BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4533_g1_i1 len=559 path=[1:0-558]

Length=559
                                                                      Score     E

ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        211   2e-65   
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   211   2e-65   Nicotiana tabacum [American tobacco]
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        209   4e-65   
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       209   8e-65   
gb|AAD02543.1|  PGPS/D1                                                 207   4e-64   Petunia x hybrida [garden petunia]
ref|XP_004250748.1|  PREDICTED: LIM domain-containing protein WLI...    206   9e-64   
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        206   9e-64   
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     205   3e-63   Vitis vinifera
gb|AAD39103.1|AF116849_1  LIM domain protein WLIM-1                     203   2e-62   Helianthus annuus
gb|AFK47041.1|  unknown                                                 203   2e-62   
gb|AFK42495.1|  unknown                                                 203   2e-62   
emb|CDP01275.1|  unnamed protein product                                202   4e-62   
gb|AAD56959.1|AF187105_1  LIM domain protein WLIM1                      202   6e-62   Helianthus annuus
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     201   9e-62   Vitis vinifera
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     201   1e-61   
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              201   2e-61   Ricinus communis
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     201   2e-61   
ref|XP_004290976.1|  PREDICTED: pollen-specific protein SF3-like        201   2e-61   
gb|ABK93551.1|  unknown                                                 200   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             200   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    199   6e-61   
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             199   6e-61   
ref|XP_010094354.1|  Pollen-specific protein SF3                        199   7e-61   
dbj|BAM05591.1|  LIM transcription factor                               199   7e-61   
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                199   7e-61   
ref|XP_003589058.1|  Transcription factor lim1                          199   7e-61   
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    199   9e-61   
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        199   1e-60   
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             198   1e-60   
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        198   2e-60   
ref|NP_001238580.1|  uncharacterized protein LOC100499957               198   2e-60   
gb|KHN04435.1|  Pollen-specific protein SF3                             198   2e-60   
ref|NP_001235758.1|  uncharacterized protein LOC100305720               198   2e-60   
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             198   2e-60   
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        197   3e-60   
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        197   3e-60   
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    197   3e-60   
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        197   3e-60   
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    197   3e-60   
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        197   4e-60   
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        197   4e-60   
dbj|BAM05589.1|  LIM transcription factor                               197   4e-60   
ref|XP_010938994.1|  PREDICTED: LIM domain-containing protein WLI...    197   4e-60   
gb|KHN36972.1|  Pollen-specific protein SF3                             197   4e-60   
dbj|BAB84581.1|  transcription factor LIM                               197   5e-60   Populus sieboldii x Populus grandidentata
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        197   5e-60   
ref|XP_002320687.1|  transcription factor LIM family protein            197   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        197   6e-60   
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        197   6e-60   
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    197   6e-60   
gb|AGE09584.1|  LIM1-like protein                                       196   7e-60   
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    196   7e-60   
ref|NP_001238429.1|  uncharacterized protein LOC100499947               196   8e-60   
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         196   8e-60   
emb|CDY20647.1|  BnaC08g14110D                                          196   2e-59   
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        196   2e-59   
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             196   2e-59   
ref|XP_010028358.1|  PREDICTED: pollen-specific protein SF3-like        196   2e-59   
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             196   2e-59   
gb|ABK58467.1|  LIM domain protein WLIM1a                               195   3e-59   Populus tremula x Populus alba [gray poplar]
dbj|BAB84584.1|  transcription factor LIM                               195   3e-59   Nicotiana tabacum [American tobacco]
gb|AFV60741.1|  LIM domain protein LIM-2                                195   3e-59   
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          195   3e-59   
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     195   3e-59   
ref|NP_172491.1|  transcription factor lim1                             195   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        195   3e-59   
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                195   3e-59   
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             195   3e-59   
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     195   3e-59   
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    195   3e-59   
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        194   4e-59   
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    194   4e-59   
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    195   4e-59   
gb|AGE09578.1|  LIM-like protein                                        194   4e-59   
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        194   4e-59   
ref|NP_001237652.1|  uncharacterized protein LOC100527547               194   5e-59   
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          194   8e-59   
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             194   8e-59   
gb|AII80544.1|  LIM-domain protein 10                                   194   8e-59   
dbj|BAA82827.1|  transcription factor Ntlim1                            194   9e-59   Nicotiana tabacum [American tobacco]
emb|CDX94916.1|  BnaC05g07550D                                          194   9e-59   
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     194   1e-58   
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             193   1e-58   
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             193   1e-58   
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    193   2e-58   
