BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c45476_g1_i1 len=591 path=[1:0-590]

Length=591
                                                                      Score     E

ref|XP_011089471.1|  PREDICTED: uncharacterized protein LOC105170415  87.0    2e-18   
ref|XP_004241176.1|  PREDICTED: uncharacterized protein LOC101259757  85.5    8e-18   
ref|XP_006344045.1|  PREDICTED: uncharacterized protein LOC102595412  81.3    3e-16   
ref|XP_009597791.1|  PREDICTED: uncharacterized protein LOC104093702  80.9    3e-16   
ref|XP_009630933.1|  PREDICTED: uncharacterized protein LOC104120797  77.4    9e-15   
ref|XP_009763724.1|  PREDICTED: uncharacterized protein LOC104215578  77.0    1e-14   
ref|XP_002280087.1|  PREDICTED: uncharacterized protein LOC100265554  74.7    5e-14   Vitis vinifera
ref|XP_007146732.1|  hypothetical protein PHAVU_006G065100g           74.3    7e-14   
gb|AFK39263.1|  unknown                                               73.2    2e-13   
emb|CAN78614.1|  hypothetical protein VITISV_028924                   75.9    2e-13   Vitis vinifera
ref|XP_003551305.1|  PREDICTED: uncharacterized protein LOC100788940  72.4    4e-13   
emb|CBI15993.3|  unnamed protein product                              71.2    7e-13   
ref|XP_008220507.1|  PREDICTED: uncharacterized protein LOC103320580  71.2    1e-12   
ref|XP_009768375.1|  PREDICTED: uncharacterized protein LOC104219388  70.9    2e-12   
ref|XP_009386263.1|  PREDICTED: uncharacterized protein LOC103973429  70.5    2e-12   
ref|XP_010278955.1|  PREDICTED: uncharacterized protein LOC104612980  70.5    6e-12   
ref|XP_004500236.1|  PREDICTED: uncharacterized protein LOC101488529  68.9    6e-12   
ref|XP_008464052.1|  PREDICTED: uncharacterized protein LOC103502033  68.9    6e-12   
ref|XP_007206189.1|  hypothetical protein PRUPE_ppa013971mg           68.6    1e-11   
ref|XP_011035188.1|  PREDICTED: uncharacterized protein LOC105133071  68.2    1e-11   
ref|XP_004143212.1|  PREDICTED: uncharacterized protein LOC101205268  67.8    2e-11   
ref|XP_010104673.1|  hypothetical protein L484_022051                 67.4    2e-11   
ref|XP_002298321.1|  hypothetical protein POPTR_0001s25670g           67.0    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008785407.1|  PREDICTED: uncharacterized protein LOC103704050  66.6    4e-11   
ref|XP_002313390.1|  hypothetical protein POPTR_0009s04820g           66.2    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008355306.1|  PREDICTED: uncharacterized protein LOC103418963  65.5    9e-11   
ref|XP_010033024.1|  PREDICTED: uncharacterized protein LOC104422404  65.5    1e-10   
ref|XP_011032145.1|  PREDICTED: uncharacterized protein LOC105131070  65.1    2e-10   
ref|XP_009374270.1|  PREDICTED: uncharacterized protein LOC103963214  63.5    5e-10   
ref|XP_006425038.1|  hypothetical protein CICLE_v10029657mg           63.5    6e-10   
ref|XP_003538289.1|  PREDICTED: uncharacterized protein LOC100789683  63.2    7e-10   
ref|XP_002525607.1|  conserved hypothetical protein                   62.8    9e-10   Ricinus communis
gb|KDP46523.1|  hypothetical protein JCGZ_08495                       62.4    1e-09   
ref|XP_004490584.1|  PREDICTED: uncharacterized protein LOC101497020  62.0    2e-09   
ref|XP_007016156.1|  Uncharacterized protein TCM_041656               61.6    2e-09   
ref|XP_010923108.1|  PREDICTED: uncharacterized protein LOC105046265  61.6    3e-09   
ref|XP_010249464.1|  PREDICTED: uncharacterized protein LOC104592021  62.4    5e-09   
ref|XP_009398868.1|  PREDICTED: uncharacterized protein LOC103983369  59.3    2e-08   
ref|XP_004295742.1|  PREDICTED: uncharacterized protein LOC101297818  57.0    1e-07   
emb|CAD45559.1|  thylakoid soluble phosphoprotein                     54.3    1e-06   Spinacia oleracea
pdb|2FFT|A  Chain A, Nmr Structure Of Spinach Thylakoid Soluble P...  53.1    2e-06   
ref|XP_006848136.1|  hypothetical protein AMTR_s00029p00225070        52.4    4e-06   
ref|XP_010520224.1|  PREDICTED: uncharacterized protein LOC104799405  52.4    4e-06   
ref|XP_003615604.1|  hypothetical protein MTR_5g069990                51.2    1e-05   
gb|KFK27416.1|  hypothetical protein AALP_AA8G379900                  50.8    2e-05   
gb|EYU18977.1|  hypothetical protein MIMGU_mgv1a016754mg              50.8    2e-05   
emb|CDX80332.1|  BnaC09g34100D                                        49.7    6e-05   
ref|XP_009120394.1|  PREDICTED: uncharacterized protein LOC103845311  49.3    6e-05   
ref|XP_010685599.1|  PREDICTED: uncharacterized protein LOC104899990  49.3    7e-05   
ref|XP_010503323.1|  PREDICTED: uncharacterized protein LOC104780519  47.4    5e-04   
ref|XP_002877540.1|  hypothetical protein ARALYDRAFT_905937           47.0    6e-04   
ref|XP_006401030.1|  hypothetical protein EUTSA_v10015099mg           47.0    6e-04   



