized protein LOC103229289 [Chlorocebus 
sabaeus]
Length=323

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG HHHA L FVF VETG H + QAG
Sbjct  248  PASASQVAGTTGAHHHAWLIFVFLVETGFHRIGQAG  283



>ref|XP_003312100.1| PREDICTED: putative calcium-sensing receptor-like 1 [Pan troglodytes]
 gb|AAG35505.1|AF130117_38 PRO2852 [Homo sapiens]
Length=169

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG  HHAQL  VF VETG H++ QAG
Sbjct  23   PVSASRVAGITGACHHAQLISVFLVETGFHHIGQAG  58



>dbj|BAB12124.1| hypothetical protein [Macaca fascicularis]
Length=113

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            PAWAT   P STK TK SW  WC+PV+ A+ EAE+GG
Sbjct  67   PAWATWQNPASTKKTKISWQLWCIPVVPATQEAEMGG  103



>gb|AAG35479.1|AF130117_10 PRO0898 [Homo sapiens]
Length=111

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PP PA FCI  RD  S C PGW
Sbjct  57   LSLPSSWDYRHMPPRPANFCILSRDGISPCWPGW  90



>ref|XP_003829841.1| PREDICTED: putative calcium-sensing receptor-like 1 [Pan paniscus]
Length=169

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG  HHAQL  VF VETG H++ QAG
Sbjct  23   PVSASRVAGITGACHHAQLISVFLVETGFHHIGQAG  58



>ref|XP_004092281.1| PREDICTED: putative uncharacterized protein C3orf66-like [Nomascus 
leucogenys]
Length=86

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PP PA FCIF +DR S   PGW
Sbjct  32   LSLPSSWDYRHPPPRPANFCIFSKDRVSPYWPGW  65



>gb|EHH19699.1| hypothetical protein EGK_02411, partial [Macaca mulatta]
Length=131

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+   ITG  HHAQL FVF VE G H+V QAG
Sbjct  68   PASASRVTGITGACHHAQLIFVFLVEMGFHHVGQAG  103



>gb|EHH52138.1| hypothetical protein EGM_12528, partial [Macaca fascicularis]
Length=109

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ AE TG HHHA + FVF +ET  H+V QAG
Sbjct  26   PASASRVAEFTGAHHHAWIIFVFLIETEFHHVGQAG  61



>ref|XP_004089135.1| PREDICTED: methyltransferase-like protein 10-like [Nomascus leucogenys]
Length=70

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
             AS+ A ITG+HHHAQL FVF VETG   V QAG
Sbjct  18   CASRVAGITGVHHHAQLIFVFLVETGFPPVGQAG  51



>gb|AAB26149.1| X-linked retinopathy protein, partial [Homo sapiens]
Length=100

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  15  ASQEAEITGMHHHAQLFFVFFVETGSHY  98
           AS+ A ITGMHHH QL FVF VETGSH 
Sbjct  40  ASRVAGITGMHHHTQLIFVFLVETGSHM  67



>ref|XP_006719763.1| PREDICTED: electroneutral sodium bicarbonate exchanger 1 isoform 
X1 [Homo sapiens]
Length=800

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   LPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LP S DYRHAPP PA FCIF RD  S C PGW
Sbjct  748  LPSSWDYRHAPPQPANFCIFSRDGVSPCWPGW  779



>gb|EAX04768.1| hCG2039105, partial [Homo sapiens]
Length=115

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P S SQ A ITG+ HHA+L FVF VET  H+V QAG
Sbjct  41   PASDSQVARITGVCHHARLIFVFLVETEFHHVRQAG  76



>gb|EHH60631.1| hypothetical protein EGM_12031, partial [Macaca fascicularis]
Length=62

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPCPA F IF RD  S C  GW
Sbjct  22   LSLPSSWDYRHVPPCPANFYIFNRDGVSPCWSGW  55



>gb|EAW58471.1| hCG2033684 [Homo sapiens]
Length=169

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG  HHAQL  VF VETG H++ QAG
Sbjct  23   PVSASRVAGITGACHHAQLISVFLVETGFHHIGQAG  58



>ref|XP_008961424.1| PREDICTED: electroneutral sodium bicarbonate exchanger 1 isoform 
X4 [Pan paniscus]
Length=747

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   LPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LP S DYRHAPP PA FCIF RD  S C PGW
Sbjct  695  LPSSWDYRHAPPQPANFCIFSRDGVSPCWPGW  726



>dbj|BAC86569.1| unnamed protein product [Homo sapiens]
Length=314

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  QPGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            QPG+H E LSL K+QK AG  G CL SQLLGRLR E+
Sbjct  151  QPGRHDEALSLPKMQKLAGCDGGCLWSQLLGRLRQEN  187



>ref|NP_001245332.1| electroneutral sodium bicarbonate exchanger 1 isoform e [Homo 
sapiens]
Length=747

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   LPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LP S DYRHAPP PA FCIF RD  S C PGW
Sbjct  695  LPSSWDYRHAPPQPANFCIFSRDGVSPCWPGW  726



>ref|XP_004089011.1| PREDICTED: putative uncharacterized protein encoded by LINC00596-like 
[Nomascus leucogenys]
Length=83

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPA-VFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPCPA  FCIF RD  S C PGW
Sbjct  42   LSLPSSWDYRHPPPCPANFFCIFSRDGVSPCWPGW  76