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        193   2e-58   
gb|ABB51614.1|  LIM-domain protein                                      193   2e-58   Brassica napus [oilseed rape]
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        192   2e-58   
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    192   2e-58   
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             192   2e-58   
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             192   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    192   3e-58   
gb|ABK94586.1|  unknown                                                 192   3e-58   Populus trichocarpa [western balsam poplar]
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      192   4e-58   Nicotiana tabacum [American tobacco]
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        192   4e-58   
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        192   5e-58   
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    192   6e-58   
gb|EYU36386.1|  hypothetical protein MIMGU_mgv1a009946mg                196   7e-58   
gb|ABK95336.1|  unknown                                                 191   7e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             191   7e-58   Populus trichocarpa [western balsam poplar]
gb|ABY21316.1|  LIM1                                                    191   8e-58   Lilium longiflorum [Easter lily]
gb|ABK58465.1|  LIM domain protein GLIM1b                               191   9e-58   Populus tremula x Populus alba [gray poplar]
gb|AGJ83946.1|  lim protein 6                                           191   1e-57   
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        191   1e-57   
ref|XP_007201308.1|  hypothetical protein PRUPE_ppa011881mg             191   1e-57   
gb|ABK58464.1|  LIM domain protein GLIM1a                               190   2e-57   Populus tremula x Populus alba [gray poplar]
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    190   3e-57   
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    189   3e-57   
ref|NP_001235271.1|  uncharacterized protein LOC100500501               189   8e-57   
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    189   8e-57   
ref|XP_008236308.1|  PREDICTED: pollen-specific protein SF3-like        189   8e-57   
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             188   9e-57   
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              188   1e-56   Ricinus communis
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    188   1e-56   
gb|KHN19331.1|  Pollen-specific protein SF3                             188   1e-56   
ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        188   1e-56   
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        188   1e-56   
gb|AII80541.1|  LIM-domain protein 7                                    189   2e-56   
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        188   2e-56   
emb|CDO97286.1|  unnamed protein product                                188   2e-56   
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         188   2e-56   
gb|KHN16307.1|  Pollen-specific protein SF3                             188   2e-56   
ref|NP_001238190.1|  uncharacterized protein LOC100500444               188   2e-56   
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     187   2e-56   
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        187   3e-56   
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        187   3e-56   Ricinus communis
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        187   3e-56   
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             187   4e-56   
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             187   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_004289780.1|  PREDICTED: pollen-specific protein SF3-like        187   5e-56   
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        186   7e-56   
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          186   7e-56   Sorghum bicolor [broomcorn]
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    186   7e-56   
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    186   1e-55   
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        186   1e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004299580.1|  PREDICTED: pollen-specific protein SF3-like        185   2e-55   
ref|XP_006422808.1|  hypothetical protein CICLE_v10029316mg             185   2e-55   
ref|NP_001104937.2|  LOC541782                                          185   3e-55   Zea mays [maize]
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     185   3e-55   
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    184   3e-55   
gb|ACG34183.1|  pollen-specific protein SF3                             184   4e-55   Zea mays [maize]
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    184   5e-55   
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     184   6e-55   Vitis vinifera
gb|AII80542.1|  LIM-domain protein 8                                    184   7e-55   
gb|KHG14633.1|  Pollen-specific SF3                                     184   7e-55   
dbj|BAB84583.1|  transcription factor LIM                               184   8e-55   Nicotiana tabacum [American tobacco]
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    183   9e-55   
gb|ABW69660.1|  transcription factor LIM                                183   1e-54   
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             183   1e-54   
ref|NP_001148027.1|  pollen-specific protein SF3                        183   2e-54   Zea mays [maize]
dbj|BAJ94823.1|  predicted protein                                      183   2e-54   
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     182   2e-54   
ref|XP_008364385.1|  PREDICTED: pollen-specific protein SF3-like        182   2e-54   
sp|P29675.1|SF3_HELAN  RecName: Full=Pollen-specific protein SF3        183   3e-54   Helianthus annuus
gb|AAD56957.1|AF187103_1  LIM domain protein PLIM1b                     182   3e-54   Helianthus annuus
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   182   4e-54   Solanum lycopersicum
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        182   4e-54   
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    181   5e-54   
ref|XP_010111544.1|  Pollen-specific protein SF3                        181   8e-54   
gb|ABK23670.1|  unknown                                                 180   3e-53   Picea sitchensis
ref|XP_010091018.1|  Pollen-specific protein SF3                        179   3e-53   
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    180   4e-53   
gb|ABK22236.1|  unknown                                                 179   4e-53   Picea sitchensis
emb|CDP17006.1|  unnamed protein product                                179   4e-53   
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        179   4e-53   
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        178   8e-53   
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    178   1e-52   