>ref|XP_011089471.1| PREDICTED: uncharacterized protein LOC105170415 [Sesamum indicum]
Length=102

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 60/89 (67%), Gaps = 7/89 (8%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekG--LLDWILGGLQKEDQLLETDPIL  366
            MASLNLFFSP    QRRV   A  A  S G+G  +    LD+ILGGL KEDQ  ETDPIL
Sbjct  1    MASLNLFFSPVVTPQRRVIRTAATAAKSSGAGSTEEKGFLDFILGGLTKEDQFYETDPIL  60

Query  365  KKVEGKSSATTATVAGRRKSVAA--PPPK  285
            KKVEGK   TT TV GR+ SV+A  PPPK
Sbjct  61   KKVEGK---TTGTVGGRKNSVSAAPPPPK  86



>ref|XP_004241176.1| PREDICTED: uncharacterized protein LOC101259757 [Solanum lycopersicum]
Length=106

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 8/94 (9%)
 Frame = -2

Query  539  MASLNLFFSPAA---AKQRR--VYtaataakssggsgeekGLLDWILGGLQKEDQLLETD  375
            MASLN+F SP A   A+Q R  VYTAATA+KSSGGS EEK LLD+ILG LQK+DQLLETD
Sbjct  1    MASLNMFVSPIATVTAQQHRSRVYTAATASKSSGGSTEEKSLLDFILGALQKQDQLLETD  60

Query  374  PILKKVEGKSSATTATVAGRRKSVAAPPPKSNAN  273
            P+LKKVE KS +TT+  +GR+ SVA PP K N+N
Sbjct  61   PLLKKVEDKSVSTTS--SGRKNSVAVPP-KKNSN  91



>ref|XP_006344045.1| PREDICTED: uncharacterized protein LOC102595412 [Solanum tuberosum]
Length=100

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 66/91 (73%), Gaps = 5/91 (5%)
 Frame = -2

Query  539  MASLNLFFSP-AAAKQRRV-YtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASLNLF  P A   QRRV YT AT+ KS G S EEK +LD++LG LQKEDQLLETDPI+
Sbjct  1    MASLNLFVPPIATTTQRRVVYTRATSTKSFGVSSEEKSILDFVLGALQKEDQLLETDPIM  60

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNAN  273
            KKVEGKS  TT+     +KSV+  PP+ + N
Sbjct  61   KKVEGKSGTTTSF---NKKSVSISPPQKDYN  88



>ref|XP_009597791.1| PREDICTED: uncharacterized protein LOC104093702 [Nicotiana tomentosiformis]
Length=102

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 67/91 (74%), Gaps = 5/91 (5%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRV--YtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASLNLF  P    QRRV  YT AT+AKSS GS EEK +LD++LG L KEDQLLETDPIL
Sbjct  1    MASLNLFSPPIPITQRRVVVYTKATSAKSSSGSSEEKSILDFVLGALAKEDQLLETDPIL  60

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNAN  273
            KKVEGKS+ TT      RKSV+ PP K N+N
Sbjct  61   KKVEGKSTGTTT--ISSRKSVSVPPEK-NSN  88



>ref|XP_009630933.1| PREDICTED: uncharacterized protein LOC104120797 [Nicotiana tomentosiformis]
Length=115

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 84/119 (71%), Gaps = 19/119 (16%)
 Frame = -2

Query  539  MASLNLF-FSP--------------AAAKQRRVYtaataakssggsgeekGLLDWILGGL  405
            MASLNLF F+P              A  ++RRVY AATAAKSSGGS EEK LLD+ILG L
Sbjct  1    MASLNLFNFTPIATAERSRVYTASLATTERRRVYAAATAAKSSGGSSEEKSLLDFILGSL  60

Query  404  QKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPKSNANggvfggfgglFAKKE  228
            QKEDQLLE DP+LKKVE KS  TT+    R K+  A PPK N+NGG FGGFGGLFAKK+
Sbjct  61   QKEDQLLEVDPVLKKVEEKSVGTTS----RGKNSVAVPPKKNSNGGGFGGFGGLFAKKD  115