>dbj|BAG61491.1| unnamed protein product [Homo sapiens]
Length=677

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   LPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LP S DYRHAPP PA FCIF RD  S C PGW
Sbjct  625  LPSSWDYRHAPPQPANFCIFSRDGVSPCWPGW  656



>ref|XP_004045110.1| PREDICTED: uncharacterized protein LOC101129799 [Gorilla gorilla 
gorilla]
Length=274

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH  L FVF VETG H++ QAG
Sbjct  183  PASASQIAGITGACHHTWLIFVFLVETGFHHIGQAG  218



>gb|EHH59972.1| hypothetical protein EGM_10210, partial [Macaca fascicularis]
Length=99

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG HHH  L FVF V+TG H++ QAG
Sbjct  36   PVSASRVAGITGAHHHTWLIFVFLVKTGFHHLGQAG  71



>gb|EHH58869.1| hypothetical protein EGM_08825, partial [Macaca fascicularis]
Length=65

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRHAPPC A FCI  R+  S C PGW
Sbjct  31   LSLPNSWDYRHAPPCLANFCISSREGVSPCWPGW  64



>gb|EHH20863.1| hypothetical protein EGK_03802, partial [Macaca mulatta]
Length=97

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SAS+ A ITG +HHA L FVF VETG H+V QAG
Sbjct  37   SASRVAGITGTYHHAWLIFVFLVETGFHHVGQAG  70



>ref|XP_004048022.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Gorilla gorilla gorilla]
Length=106

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS     TGMHHHA+L FVF VETG  +V QAG
Sbjct  39   PASASGVDGTTGMHHHARLIFVFLVETGFLHVGQAG  74



>gb|AAF22025.1|AF118094_20 PRO1900 [Homo sapiens]
Length=126

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HHAQL FVF VETG ++V  AG
Sbjct  72   PASASQVAGITGACHHAQLIFVFLVETGFYHVGLAG  107



>gb|EAW63194.1| hCG2040615, partial [Homo sapiens]
Length=106

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  PGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            PGQ  E  SL KIQK AG GG CL SQLLGRLR E+
Sbjct  39   PGQQGETPSLLKIQKLAGCGGMCLQSQLLGRLRQEN  74



>gb|EAW89122.1| hCG2039054, partial [Homo sapiens]
Length=96

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A + G+ HHAQL FVF  ETG  +V QAG
Sbjct  25   PASASQVAVVIGLRHHAQLIFVFLAETGFCHVGQAG  60



>gb|EAW92132.1| hCG2009101, partial [Homo sapiens]
Length=93

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVG  5
            PAW T   P+STKNTK S  WW MPVI A+WEAE G
Sbjct  15   PAWPTWRNPISTKNTKISQTWWRMPVILATWEAEAG  50



>gb|EHH62571.1| hypothetical protein EGM_20956, partial [Macaca fascicularis]
Length=179

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SA + A ITG+ HHA+L FVF  ETG H+V QAG
Sbjct  140  SAFRGARITGVCHHARLIFVFLAETGFHHVGQAG  173



>ref|XP_004031705.1| PREDICTED: solute carrier family 35 member F5-like [Gorilla gorilla 
gorilla]
Length=173

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A  TG  HH QL FVF VETG H+V Q G
Sbjct  132  PASASRVAGTTGARHHTQLNFVFLVETGFHHVGQDG  167



>gb|EHH22373.1| hypothetical protein EGK_05619, partial [Macaca mulatta]
Length=97

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ    TG  HHAQL FVF VE G H++ QAG
Sbjct  35   PVSASQVTGTTGARHHAQLIFVFLVEMGFHHIGQAG  70



>gb|EHH18945.1| hypothetical protein EGK_19530 [Macaca mulatta]
Length=66

 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S LSLP   DYR  PPC A FCIF RD  S C PGW
Sbjct  30   SRLSLPSGWDYRRVPPCLANFCIFSRDGVSPCWPGW  65



>ref|XP_004048368.1| PREDICTED: putative uncharacterized protein encoded by LINC00596-like 
[Gorilla gorilla gorilla]
Length=65

 Score = 45.4 bits (106),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S  YR APPCPA FCIF RD  SLC PGW
Sbjct  32   LSLLSSQVYRCAPPCPANFCIFSRDSVSLCWPGW  65



>dbj|BAC45260.1| seven transmembrane helix receptor [Homo sapiens]
Length=919

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            PP S SQ A ITG  HH  L FVF VE G H+V+Q G
Sbjct  632  PPASTSQAAGITGTRHHTLLIFVFLVEMGFHHVSQVG  668



>ref|XP_002799766.1| PREDICTED: hypothetical protein LOC100428781 [Macaca mulatta]
Length=113

 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            PAWAT   P STK TK SW  WC PV+ A+ EAE+GG
Sbjct  67   PAWATWQNPASTKKTKISWQLWCTPVVPATQEAEMGG  103



>gb|EAW72125.1| hCG1789799 [Homo sapiens]
Length=151

 Score = 45.8 bits (107),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITGM  H +L FVF VETG  +V+QAG
Sbjct  67   PASASRAAGITGMRQHTRLIFVFLVETGFFHVSQAG  102



>gb|EHH50883.1| hypothetical protein EGM_01778, partial [Macaca fascicularis]
Length=100

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG   HA L FVF VE G H+V QAG
Sbjct  37   PASASQAAGITGACRHAWLLFVFLVEMGFHHVGQAG  72



>gb|EHH15935.1| hypothetical protein EGK_02111, partial [Macaca mulatta]
Length=98