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             177   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        178   2e-52   
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    177   3e-52   
ref|XP_007143127.1|  hypothetical protein PHAVU_007G046100g             176   4e-52   
gb|AAD32870.1|AC005489_8  F14N23.8                                      177   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KDP44510.1|  hypothetical protein JCGZ_16343                         176   5e-52   
gb|ACA33841.1|  LIM2 transcription factor                               176   7e-52   Pinus pinaster [cluster pine]
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        176   8e-52   
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        176   9e-52   
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        176   9e-52   
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    175   1e-51   
ref|XP_004496871.1|  PREDICTED: pollen-specific protein SF3-like        175   2e-51   
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             174   5e-51   
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        173   7e-51   
gb|KHG30571.1|  Pollen-specific SF3                                     172   1e-50   
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    174   1e-50   
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        174   1e-50   
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    174   1e-50   
gb|KCW55096.1|  hypothetical protein EUGRSUZ_I01055                     172   2e-50   
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        172   3e-50   
ref|NP_001236461.1|  uncharacterized protein LOC100306027               171   3e-50   
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        171   7e-50   
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    170   3e-49   
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    169   4e-49   
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                168   5e-49   
gb|AEA86290.1|  transcription factor LIM                                166   6e-49   
gb|KHN06818.1|  Pollen-specific protein SF3                             168   6e-49   
ref|XP_009389653.1|  PREDICTED: pollen-specific protein SF3-like        166   5e-48   
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    166   1e-47   
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        162   2e-46   
ref|XP_003608956.1|  LIM domain protein                                 162   2e-46   
gb|AFK42303.1|  unknown                                                 162   2e-46   
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                162   2e-46   
gb|EEC69362.1|  hypothetical protein OsI_38483                          159   4e-46   Oryza sativa Indica Group [Indian rice]
gb|EPS69807.1|  hypothetical protein M569_04956                         157   7e-46   
gb|EMT23508.1|  Pollen-specific protein SF3                             161   2e-45   
gb|EMS67160.1|  Pollen-specific protein SF3                             157   2e-44   
gb|ACA33852.1|  LIM2 transcription factor                               155   2e-44   Pinus taeda
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             156   3e-44   
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             156   5e-44   
ref|XP_008793825.1|  PREDICTED: pollen-specific protein SF3-like ...    153   1e-43   
gb|ACU17588.1|  unknown                                                 153   1e-43   Glycine max [soybeans]
ref|XP_001765937.1|  predicted protein                                  154   2e-43   
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    153   4e-43   
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    153   4e-43   
gb|AFW74662.1|  putative LIM-type zinc finger domain family protein     150   6e-43   
gb|AAZ95169.1|  putative transcription factor LIM                       150   6e-43   Brassica rapa
gb|EEE65408.1|  hypothetical protein OsJ_20745                          155   7e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    152   2e-42   
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        151   2e-42   
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                151   3e-42   
ref|NP_001241110.1|  uncharacterized protein LOC100809121               151   3e-42   
gb|ABK22125.1|  unknown                                                 151   4e-42   Picea sitchensis
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             151   4e-42   
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        150   6e-42   
emb|CBL95262.1|  lim domain protein                                     150   1e-41   
gb|KHN17859.1|  Pollen-specific protein SF3                             149   2e-41   
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    149   2e-41   
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          148   4e-41   
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          148   5e-41   
ref|XP_010093495.1|  Pollen-specific protein SF3                        148   6e-41   
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        148   6e-41   
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        148   7e-41   
ref|XP_010227809.1|  PREDICTED: enolase-phosphatase E1-like             159   7e-41   
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             147   8e-41   
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    148   8e-41   
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    147   1e-40   
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             147   1e-40   
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             147   2e-40   
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    147   2e-40   
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    146   2e-40   
ref|XP_002315180.1|  LIM domain-containing family protein               146   2e-40   Populus trichocarpa [western balsam poplar]
gb|AFK39062.1|  unknown                                                 146   3e-40   
gb|ABK58469.1|  LIM domain protein WLIM2a                               146   3e-40   Populus tremula x Populus alba [gray poplar]
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    146   3e-40   
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    146   3e-40   
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    146   4e-40   
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         145   5e-40   
gb|ACX47456.1|  LIM1                                                    145   6e-40   Hevea brasiliensis [jebe]
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        145   7e-40   
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    145   8e-40   
ref|XP_001771340.1|  predicted protein                                  145   8e-40   
gb|EEC80296.1|  hypothetical protein OsI_22314                          155   9e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001057248.1|  Os06g0237300                                       155   1e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              144   1e-39   Ricinus communis
ref|XP_004965094.1|  PREDICTED: microtubule-associated protein fu...    155   1e-39   