>ref|XP_009763724.1| PREDICTED: uncharacterized protein LOC104215578 [Nicotiana sylvestris]
Length=115

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 81/119 (68%), Gaps = 19/119 (16%)
 Frame = -2

Query  539  MASLNLF-FSP--------------AAAKQRRVYtaataakssggsgeekGLLDWILGGL  405
            MASLNLF F+P              A  ++RRVY AATAAKSSGGS  EK LLD+ILG L
Sbjct  1    MASLNLFNFTPIATAERSRVYTASLATTERRRVYAAATAAKSSGGSSTEKSLLDFILGSL  60

Query  404  QKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPKSNANggvfggfgglFAKKE  228
            QKEDQLLE DPILKKVE KS  TT+    R K+  A P K N+N G FGGFGGLFAKK+
Sbjct  61   QKEDQLLEVDPILKKVEDKSVGTTS----RGKNSVAVPSKKNSNDGGFGGFGGLFAKKD  115



>ref|XP_002280087.1| PREDICTED: uncharacterized protein LOC100265554 [Vitis vinifera]
Length=88

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 54/88 (61%), Gaps = 8/88 (9%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + F+PAA    RV+ A     S G   +   +LDWILGGLQKEDQ+LETDPILKK
Sbjct  1    MASLTIAFAPAAG---RVFAATAEKSSGGSGEKG--ILDWILGGLQKEDQMLETDPILKK  55

Query  359  VEGKSSATTATVAGRRKSVAAPPPKSNA  276
            VE K+  +     GR+ SV  PP K   
Sbjct  56   VEEKNGGSN---GGRKNSVVVPPKKKGG  80



>ref|XP_007146732.1| hypothetical protein PHAVU_006G065100g [Phaseolus vulgaris]
 gb|ESW18726.1| hypothetical protein PHAVU_006G065100g [Phaseolus vulgaris]
Length=91

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS+ + FSPA     RV+ A  A  + G   E+   LDWILGGLQKEDQLLETDPILKK
Sbjct  1    MASIIMSFSPATG---RVFAATAAKGAGGSKEEKG-FLDWILGGLQKEDQLLETDPILKK  56

Query  359  VEGKSSATTATVAGRRKSVAAPPPK  285
            VE K+  TT T  GR+ SVA P  K
Sbjct  57   VEEKNGGTT-TSNGRKNSVAVPQKK  80



>gb|AFK39263.1| unknown [Medicago truncatula]
 gb|KEH34203.1| thylakoid soluble phosphoprotein TSP9 protein [Medicago truncatula]
Length=95

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            M SL + F+P   + R     AT   +S    EEKG LDWILGG+QKEDQ  ETDPILKK
Sbjct  1    MTSLFMSFTPTTTRTRVFAPTATKGTTSAPIKEEKGFLDWILGGMQKEDQFFETDPILKK  60

Query  359  VEGKSSATTATVAGRRKSVAAPP  291
            VE KS+ TT+   GR+ +V  PP
Sbjct  61   VEEKSAGTTSN--GRKNTVVVPP  81



>emb|CAN78614.1| hypothetical protein VITISV_028924 [Vitis vinifera]
Length=287

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (64%), Gaps = 8/88 (9%)
 Frame = -2

Query  548  ISYMASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPI  369
            I+ MASL + F+PAA    RV+ A     S G   +   +LDWILGGLQKEDQ+LETDPI
Sbjct  197  IAKMASLTIAFAPAAG---RVFAATAEKSSGGSGEKG--ILDWILGGLQKEDQMLETDPI  251

Query  368  LKKVEGKSSATTATVAGRRKSVAAPPPK  285
            LKKVE K+  +     GR+ SV  PP K
Sbjct  252  LKKVEEKNGGSN---GGRKNSVVVPPKK  276



>ref|XP_003551305.1| PREDICTED: uncharacterized protein LOC100788940 [Glycine max]
 gb|KHN06254.1| hypothetical protein glysoja_030320 [Glycine soja]
Length=92

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS+ + F+PA     RV+ A  A  + G   E+  LLDWILGGLQKEDQLLETDPILKK
Sbjct  1    MASIIMSFAPATG---RVFAATAAKGAGGSKEEKG-LLDWILGGLQKEDQLLETDPILKK  56

Query  359  VEGKSSATTATVAGRRKSVAAPPPK  285
            VE K+  TT+     + SVA P  K
Sbjct  57   VEEKNGGTTSNTGRNKNSVAVPQKK  81



>emb|CBI15993.3| unnamed protein product [Vitis vinifera]
Length=72

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 49/88 (56%), Gaps = 24/88 (27%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + F+PAA +                     G+LDWILGGLQKEDQ+LETDPILKK
Sbjct  1    MASLTIAFAPAAGR---------------------GILDWILGGLQKEDQMLETDPILKK  39