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG HHH  L FVF VET  H+V QAG
Sbjct  35   PASASQVAGTTGAHHHTWLIFVFLVETAFHHVGQAG  70



>gb|EHH55734.1| hypothetical protein EGM_04997, partial [Macaca fascicularis]
Length=98

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH  L FVF V+ G HYV QAG
Sbjct  38   PASASQVAGITGACHHTWLTFVFLVDMGFHYVGQAG  73



>gb|EHH66749.1| hypothetical protein EGM_03798, partial [Macaca fascicularis]
Length=74

 Score = 45.1 bits (105),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRH PPC A FCIF RD  S C PGW
Sbjct  34   LSLSSSWDYRHLPPCLANFCIFSRDGVSPCWPGW  67



>gb|EHH16997.1| hypothetical protein EGK_13278, partial [Macaca mulatta]
Length=76

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRH PP PA FCIF RD  S C PGW
Sbjct  42   LSLLSSWDYRHLPPYPANFCIFSRDGVSPCWPGW  75



>ref|XP_002800912.1| PREDICTED: putative uncharacterized protein CXorf62-like [Macaca 
mulatta]
Length=136

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG+ HH  L F+F VE G H+V QAG
Sbjct  19   PASASQVAGITGVCHHGWLIFLFLVEKGFHHVGQAG  54



>ref|XP_009199962.1| PREDICTED: putative uncharacterized protein encoded by LINC00596, 
partial [Papio anubis]
Length=62

 Score = 45.1 bits (105),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PP PA FCIF RDR     PGW
Sbjct  22   LSLPDSWDYRHVPPHPANFCIFSRDRVLPYWPGW  55



>dbj|BAB70813.1| unnamed protein product [Homo sapiens]
Length=136

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVG  5
            PAW T   P+STKNTK S  WW MPV+ A+WEAE G
Sbjct  58   PAWPTWRNPISTKNTKISQTWWRMPVVLATWEAEAG  93



>dbj|BAE89711.1| unnamed protein product [Macaca fascicularis]
Length=136

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG+ HH  L F+F VE G H+V QAG
Sbjct  19   PASASQVAGITGVCHHGWLIFLFLVEKGFHHVGQAG  54



>gb|EAW70079.1| hCG2038857, partial [Homo sapiens]
Length=145

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 26/39 (67%), Gaps = 2/39 (5%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLF--FVFFVETGSHYVAQAG  113
            PP SASQ AE  G   H+ LF  F F VETGSH VAQAG
Sbjct  56   PPVSASQVAETAGACQHSWLFICFYFIVETGSHCVAQAG  94



>gb|EHH18962.1| hypothetical protein EGK_19562, partial [Macaca mulatta]
Length=71

 Score = 45.1 bits (105),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP   DY HAPP  A FCIF RDR S C PGW
Sbjct  31   LSLPSRWDYSHAPPRLANFCIFSRDRVSPCWPGW  64



>gb|EHH57573.1| hypothetical protein EGM_07242, partial [Macaca fascicularis]
Length=131

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG+ HHA L FVF VET  H+V Q G
Sbjct  68   PASASQVAGITGVCHHAWLIFVFLVETRFHHVGQDG  103



>gb|AAF22026.1|AF118094_21 PRO1902 [Homo sapiens]
Length=84

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S+LSLP S DYR  PP PA F  F RD  S CCPGW
Sbjct  32   SYLSLPSSWDYRCTPPHPANFLYFNRDGISPCCPGW  67



>ref|XP_005267863.1| PREDICTED: uncharacterized protein C14orf105 isoform X3 [Homo 
sapiens]
Length=290

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG  HHAQL FVF VET  H+V QAG
Sbjct  249  PASASRVAGITGACHHAQLTFVFVVETRFHHVGQAG  284



>ref|XP_004092321.1| PREDICTED: KN motif and ankyrin repeat domain-containing protein 
3-like [Nomascus leucogenys]
Length=187

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PPC A FCIF RD  + C PGW
Sbjct  103  LSLPSSWDYRRLPPCLADFCIFSRDGVTSCWPGW  136



>gb|EHH24999.1| hypothetical protein EGK_08749, partial [Macaca mulatta]
Length=65

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYR  PP PA FCIF RDR S C PGW
Sbjct  31   LSLLSSWDYRRVPPHPANFCIFSRDRVSACWPGW  64



>gb|EAW99058.1| TAK1-binding protein 3, isoform CRA_b [Homo sapiens]
Length=721

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    SSHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SS LS   S DYR  PP PA  CIFC DR S CCPGW
Sbjct  657  SSCLSHLSSWDYRRTPPRPANLCIFCGDRVSPCCPGW  693



>gb|EHH64557.1| hypothetical protein EGM_17802, partial [Macaca fascicularis]
Length=93

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  H AQL FVF VE G H+V Q+G
Sbjct  33   PASASQIAGITGACHLAQLIFVFLVEMGFHHVGQSG  68



>gb|EHH31099.1| hypothetical protein EGK_20953, partial [Macaca mulatta]
Length=131

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ A ITG+H+H  L FVF VE G H+V QAG
Sbjct  70   SASQVAGITGVHYHTWLIFVFLVEMGFHHVGQAG  103



>gb|EHH26452.1| hypothetical protein EGK_16433, partial [Macaca mulatta]
Length=102