gb|AGJ83945.1|  lim protein 5                                           144   1e-39   
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    145   1e-39   
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        145   1e-39   
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        145   1e-39   
gb|KHG07853.1|  Pollen-specific SF3                                     144   2e-39   
ref|XP_008649270.1|  PREDICTED: microtubule-associated protein fu...    154   2e-39   
ref|XP_002312139.1|  LIM domain-containing family protein               144   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    144   3e-39   
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    144   3e-39   
ref|XP_004307607.1|  PREDICTED: pollen-specific protein SF3-like        143   4e-39   
gb|EMS52970.1|  Pollen-specific protein SF3                             153   5e-39   
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    143   5e-39   Vitis vinifera
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        142   6e-39   
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    142   8e-39   
gb|KHG27160.1|  Pollen-specific SF3                                     142   9e-39   
ref|XP_006656826.1|  PREDICTED: microtubule-associated protein fu...    152   1e-38   
gb|EMT02506.1|  Pollen-specific protein SF3                             151   2e-38   
ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        140   4e-38   
emb|CDY20498.1|  BnaC04g05460D                                          141   4e-38   
gb|ABK94608.1|  unknown                                                 140   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             140   4e-38   
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    142   5e-38   
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        140   7e-38   
emb|CDY24943.1|  BnaC03g22290D                                          140   8e-38   
emb|CDY60999.1|  BnaA03g56620D                                          140   9e-38   
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        140   1e-37   
dbj|BAM13335.1|  LIM domain-containing protein                          139   2e-37   
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             139   2e-37   
gb|EPS59684.1|  hypothetical protein M569_15118                         138   3e-37   
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        138   3e-37   
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    139   4e-37   
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        139   4e-37   
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    138   5e-37   
emb|CBI40313.3|  unnamed protein product                                138   5e-37   
dbj|BAM13341.1|  LIM domain-containing protein                          138   5e-37   
ref|NP_001049655.1|  Os03g0266100                                       138   5e-37   
dbj|BAM13340.1|  LIM domain-containing protein                          138   6e-37   
dbj|BAM13338.1|  LIM domain-containing protein                          137   8e-37   
ref|XP_002970742.1|  hypothetical protein SELMODRAFT_441295             137   8e-37   
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    139   8e-37   
dbj|BAM13339.1|  LIM domain-containing protein                          137   8e-37   
ref|XP_003600847.1|  LIM domain-containing protein                      137   9e-37   
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             137   1e-36   
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    137   1e-36   
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    137   1e-36   
gb|EPS71497.1|  hypothetical protein M569_03263                         137   1e-36   
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    137   1e-36   
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    137   1e-36   
gb|AFK34184.1|  unknown                                                 136   2e-36   
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    137   2e-36   
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        137   2e-36   
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    137   2e-36   
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        137   2e-36   
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    137   3e-36   
ref|NP_181519.1|  protein WLIM2A                                        136   3e-36   
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    135   3e-36   
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    136   3e-36   
emb|CDP08845.1|  unnamed protein product                                136   3e-36   
ref|XP_002879831.1|  LIM domain-containing protein                      136   3e-36   
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    135   4e-36   
gb|AAL38006.1|AF443117_1  LIM domain protein                            135   4e-36   
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    135   4e-36   
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        135   4e-36   
gb|AGJ83942.1|  lim protein 2                                           135   4e-36   
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        136   4e-36   
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          135   5e-36   
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    135   6e-36   
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             135   6e-36   
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    135   7e-36   
emb|CDX72203.1|  BnaC08g26710D                                          135   8e-36   
emb|CDY27267.1|  BnaA09g35350D                                          135   8e-36   
ref|NP_001288583.1|  uncharacterized protein LOC101266456               135   8e-36   
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             135   9e-36   
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        134   1e-35   
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    135   1e-35   
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        135   1e-35   
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    134   1e-35   
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    134   2e-35   
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    134   2e-35   
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    134   2e-35   
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    134   2e-35   
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    134   2e-35   
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    134   3e-35   
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    134   3e-35   
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        134   4e-35   
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        133   4e-35   
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    133   4e-35   
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    133   4e-35   
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        133   4e-35   
gb|EPS58831.1|  hypothetical protein M569_15983                         133   4e-35   
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    133   4e-35   
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    133   5e-35   
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        133   5e-35   