Query  359  VEGKSSATTATVAGRRKSVAAPPPKSNA  276
            VE K+  +     GR+ SV  PP K   
Sbjct  40   VEEKNGGSN---GGRKNSVVVPPKKKGG  64



>ref|XP_008220507.1| PREDICTED: uncharacterized protein LOC103320580 [Prunus mume]
Length=93

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQ--RRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASL + F+P A  +   RVY A  A   S        LLDWILGGL KEDQLLETDPIL
Sbjct  1    MASLTMVFAPVATGRASSRVYAATAAKGGSKEEKG---LLDWILGGLAKEDQLLETDPIL  57

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNA  276
            KKVE K+ AT     GR+ +V  P  K   
Sbjct  58   KKVEDKNGATN---GGRKGTVEIPQKKKGG  84



>ref|XP_009768375.1| PREDICTED: uncharacterized protein LOC104219388 [Nicotiana sylvestris]
Length=102

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRV--YtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASLNLF  P    QRRV  YT AT+AKSSGGS EEK +LD++LG + KEDQLLETDPIL
Sbjct  1    MASLNLFSPPIPITQRRVLVYTKATSAKSSGGSSEEKSILDFVLGAITKEDQLLETDPIL  60

Query  365  KKVEGKSSATTA  330
            KKVEGKS+ TT 
Sbjct  61   KKVEGKSTGTTT  72



>ref|XP_009386263.1| PREDICTED: uncharacterized protein LOC103973429 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL++ F  A A  R V+ A   AK +G SGEEKGLLDWILGGLQKEDQLLETDPILKK
Sbjct  1    MASLSMAFGAAVAGGR-VFAATAEAKGAGSSGEEKGLLDWILGGLQKEDQLLETDPILKK  59

Query  359  V-EGKSSATTATVAGRRKS  306
            V E     + +T  G RKS
Sbjct  60   VGEKNGGGSRSTATGSRKS  78



>ref|XP_010278955.1| PREDICTED: uncharacterized protein LOC104612980 [Nelumbo nucifera]
Length=152

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPKSNA  276
            LLDWILG L+KEDQLLETDPILKKV+ K++ TT+   GRR S+  PP KS+A
Sbjct  102  LLDWILGDLKKEDQLLETDPILKKVDEKNNGTTSL--GRRGSIVVPPKKSDA  151



>ref|XP_004500236.1| PREDICTED: uncharacterized protein LOC101488529 [Cicer arietinum]
Length=95

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS+ + F P+  +       ++         EEKG+ DWI+GGLQKEDQLLETDPILKK
Sbjct  1    MASIIMSFVPSTTRVFATKGTSSGGGGGSSIKEEKGIFDWIIGGLQKEDQLLETDPILKK  60

Query  359  VEGKSSATTATVAGRRKSVAAP  294
            VE KS  TT+   GR+ +VA P
Sbjct  61   VEEKSGGTTSN--GRKNTVAVP  80



>ref|XP_008464052.1| PREDICTED: uncharacterized protein LOC103502033 [Cucumis melo]
Length=96

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + FSPAA    RV+ A  A  +     E+  LLDWI+G L K DQLLETDP+L+K
Sbjct  1    MASLPIAFSPAAG---RVFAATAAKGAGESKKEKG-LLDWIIGSLNK-DQLLETDPVLQK  55

Query  359  VEGK---SSATTATVAGRRKSVAAPPPKSNA  276
            VEGK   S   T TV GR+ SV  PP K+  
Sbjct  56   VEGKDGTSGNGTGTVRGRKNSVQIPPKKNGG  86



>ref|XP_007206189.1| hypothetical protein PRUPE_ppa013971mg [Prunus persica]
 gb|EMJ07388.1| hypothetical protein PRUPE_ppa013971mg [Prunus persica]
Length=93

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  MASLNLFFSPA--AAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASL + F+P        RVY A  A   S        LLDWILGGL KEDQLLETDPIL
Sbjct  1    MASLTMVFAPVPTGRASSRVYAATAAKGGSKEEKG---LLDWILGGLAKEDQLLETDPIL  57

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNA  276
            KKVE K+ AT     GR+ +V  P  K   
Sbjct  58   KKVEDKNGATN---GGRKGTVEIPQKKKGG  84



>ref|XP_011035188.1| PREDICTED: uncharacterized protein LOC105133071 [Populus euphratica]
Length=92

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPK  285
            LLDWI+G LQKEDQ  ETDPILKKVEGK+S  TA+  GR+ SVA P  K
Sbjct  33   LLDWIIGSLQKEDQFYETDPILKKVEGKNSGGTAS--GRKNSVAVPQKK  79



>ref|XP_004143212.1| PREDICTED: uncharacterized protein LOC101205268 [Cucumis sativus]
 ref|XP_004160173.1| PREDICTED: uncharacterized protein LOC101232525 [Cucumis sativus]
 gb|KGN47098.1| hypothetical protein Csa_6G187910 [Cucumis sativus]
Length=97