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  33   ITGMHHHAQLFFVFFVETGSHYVAQAG  113
            ITG+HHH QL FVF VE G HYV QAG
Sbjct  47   ITGVHHHTQLIFVFLVEMGFHYVGQAG  73



>ref|XP_008013785.1| PREDICTED: tripartite motif-containing protein 52 isoform X1 
[Chlorocebus sabaeus]
Length=356

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  32   DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            DY+HAPPCPA FCIF RDR S C  GW
Sbjct  309  DYKHAPPCPANFCIFSRDRVSPCWSGW  335



>sp|Q86U02.1|CN165_HUMAN RecName: Full=Putative uncharacterized protein encoded by LINC00596 
[Homo sapiens]
 emb|CAD61903.1| unnamed protein product [Homo sapiens]
Length=117

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRHAPPC A F IF  DR S C P W
Sbjct  83   LSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDW  116



>gb|EHH54566.1| hypothetical protein EGM_15433, partial [Macaca fascicularis]
Length=64

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A I G  HHA L FVF VE G H+V QAG
Sbjct  5    PASASRVAGIRGTRHHAWLIFVFLVEMGFHHVGQAG  40



>ref|XP_009000758.1| PREDICTED: metalloreductase STEAP2 isoform X3 [Callithrix jacchus]
 ref|XP_009000759.1| PREDICTED: metalloreductase STEAP2 isoform X3 [Callithrix jacchus]
 ref|XP_009000760.1| PREDICTED: metalloreductase STEAP2 isoform X3 [Callithrix jacchus]
 ref|XP_009000761.1| PREDICTED: metalloreductase STEAP2 isoform X3 [Callithrix jacchus]
Length=513

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQ  107
            P SAS+ A  TG+HH AQL FVF VETG H+V Q
Sbjct  475  PASASRVAGTTGVHHQAQLIFVFLVETGFHHVDQ  508



>gb|EHH51985.1| hypothetical protein EGM_12341, partial [Macaca fascicularis]
Length=102

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A  T   HH QL F+F VETG H+V QAG
Sbjct  40   PASASRVAGTTSARHHTQLIFIFLVETGFHHVGQAG  75



>gb|EAX08724.1| hCG2038303, partial [Homo sapiens]
Length=105

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -2

Query  88  PVSTKNTKNSWAWWCMPVISASWEAE  11
           PVS KNTK  WAWWC PV+ A+WEAE
Sbjct  67  PVSNKNTKIRWAWWCAPVVPATWEAE  92



>gb|EHH59230.1| hypothetical protein EGM_09292, partial [Macaca fascicularis]
Length=64

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPG  109
            LSLP S DYR  PP PA FCIF RDR S C PG
Sbjct  32   LSLPSSWDYRSLPPYPANFCIFIRDRVSPCWPG  64



>dbj|BAC85380.1| unnamed protein product [Homo sapiens]
Length=158

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ AEIT + HH  L FVF +E G H+V QAG
Sbjct  43   PASASQVAEITDVCHHPWLIFVFLLEMGFHHVGQAG  78



>ref|XP_004045461.1| PREDICTED: putative uncharacterized protein encoded by LINC00596-like 
[Gorilla gorilla gorilla]
Length=118

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PPCPA FC F RD  S C PGW
Sbjct  64   LSLPSSWDYRCPPPCPANFCNFSRDGVSPCWPGW  97



>ref|XP_004060486.1| PREDICTED: uncharacterized protein LOC101134118 [Gorilla gorilla 
gorilla]
Length=243

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PP PA FCIF RD  S C PGW
Sbjct  203  LSLPSSWDYRRPPPRPANFCIFSRDGVSPCWPGW  236



>gb|EHH53367.1| hypothetical protein EGM_13996, partial [Macaca fascicularis]
Length=145

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ +  TG HHH +L FVF VE G H++ QAG
Sbjct  37   PLSASRVSGTTGTHHHIRLIFVFLVEIGFHHIGQAG  72



>gb|EHH17322.1| hypothetical protein EGK_13706, partial [Macaca mulatta]
Length=109

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ AE TG  HHA + FVF +ET  H+V QAG
Sbjct  26   PASASRVAEFTGARHHAWIIFVFLIETEFHHVGQAG  61



>gb|EHH27543.1| hypothetical protein EGK_17760, partial [Macaca mulatta]
Length=90

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQ  107
            P S S+ A  TG HHHAQL FVF VE G H+V Q
Sbjct  35   PASVSRVAGTTGAHHHAQLIFVFLVEVGFHHVGQ  68



>gb|AAF69609.1|AF119917_17 PRO1847 [Homo sapiens]
Length=76

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S LSLP S DYR  PPCP  FCIF  DR S C PGW
Sbjct  37   SCLSLPSSWDYRCPPPCPINFCIFGTDRVSPCWPGW  72



>gb|EHH20620.1| hypothetical protein EGK_03509, partial [Macaca mulatta]
Length=64

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PP PA FCIF RD  S C PGW
Sbjct  30   LSLPSSWDYRCTPPHPANFCIFSRDGVSPCWPGW  63



>sp|Q8N2A0.1|CX062_HUMAN RecName: Full=Putative uncharacterized protein encoded by LINC00269 
[Homo sapiens]
 dbj|BAC03549.1| unnamed protein product [Homo sapiens]
 gb|EAX05366.1| hCG1991754 [Homo sapiens]
Length=174

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ AE T   HH +L FVF VETG H+V QAG
Sbjct  102  PVSASQVAETTEACHHTRLIFVFSVETGFHHVGQAG  137