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + FSPAA    RV+ A  A  +     E+  LLDWI+G L K DQLLETDP+L+K
Sbjct  1    MASLPIAFSPAAG---RVFAATAAKGAGESKKEKG-LLDWIIGSLNK-DQLLETDPVLQK  55

Query  359  VEGKSSAT---TATVAGRRKSVAAPPPKSNAN  273
            VEGK +A+   T +V G RK+    PPK N  
Sbjct  56   VEGKDAASGNGTGSVRGGRKNSVQVPPKKNGG  87



>ref|XP_010104673.1| hypothetical protein L484_022051 [Morus notabilis]
 gb|EXC01479.1| hypothetical protein L484_022051 [Morus notabilis]
Length=89

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 7/85 (8%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + FSPA     RV+ A  A  + G   E+  LLDWILGGLQK++QLLETDPILKK
Sbjct  1    MASLTMAFSPALTG--RVFAATAAKGTGGSKEEKG-LLDWILGGLQKDNQLLETDPILKK  57

Query  359  VEGKSSATTATVAGRRKSVAAPPPK  285
            VE K+         R+ SVA PP K
Sbjct  58   VEEKNGGGGG----RKNSVAVPPKK  78



>ref|XP_002298321.1| hypothetical protein POPTR_0001s25670g [Populus trichocarpa]
 gb|ABK95428.1| unknown [Populus trichocarpa]
 gb|EEE83126.1| hypothetical protein POPTR_0001s25670g [Populus trichocarpa]
Length=92

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPK  285
            LLDWI+G LQKEDQ  ETDPILKKVEGK++  TA+  GR+ SVA P  K
Sbjct  33   LLDWIIGSLQKEDQFYETDPILKKVEGKNNGGTAS--GRKNSVAVPQKK  79



>ref|XP_008785407.1| PREDICTED: uncharacterized protein LOC103704050 [Phoenix dactylifera]
Length=94

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 4/76 (5%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS  +    AAA   RV+ A  A  + G   E+  L+DWILGGLQKEDQLLETDPIL+K
Sbjct  1    MASFGIVGFGAAAASGRVFAATAAKSAGGSGEEKG-LMDWILGGLQKEDQLLETDPILQK  59

Query  359  VEGKSSA---TTATVA  321
            VEGK+     +T TV+
Sbjct  60   VEGKNGGGGKSTGTVS  75



>ref|XP_002313390.1| hypothetical protein POPTR_0009s04820g [Populus trichocarpa]
 gb|EEE87345.1| hypothetical protein POPTR_0009s04820g [Populus trichocarpa]
Length=90

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + F   A+   RVY A  +  S    G    LLDWILG LQKEDQ  ETDPILKK
Sbjct  1    MASLPIVF---ASPSVRVYAATASGGSKEEKG----LLDWILGSLQKEDQFYETDPILKK  53

Query  359  VEGKSSATTATVAGRRKSVAAP  294
            VE K+S    T +GRR SVA P
Sbjct  54   VEEKNSG--GTTSGRRNSVAVP  73



>ref|XP_008355306.1| PREDICTED: uncharacterized protein LOC103418963 [Malus domestica]
Length=92

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 50/90 (56%), Gaps = 9/90 (10%)
 Frame = -2

Query  539  MASLNLFFSPAAA--KQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASL + F P        +VY A  A   S        LLDWILGGL KEDQLLE DPIL
Sbjct  1    MASLTMVFPPVVTGWATGQVYAATAAKGGSKEEKG---LLDWILGGLAKEDQLLEVDPIL  57

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNA  276
            KKVE K+     TV+GR+ +V  PP K   
Sbjct  58   KKVEDKN----GTVSGRKGTVVVPPKKXGG  83



>ref|XP_010033024.1| PREDICTED: uncharacterized protein LOC104422404 [Eucalyptus grandis]
Length=94

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPP  291
            LLDWI+GGL KEDQLLETDPILKKVEGK+   + T  G + +VA PP
Sbjct  34   LLDWIVGGLAKEDQLLETDPILKKVEGKNGTGSGT--GSKNTVAMPP  78



>ref|XP_011032145.1| PREDICTED: uncharacterized protein LOC105131070 [Populus euphratica]
Length=90

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAP  294
            LLDWILG +QKEDQ  ETDPILKKVE K+S    T +GRR SVA P
Sbjct  30   LLDWILGSMQKEDQFYETDPILKKVEEKNSG--GTTSGRRNSVAVP  73



>ref|XP_009374270.1| PREDICTED: uncharacterized protein LOC103963214 [Pyrus x bretschneideri]
Length=93

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 49/91 (54%), Gaps = 9/91 (10%)
 Frame = -2