>gb|AAL55737.1|AF289553_1 unknown [Homo sapiens]
Length=109

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG+ HHA+L FVF V+T  H+V QAG
Sbjct  67   PVSASQVAGTTGLCHHARLRFVFLVQTVFHHVGQAG  102



>gb|AAU43855.1| HMGA2e' [Homo sapiens]
 gb|AAU43856.1| HMGA2e [Homo sapiens]
Length=147

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +2

Query  32   DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            DYRH PP PA FCIF RD  S C PGW
Sbjct  114  DYRHPPPHPANFCIFSRDGVSPCWPGW  140



>gb|EAW65432.1| hCG2038442, partial [Homo sapiens]
Length=98

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            L L  S DYRHAPP PA FCIF RD  S C PGW
Sbjct  64   LGLLSSWDYRHAPPRPANFCIFSRDGVSPCWPGW  97



>dbj|BAC85305.1| unnamed protein product [Homo sapiens]
Length=133

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  QHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            QH E  SL KIQK AGHGG C  SQL GRLR E+
Sbjct  26   QHGETPSLLKIQKLAGHGGTCWLSQLFGRLRQEN  59



>gb|EHH16041.1| hypothetical protein EGK_11270 [Macaca mulatta]
Length=130

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPG  109
            SHLSL    DYRH PPCP   CIF RD  S C PG
Sbjct  96   SHLSLLNRWDYRHPPPCPDNICIFSRDGVSPCSPG  130



>gb|EHH16558.1| hypothetical protein EGK_11851, partial [Macaca mulatta]
Length=62

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYR  PP PA FCIF RDR S C PGW
Sbjct  22   LSLLSSWDYRRPPPHPANFCIFSRDRVSPCWPGW  55



>gb|EHH63176.1| hypothetical protein EGM_16090, partial [Macaca fascicularis]
Length=66

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR  PP P  FCIF +D  S C PGW
Sbjct  32   LSLPSSWDYRRMPPGPGNFCIFGKDGVSPCWPGW  65



>gb|EHH27936.1| hypothetical protein EGK_18253, partial [Macaca mulatta]
Length=70

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYV  101
            PPTSAS  A  TG  HH QL FVFFVE G H+V
Sbjct  38   PPTSASHVASTTGECHHTQLIFVFFVEMGFHHV  70



>dbj|BAG59163.1| unnamed protein product [Homo sapiens]
Length=126

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA+Q A ITG  HH  L + F VETG H+V QAG
Sbjct  50   PASATQVAGITGTRHHTWLIYKFLVETGFHHVGQAG  85



>dbj|BAB39337.1| hypothetical protein [Macaca fascicularis]
Length=139

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +3

Query  39   GMHHHAQLFFVFFVETGSHYVAQAG  113
            GMHHHA L FVF VETG  YV QAG
Sbjct  109  GMHHHAWLIFVFLVETGFQYVGQAG  133



>gb|EHH55556.1| hypothetical protein EGM_04788, partial [Macaca fascicularis]
Length=96

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA +   ITG  HHA L FVF VETG H+V QAG
Sbjct  33   PVSAPRVVGITGTCHHAWLTFVFLVETGFHHVGQAG  68



>gb|EHH60624.1| hypothetical protein EGM_12020, partial [Macaca fascicularis]
Length=92

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A +TG  HH Q+ FVF VE G H+V  AG
Sbjct  36   PASASQVAGMTGTRHHVQIIFVFLVEMGFHHVGHAG  71



>ref|XP_003846764.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Homo sapiens]
 ref|XP_003846300.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Homo sapiens]
 ref|XP_003960504.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Homo sapiens]
 dbj|BAB15071.1| unnamed protein product [Homo sapiens]
 gb|EAW62471.1| hCG1744006 [Homo sapiens]
Length=171

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ   ITG HHHA L FVF VETG  +V Q G
Sbjct  88   PASASQVTGITGSHHHAWLIFVFLVETGFCHVGQDG  123



>gb|EHH57429.1| hypothetical protein EGM_07048, partial [Macaca fascicularis]
Length=64

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SSHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPG  109
            +SHLSL  S DYRH  P PA FCIF RD  S C PG
Sbjct  29   ASHLSLLSSWDYRHVRPHPANFCIFSRDGVSPCWPG  64



>ref|XP_009249894.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Pongo abelii]
Length=330

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQL-FFVFFVETGSHYVAQAG  113
            SAS+ A ITG HHHA+L FFVF VETG H++ QAG
Sbjct  290  SASRVAGITGAHHHARLIFFVFLVETGFHHLGQAG  324



>gb|EHH23728.1| hypothetical protein EGK_07262, partial [Macaca mulatta]
Length=83

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PPCP  FC F R+    C PGW
Sbjct  24   LSLPSSWDYRHMPPCPPNFCTFSRNGILPCWPGW  57



>gb|EHH49511.1| hypothetical protein EGM_00180, partial [Macaca fascicularis]
Length=131

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A I G  HH +L FVF +ETG ++V QAG
Sbjct  68   PASASQVAWIIGACHHTRLIFVFLLETGFYHVGQAG  103



>pir||I38022 hypothetical protein - human
 emb|CAA39297.1| unnamed protein product [Homo sapiens]
Length=196

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  108  PGQHSENLSLQKIQKTAGHGGACL*SQLLGRLRWED  1
            PGQH +  SL KIQ+ AGHGG CL SQLL RLR E+
Sbjct  12   PGQHGKIPSLLKIQELAGHGGRCLQSQLLRRLRQEN  47