Query  539  MASLNLFFSPAAAK--QRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASL + F P        +VY A  A   S        LLDWILGGL KEDQLLE DPIL
Sbjct  1    MASLTMVFPPVVTSWATGQVYAATAAKGGSKEEKG---LLDWILGGLAKEDQLLEVDPIL  57

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPKSNAN  273
            KKVE K+     TV+G + +V  PP K    
Sbjct  58   KKVEDKN----GTVSGSKGTVVVPPKKKQGG  84



>ref|XP_006425038.1| hypothetical protein CICLE_v10029657mg [Citrus clementina]
 ref|XP_006488492.1| PREDICTED: uncharacterized protein LOC102613315 [Citrus sinensis]
 gb|ESR38278.1| hypothetical protein CICLE_v10029657mg [Citrus clementina]
 gb|KDO66830.1| hypothetical protein CISIN_1g034302mg [Citrus sinensis]
Length=98

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = -2

Query  539  MASLNLF-FSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILK  363
            MASL +  F+PA     RVY A  A ++ G   E+  LLDWILGG+QK+DQ  ETDPILK
Sbjct  1    MASLPIISFAPATV---RVYAATAAKEAGGSKEEKS-LLDWILGGMQKQDQFYETDPILK  56

Query  362  KVEGKSSATT-ATVAGRRKSVAAPPPK  285
            KVE KS  +   T  GR+ S + P P+
Sbjct  57   KVEDKSPPSGRGTTNGRKNSASVPQPQ  83



>ref|XP_003538289.1| PREDICTED: uncharacterized protein LOC100789683 [Glycine max]
 gb|KHN47606.1| hypothetical protein glysoja_047850 [Glycine soja]
Length=92

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS+ + F+PA     RV+ A  A  + G   +   LLDWI+GGLQKEDQL+ETDPILKK
Sbjct  1    MASIIMSFAPATG---RVFAATAAKGAGGSKEKG--LLDWIIGGLQKEDQLVETDPILKK  55

Query  359  VEGKSSATTATVAGRRKSVAAPPPK  285
            VE K+  TT T  GR K+  A P K
Sbjct  56   VEEKNGGTTTTTTGRNKNSVAVPQK  80



>ref|XP_002525607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36725.1| conserved hypothetical protein [Ricinus communis]
Length=94

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPKSN  279
             LDW+LG L KEDQ  ETDPILKKVE KSS    T +GR+ SV+ P  K N
Sbjct  33   FLDWVLGNLTKEDQFYETDPILKKVEEKSSG--GTTSGRKNSVSIPQKKKN  81



>gb|KDP46523.1| hypothetical protein JCGZ_08495 [Jatropha curcas]
Length=96

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + F+P      RVY A    ++ G   E+   LDW+LG L KEDQ  ETDPILKK
Sbjct  1    MASLPIVFAPPKV---RVYAATATKEAGGSKEEKS-FLDWVLGNLAKEDQFYETDPILKK  56

Query  359  VEGKSSATTATVAGRRKSVAAPPPKSNA  276
            VE K+S+ T +  GR  SV+ P  K N 
Sbjct  57   VEEKNSSGTTSGRGRN-SVSIPQKKKNG  83



>ref|XP_004490584.1| PREDICTED: uncharacterized protein LOC101497020 [Cicer arietinum]
Length=85

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 6/49 (12%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPK  285
             LDWILGG+QKEDQLLETDPILKKVE K+S      +G + SVA P  K
Sbjct  32   FLDWILGGMQKEDQLLETDPILKKVEEKNS------SGGKNSVAVPQKK  74



>ref|XP_007016156.1| Uncharacterized protein TCM_041656 [Theobroma cacao]
 gb|EOY33775.1| Uncharacterized protein TCM_041656 [Theobroma cacao]
Length=91

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 6/82 (7%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL + F+P+     RV+ A  A  + G   E+  L DWILG LQKE+Q  ETDPIL+K
Sbjct  1    MASLLISFAPSTT---RVFAATAAKSAGGSKEEKG-LFDWILGQLQKEEQFYETDPILQK  56

Query  359  VEGKSSATTATVAGRRKSVAAP  294
            VEGK+     T +GR+ SV+ P
Sbjct  57   VEGKNG--DGTTSGRKNSVSVP  76



>ref|XP_010923108.1| PREDICTED: uncharacterized protein LOC105046265 [Elaeis guineensis]
Length=94

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MAS  +    AAA   RV+ A  A  + G   E+  LLDWILGGLQKEDQLLETDP+L+K
Sbjct  1    MASFGIMGFGAAAASGRVFAATAAKSTGGSGEEKG-LLDWILGGLQKEDQLLETDPVLQK  59

Query  359  VEGKSSATTATVAGRRKSVAAPPPKS  282
            VE K+        GR+ + +   P +
Sbjct  60   VEEKNG------GGRKSTNSVSIPNN  79