>gb|EAW94215.1| hCG1820974 [Homo sapiens]
Length=143

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 1/36 (3%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFV-FFVETGSHYVAQA  110
            P SASQ A ITG  HHA L FV F VETG H+V QA
Sbjct  39   PASASQAAGITGTRHHAWLIFVIFLVETGFHHVGQA  74


 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGS  92
            PP SASQ A ITGM HHA+ FFV  VET S
Sbjct  84   PPVSASQSAGITGMSHHARQFFVVVVETES  113



>gb|EHH55411.1| hypothetical protein EGM_04619, partial [Macaca fascicularis]
Length=63

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYR  PPCPA FCIF RD  S C PGW
Sbjct  23   LSLLSSWDYRCMPPCPANFCIFSRDGVSPCWPGW  56



>ref|XP_003830704.1| PREDICTED: putative calcium-sensing receptor-like 1 [Pan paniscus]
Length=755

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA   A  TG HHHAQL FVF VETG H+V+Q G
Sbjct  334  PASAPLVAGTTGAHHHAQLIFVFLVETGFHHVSQDG  369



>gb|EHH60591.1| hypothetical protein EGM_11981, partial [Macaca fascicularis]
Length=66

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SHLSLP S DYR APP  A FCIF RD  S   PGW
Sbjct  30   SHLSLPSSWDYRCAPPHLANFCIFSRDGVSPYFPGW  65



>sp|Q8NGV9.1|CSRL1_HUMAN RecName: Full=Putative calcium-sensing receptor-like 1; AltName: 
Full=Vomeronasal type-2 receptor-like
 dbj|BAC05890.1| seven transmembrane helix receptor [Homo sapiens]
Length=755

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA   A  TG HHHAQL FVF VETG H+V+Q G
Sbjct  334  PASAPLVAGTTGAHHHAQLIFVFLVETGFHHVSQDG  369



>gb|EAW78738.1| hCG27718 [Homo sapiens]
Length=755

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SA   A  TG HHHAQL FVF VETG H+V+Q G
Sbjct  334  PASAPLVAGTTGAHHHAQLIFVFLVETGFHHVSQDG  369



>gb|EHH63683.1| hypothetical protein EGM_16698, partial [Macaca fascicularis]
Length=70

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYV  101
            PPTSAS  A  TG  HH QL FVFFVE G H+V
Sbjct  38   PPTSASHVARPTGECHHTQLIFVFFVEMGFHHV  70



>gb|AAF22022.1|AF118094_17 PRO1848 [Homo sapiens]
 gb|EAX07585.1| hCG2032337, partial [Homo sapiens]
Length=105

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVA  104
            PPTS SQ A   G  HH QL FVFF ETG H+VA
Sbjct  14   PPTSTSQVARTIGACHHVQLIFVFFGETGFHHVA  47



>gb|EHH64004.1| hypothetical protein EGM_17106, partial [Macaca fascicularis]
Length=121

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A ITG  HH  L FVF VET  H++ QAG
Sbjct  35   PASASQVAGITGSRHHTWLSFVFLVETRFHHIGQAG  70



>gb|EAX00825.1| hCG1989288, partial [Homo sapiens]
Length=96

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCC  103
            LSLPRS DYR  PPCPA FCIF RD  SL  
Sbjct  60   LSLPRSWDYRRPPPCPANFCIFGRDGVSLLA  90



>emb|CAD38576.2| hypothetical protein [Homo sapiens]
Length=750

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +2

Query  17   LPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LP S DYRHAPP PA FCIF  D  S C PGW
Sbjct  698  LPSSWDYRHAPPRPANFCIFSGDGVSPCWPGW  729



>dbj|BAC03988.1| unnamed protein product [Homo sapiens]
Length=162

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ A ITG  HHA+L FVF VE G H++ QAG
Sbjct  126  SASQIAGITGTCHHARLIFVFLVEMGFHHLGQAG  159



>gb|EHH50766.1| hypothetical protein EGM_01641 [Macaca fascicularis]
Length=76

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 22/32 (69%), Gaps = 1/32 (3%)
 Frame = +2

Query  20   PRS*DYRHAPPCPA-VFCIFCRDRFSLCCPGW  112
            P S DYRH PPCPA  FCIF RD  S C PGW
Sbjct  38   PSSWDYRHGPPCPANFFCIFSRDGVSPCWPGW  69



>gb|AAH67859.1| GTF2IRD2 protein [Homo sapiens]
 gb|AIC60913.1| GTF2IRD2, partial [synthetic construct]
Length=498

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVGG  2
            PAWAT  +P+STKN K SW  W  PV  A+W+AE GG
Sbjct  433  PAWATWQDPISTKNLKISWKQWLTPVAPATWQAEAGG  469



>ref|XP_004089607.1| PREDICTED: putative uncharacterized protein encoded by LINC00269-like 
[Nomascus leucogenys]
Length=144

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG  HHA L FVF VE G H+V Q G
Sbjct  58   PASASQVAGTTGTCHHAWLIFVFLVEAGFHHVGQDG  93



>gb|EHH18952.1| hypothetical protein EGK_19543, partial [Macaca mulatta]
Length=73

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRH PP PA FCIF RD  S C  GW
Sbjct  34   LSLLSSWDYRHVPPHPANFCIFSRDGVSPCWSGW  67



>dbj|BAG64901.1| unnamed protein product [Homo sapiens]
Length=184

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ A ITG  HHA+L FVF VE G H++ QAG
Sbjct  148  SASQIAGITGTCHHARLIFVFLVEMGFHHLGQAG  181



>ref|XP_004089707.1| PREDICTED: LOW QUALITY PROTEIN: putative calcium-sensing receptor-like 
1-like [Nomascus leucogenys]
Length=759

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQ  107
            P SAS+ A   G HHHAQL FVF VETG H+V+Q
Sbjct  338  PASASRVAGTIGAHHHAQLIFVFLVETGFHHVSQ  371



>gb|EHH27277.1| hypothetical protein EGK_17439, partial [Macaca mulatta]
Length=73

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DY H PP PA FCIF R R S C  GW
Sbjct  39   LSLPSSWDYMHVPPRPANFCIFSRHRVSPCWSGW  72



>gb|EHH64622.1| hypothetical protein EGM_17881 [Macaca fascicularis]
Length=66

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S LSLP   DYR  PPC A FCIF R   S C PGW
Sbjct  30   SRLSLPSGWDYRRVPPCLANFCIFSRHGVSPCWPGW  65



>ref|XP_004025400.1| PREDICTED: zinc finger protein ENSP00000375192-like [Gorilla 
gorilla gorilla]
Length=105

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQLFFVFFVETGSHYVA  104
            PPTS SQ A   G +HH QL FVFF ETG H+VA
Sbjct  14   PPTSTSQVAGSIGAYHHVQLIFVFFGETGFHHVA  47



>gb|EHH17143.1| hypothetical protein EGK_13471, partial [Macaca mulatta]
Length=72

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPA-VFCIFCRDRFSLCCPGW  112
            LSL  S DY+H PPCPA  FCIF RD  S C PGW
Sbjct  31   LSLLGSWDYKHVPPCPANFFCIFSRDGVSPCWPGW  65



>gb|EAX06302.1| hCG2038847, partial [Homo sapiens]
Length=159

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SA Q A + GMHHH  L FVF VE G H+V QAG
Sbjct  37   SAFQVAGVAGMHHHTPLIFVFLVEMGFHHVGQAG  70



>gb|AIC59745.1| CHP, partial [synthetic construct]
Length=66

 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SHLSLP S DYR  PP    FCIF  +  S C PGW
Sbjct  30   SHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGW  65



>ref|XP_008997697.1| PREDICTED: putative uncharacterized protein encoded by LINC00596, 
partial [Callithrix jacchus]
Length=74

 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSL  S DYRHAPPCPA F  F R+  S C PGW
Sbjct  23   LSLLSSWDYRHAPPCPANFLYFYREGVSPCWPGW  56



>ref|XP_004065407.1| PREDICTED: LOW QUALITY PROTEIN: general transcription factor 
II-I repeat domain-containing protein 2A, partial [Gorilla gorilla 
gorilla]
Length=262

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAE  11
            PAW T   P+STKNTK S  WWC PVI A+ EAE
Sbjct  195  PAWPTWQNPISTKNTKISRVWWCTPVIPATQEAE  228



>gb|EHH50885.1| hypothetical protein EGM_01780, partial [Macaca fascicularis]
Length=97

 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   SASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            SASQ A ITG HHHA L FV  VET  H+V QAG
Sbjct  37   SASQVAGITGTHHHAWLIFVSLVETRFHHVGQAG  70



>dbj|BAE89837.1| unnamed protein product [Macaca fascicularis]
Length=78

 Score = 42.4 bits (98),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITGM HHA L FV  VETG  +  QAG
Sbjct  17   PASASRVAGITGMRHHAWLIFVALVETGFLHAGQAG  52



>gb|EHH31460.1| hypothetical protein EGK_12542, partial [Macaca mulatta]
Length=101

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQL--FFVFFVETGSHYVAQAG  113
            P S S  A ITG HHH  L  FFVF VE G H+V QAG
Sbjct  40   PASVSWVAGITGTHHHTWLIFFFVFLVEVGFHHVGQAG  77



>sp|Q6ZWE1.1|CC066_HUMAN RecName: Full=Putative uncharacterized protein C3orf66
Length=131

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            SHLSL    DYRH PP P   CIF RD  S   PGW
Sbjct  95   SHLSLLNRWDYRHPPPRPDNICIFSRDGVSTYSPGW  130



>gb|EAX08129.1| hCG2038166, partial [Homo sapiens]
Length=134

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/29 (69%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  27   AEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            A ITG HH A+LFFVF VETG H+ +QAG
Sbjct  73   AGITGAHHQARLFFVFLVETGFHHASQAG  101



>gb|AAQ04644.1|AF447869_1 Unknown [Homo sapiens]
Length=96

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    HLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            +L LP S DYRHA P  A FC F RDR S C PGW
Sbjct  41   NLRLPGSWDYRHASPYLANFCGFSRDRVSPCWPGW  75



>gb|EAW65398.1| hCG2041530, isoform CRA_a [Homo sapiens]
Length=106

 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P  AS+ A  TG  HHA+L FVF VETG H ++Q G
Sbjct  65   PALASRVAGTTGACHHARLIFVFLVETGFHRISQDG  100



>dbj|BAC85220.1| unnamed protein product [Homo sapiens]
Length=140

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SASQ A  TG  HHA L FVF VE G H+V Q G
Sbjct  57   PASASQVAGTTGACHHAWLIFVFLVEAGFHHVGQDG  92