>ref|XP_010249464.1| PREDICTED: uncharacterized protein LOC104592021 [Nelumbo nucifera]
Length=195

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MA L + F+P      RV+ A TA +S G   E+  LLDWIL GLQKEDQLLETDP LK 
Sbjct  1    MAPLTIAFAPPVG---RVFAATTAKRSGGCGEEKG-LLDWILRGLQKEDQLLETDPTLKN  56

Query  359  VEGKSSATTATVAGRRKSVAAPPPKSNA  276
            V+ K++ TT++  G R S+A PP KS+ 
Sbjct  57   VKKKNNDTTSS--GWRGSIAVPPKKSSG  82



>ref|XP_009398868.1| PREDICTED: uncharacterized protein LOC103983369 [Musa acuminata 
subsp. malaccensis]
Length=98

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 4/55 (7%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRK---SVAAPPPKSNA  276
            LLDWILGGLQKEDQLLETDPIL+KVE +S+    T   R+    SV+ P  K + 
Sbjct  36   LLDWILGGLQKEDQLLETDPILRKVE-ESNGRGRTTGSRKSTTTSVSVPNKKKSG  89



>ref|XP_004295742.1| PREDICTED: uncharacterized protein LOC101297818 [Fragaria vesca 
subsp. vesca]
Length=96

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQ--RRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MAS  + F+P    +   RVY A  A  + G   E+   +DW+ G + KEDQLLE DPIL
Sbjct  1    MASFTMVFAPMVTTRVNTRVYAATAAKGAGGSKEEKG-FIDWLGGVIAKEDQLLEVDPIL  59

Query  365  KKVEGKSSATTATVAGRRKSVAAPPPK  285
            KKVE KS  TT     R+ +V  PP K
Sbjct  60   KKVEDKSGGTTND---RKNTVVVPPKK  83



>emb|CAD45559.1| thylakoid soluble phosphoprotein [Spinacia oleracea]
Length=103

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 8/94 (9%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            M+SL   F  AAA  R V   A AAK +  + +EK  +DW+LG + KEDQ  ETDPIL+ 
Sbjct  1    MSSLPFVFG-AAASSRVV--TAAAAKGTAETKQEKSFVDWLLGKITKEDQFYETDPILRG  57

Query  359  VEGKSSATTA-----TVAGRRKSVAAPPPKSNAN  273
             + KSS +T+     T +G++ +V+ P  K N N
Sbjct  58   GDVKSSGSTSGKKGGTTSGKKGTVSIPSKKKNGN  91



>pdb|2FFT|A Chain A, Nmr Structure Of Spinach Thylakoid Soluble Phosphoprotein 
Of 9 Kda In Sds Micelles
Length=84

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 5/58 (9%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTA-----TVAGRRKSVAAPPPKSNAN  273
             +DW+LG + KEDQ  ETDPIL+  + KSS +T+     T +G++ +V+ P  K N N
Sbjct  15   FVDWLLGKITKEDQFYETDPILRGGDVKSSGSTSGKKGGTTSGKKGTVSIPSKKKNGN  72



>ref|XP_006848136.1| hypothetical protein AMTR_s00029p00225070 [Amborella trichopoda]
 gb|ERN09717.1| hypothetical protein AMTR_s00029p00225070 [Amborella trichopoda]
Length=89

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 30/49 (61%), Gaps = 6/49 (12%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTATVAGRRKSVAAPPPK  285
            L DWI   LQKEDQ  ETDPILKKVE K+        G++ SV  P PK
Sbjct  32   LFDWITAKLQKEDQFYETDPILKKVEEKNG------VGKKNSVTIPSPK  74



>ref|XP_010520224.1| PREDICTED: uncharacterized protein LOC104799405 [Tarenaya hassleriana]
Length=96

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 32/53 (60%), Gaps = 3/53 (6%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGK---SSATTATVAGRRKSVAAPPPKS  282
             LDW+LG L KEDQ  ETDPILKKVE K         T  G + SVA PP K+
Sbjct  34   FLDWVLGNLTKEDQFYETDPILKKVEEKGTTGGNGRGTTRGGKNSVAVPPKKN  86



>ref|XP_003615604.1| hypothetical protein MTR_5g069990 [Medicago truncatula]
 gb|AES98562.1| thylakoid soluble phosphoprotein TSP9 protein [Medicago truncatula]
Length=106

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (63%), Gaps = 10/56 (18%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSA--TTA--------TVAGRRKSVAAP  294
              DWI+GGL KEDQ  ETDPILKKVE K+++  TT+        T +G + SV  P
Sbjct  37   FWDWIVGGLTKEDQFYETDPILKKVEEKNNSRGTTSRGTTSGKGTTSGGKNSVVVP  92



>gb|KFK27416.1| hypothetical protein AALP_AA8G379900 [Arabis alpina]
Length=91

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 7/87 (8%)
 Frame = -2

Query  536  ASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKKV  357
            +S+ + FSPA    R   T A    S+  + EEK ++D++LG L K+DQ  ETDPILKKV
Sbjct  3    SSILMSFSPATV--RCFATGAKGTSSTTTAKEEKNIIDFVLGSLTKQDQFYETDPILKKV  60

Query  356  EGKSSATTATVAGRRKSVAAPPPKSNA  276
            + K   T     G + SV  PP K++ 
Sbjct  61   DDKEGTT-----GGKNSVVVPPKKNSG  82



>gb|EYU18977.1| hypothetical protein MIMGU_mgv1a016754mg [Erythranthe guttata]
Length=108

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = -2

Query  539  MASLNLFFSPA-AAKQRRVY-taataakssggsgeekGLLDWILGGLQKEDQLLETDPIL  366
            MASLNLF +P     QRRV  TAATAAKSSGG GEEKGLLD+ILGGL KE+Q+ ET+PIL
Sbjct  1    MASLNLFVAPINVTPQRRVLRTAATAAKSSGGGGEEKGLLDFILGGLAKEEQIYETNPIL  60

Query  365  KKVE  354
            KKVE
Sbjct  61   KKVE  64



>emb|CDX80332.1| BnaC09g34100D [Brassica napus]
Length=101

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTA-----TVAGRRKSVAAPPPKSNA  276
            ++D++LG L K+DQ  ETDP+LKKV+ K   T       TV+G + S+A P  K+  
Sbjct  36   IIDFVLGSLTKQDQFYETDPLLKKVDDKEGTTGGNGDRKTVSGGKNSLAVPQKKNGG  92



>ref|XP_009120394.1| PREDICTED: uncharacterized protein LOC103845311 [Brassica rapa]
 emb|CDY54176.1| BnaA10g29120D [Brassica napus]
Length=101

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTA-----TVAGRRKSVAAPPPKSNA  276
            ++D++LG L K+DQ  ETDP+LKKV+ K   T       TV+G + S+A P  K+  
Sbjct  36   IIDFVLGSLTKQDQFYETDPLLKKVDDKEGTTGGNGGRKTVSGGKNSLAVPQKKNGG  92



>ref|XP_010685599.1| PREDICTED: uncharacterized protein LOC104899990 [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            MASL   F  AA    RV+T      SS  + E+   +DW+LG + KEDQ  ETDP+L+K
Sbjct  1    MASLPFVFGAAATG--RVFTTRATKGSSAPTEEKS-FVDWLLGKVAKEDQFYETDPLLQK  57

Query  359  VEGKSSATTATVAGRRKSVAAPPPK  285
            VE K++ TT    GR+ +V+    K
Sbjct  58   VEEKAAGTT---NGRKGTVSMQSKK  79



>ref|XP_010503323.1| PREDICTED: uncharacterized protein LOC104780519 [Camelina sativa]
Length=116

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 4/45 (9%)
 Frame = -2

Query  428  LDWILGGLQKEDQLLETDPILKKVEGK----SSATTATVAGRRKS  306
            LD++LG + K+DQ  ETDPILKKVE K    SS TT+   G R S
Sbjct  34   LDFVLGFMTKQDQFYETDPILKKVEEKQATRSSGTTSGKGGTRSS  78



>ref|XP_002877540.1| hypothetical protein ARALYDRAFT_905937 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53799.1| hypothetical protein ARALYDRAFT_905937 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (57%), Gaps = 7/88 (8%)
 Frame = -2

Query  539  MASLNLFFSPAAAKQRRVYtaataakssggsgeekGLLDWILGGLQKEDQLLETDPILKK  360
            ++SL + F+PA     RVY   T   S G   E+  + D++LG + K+DQ  ET+PILKK
Sbjct  2    VSSLLMSFAPATV---RVYATGTKGASGGAKEEKNPI-DFVLGFMTKQDQFYETNPILKK  57

Query  359  VEGKSSATTA--TVAGRRKSVAAP-PPK  285
            VE K   T +  TV G + S   P PPK
Sbjct  58   VEEKEGTTGSRGTVRGGKNSAPTPVPPK  85



>ref|XP_006401030.1| hypothetical protein EUTSA_v10015099mg [Eutrema salsugineum]
 gb|ESQ42483.1| hypothetical protein EUTSA_v10015099mg [Eutrema salsugineum]
Length=102

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 35/55 (64%), Gaps = 5/55 (9%)
 Frame = -2

Query  431  LLDWILGGLQKEDQLLETDPILKKVEGKSSATTA-----TVAGRRKSVAAPPPKS  282
            ++D++LG L K+DQ  ET+P+LKKV+ K   T       TV+G + SVA P  K+
Sbjct  37   IIDFVLGSLTKQDQFYETNPLLKKVDEKEGGTGGNGGRKTVSGGKNSVAVPQKKN  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 704648528304