>gb|EAW65399.1| hCG2041530, isoform CRA_b [Homo sapiens]
Length=93

 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P  AS+ A  TG  HHA+L FVF VETG H ++Q G
Sbjct  52   PALASRVAGTTGACHHARLIFVFLVETGFHRISQDG  87



>gb|EAW66730.1| hCG1798187, partial [Homo sapiens]
Length=91

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  27   AEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            A ITG  HHA+L FVF VETG H+V QAG
Sbjct  46   AGITGARHHARLIFVFLVETGFHHVGQAG  74



>gb|AAK55521.1|AF305818_1 PRO0764 [Homo sapiens]
Length=133

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS  A ITG  HH  L FVF V TG H+V QAG
Sbjct  46   PASASWVAGITGTRHHTWLIFVFLVVTGFHHVGQAG  81



>gb|EHH30155.1| hypothetical protein EGK_10762, partial [Macaca mulatta]
Length=81

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P  AS+ A IT +HHHAQL FVF VE   ++V+QAG
Sbjct  36   PALASRVAGITRVHHHAQLIFVFLVEMEFYHVSQAG  71



>gb|EAX04538.1| hCG2000782 [Homo sapiens]
Length=106

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAE  11
            PAW T   P+ TKNTK SW WW M VI A+WEAE
Sbjct  60   PAWPTWQNPIPTKNTKISWVWWHMHVIPATWEAE  93



>gb|EAW59619.1| hCG2010644, partial [Homo sapiens]
Length=131

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +2

Query  2    SSHLSLPRS*DYRHAPPCPAV-FCIFCRDRFSLCCPGW  112
            SS+LSLP + D+RH    PA+ F  F RD  S CCPGW
Sbjct  77   SSYLSLPNNWDHRHVQQSPAILFVFFSRDGVSSCCPGW  114



>gb|EAW62946.1| hCG2038800, partial [Homo sapiens]
Length=117

 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 22/36 (61%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    SHLSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            S LSL  S DYRH  P PA FCIF RD  S   PGW
Sbjct  61   SFLSLLSSWDYRHVLPRPAKFCIFSRDEVSSYWPGW  96



>ref|NP_001243297.1| uncharacterized protein LOC100144595 [Homo sapiens]
Length=102

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP   DYRHAPPC      F RD  SLC PGW
Sbjct  48   LSLPSGWDYRHAPPCRPNVLYFSRDGVSLCWPGW  81



>gb|EHB03251.1| hypothetical protein GW7_10939, partial [Heterocephalus glaber]
Length=93

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 26/40 (65%), Gaps = 4/40 (10%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQL-FFVF---FVETGSHYVAQAG  113
            P SASQ A ITGMHHHA L  F +   F   G HYVAQAG
Sbjct  27   PASASQRAGITGMHHHAWLRLFSYGNCFGGVGPHYVAQAG  66



>gb|EHH57493.1| hypothetical protein EGM_07132, partial [Macaca fascicularis]
Length=95

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  6    PTSASQEAEITGMHHHAQLFFVFFVETGSHYVAQAG  113
            P SAS+ A ITG   HA L FV  VETG H+V QAG
Sbjct  36   PASASRVAGITGARLHAWLIFVVLVETGFHHVGQAG  71



>gb|AAG35513.1|AF130117_46 PRO2411 [Homo sapiens]
Length=68

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  112  PAWAT**EPVSTKNTKNSWAWWCMPVISASWEAEVG  5
            P+W T   P+STKNTK SWAWW MPV+ A+  AE G
Sbjct  22   PSWPTWGNPMSTKNTKISWAWWHMPVVPATQGAEAG  57



>gb|EAX08465.1| hCG1820635 [Homo sapiens]
Length=119

 Score = 42.4 bits (98),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 24/37 (65%), Gaps = 1/37 (3%)
 Frame = +3

Query  3    PPTSASQEAEITGMHHHAQL-FFVFFVETGSHYVAQA  110
            PPTSASQ A  TGM  H QL F VFF ET  H VA A
Sbjct  14   PPTSASQVAGTTGMRQHVQLIFLVFFAETRFHQVAVA  50



>dbj|BAG52531.1| unnamed protein product [Homo sapiens]
Length=110

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYRH PP    FCIF RD+   C PGW
Sbjct  70   LSLPSSCDYRHVPPHLVNFCIFGRDKVLPCWPGW  103



>ref|XP_004047977.1| PREDICTED: putative uncharacterized protein encoded by LINC00596-like 
[Gorilla gorilla gorilla]
Length=72

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +2

Query  11   LSLPRS*DYRHAPPCPAVFCIFCRDRFSLCCPGW  112
            LSLP S DYR APP  A FCIF RD    C PGW
Sbjct  32   LSLPSSWDYRRAPPRLANFCIFSRDGIYPCWPGW  65



>gb|AIC61903.1| hypothetical protein, partial [synthetic construct]
Length=66

 Score = 37.4 bits (85),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +3

Query  3   PPTSASQEAEITGMHHHAQLFFVFF  77
           PPTSASQ AE TG HHH  L F  F
Sbjct  29  PPTSASQVAETTGTHHHTWLIFCDF  53


 Score = 31.6 bits (70),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  62   VFCIFCRDRFSLCCPGW  112
            +FC F RDR S CCPGW
Sbjct  49   IFCDFGRDRVSPCCPGW  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284