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             133   5e-35   
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    134   5e-35   
emb|CDX76073.1|  BnaA04g03370D                                          134   6e-35   
emb|CDY02959.1|  BnaC04g25270D                                          134   6e-35   
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        133   6e-35   
ref|NP_001132843.1|  uncharacterized LOC100194335                       132   7e-35   
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        132   7e-35   
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        132   8e-35   
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                133   9e-35   
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        132   9e-35   
ref|XP_002882034.1|  LIM domain-containing protein                      133   1e-34   
ref|XP_010089139.1|  Pollen-specific protein SF3                        137   1e-34   
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              132   1e-34   
ref|NP_182104.1|  protein PLIM2A                                        132   1e-34   
ref|NP_001147673.1|  pollen-specific protein SF3                        132   1e-34   
ref|XP_010923153.1|  PREDICTED: LIM domain-containing protein WLI...    130   1e-34   
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          131   2e-34   
ref|XP_002876333.1|  LIM domain-containing protein                      131   2e-34   
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             132   2e-34   
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                132   2e-34   
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          131   2e-34   
emb|CDY56926.1|  BnaAnng14450D                                          132   2e-34   
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        131   3e-34   
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        130   3e-34   
emb|CAA62744.1|  transcription factor L2                                130   3e-34   
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        131   3e-34   
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    130   3e-34   
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    131   3e-34   
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             131   4e-34   
emb|CDY01571.1|  BnaC07g35610D                                          130   4e-34   
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        130   4e-34   
ref|NP_001047550.1|  Os02g0641000                                       130   4e-34   
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        130   4e-34   
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        130   5e-34   
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             130   5e-34   
dbj|BAK06966.1|  predicted protein                                      130   5e-34   
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               130   5e-34   
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    130   6e-34   
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    130   6e-34   
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             130   6e-34   
emb|CDY15152.1|  BnaC05g00310D                                          130   6e-34   
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    130   6e-34   
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        130   7e-34   
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    130   7e-34   
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        130   8e-34   
emb|CDX71757.1|  BnaC08g31170D                                          130   8e-34   
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        130   8e-34   
gb|KHN29376.1|  Pollen-specific protein SF3                             130   9e-34   
ref|XP_001764074.1|  predicted protein                                  130   9e-34   
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    130   1e-33   
ref|NP_171683.1|  LIM family protein                                    129   1e-33   
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             130   1e-33   
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    130   1e-33   
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    129   1e-33   
gb|ACN26203.1|  unknown                                                 129   1e-33   
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        129   1e-33   
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        129   1e-33   
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    129   2e-33   
dbj|BAK04207.1|  predicted protein                                      129   2e-33   
dbj|BAH20111.1|  AT3G55770                                              129   2e-33   
emb|CDY38028.1|  BnaCnng08890D                                          129   2e-33   
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             129   2e-33   
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             129   2e-33   
emb|CDY27358.1|  BnaC04g50470D                                          129   2e-33   
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             129   2e-33   
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        129   2e-33   
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    129   2e-33   
emb|CDY18899.1|  BnaC04g04510D                                          129   2e-33   
gb|EMT25782.1|  Pollen-specific protein SF3                             129   2e-33   
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    130   3e-33   
ref|XP_002892043.1|  LIM domain-containing protein                      128   3e-33   
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    128   3e-33   
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             128   3e-33   
emb|CAB71053.1|  LIM domain protein                                     129   3e-33   
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        129   3e-33   
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    128   5e-33   
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    128   5e-33   
emb|CDY37066.1|  BnaA04g26440D                                          128   5e-33   
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        128   5e-33   
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        128   5e-33   
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    128   6e-33   
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        128   6e-33   
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    128   6e-33   
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             127   7e-33   
gb|EAY79118.1|  hypothetical protein OsI_34224                          128   8e-33   
ref|NP_001064995.1|  Os10g0503100                                       128   8e-33   
ref|XP_004306805.1|  PREDICTED: pollen-specific protein SF3-like        127   8e-33   
ref|NP_001053405.1|  Os04g0532500                                       127   8e-33   
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    127   8e-33   
ref|XP_002320783.2|  LIM domain-containing family protein               127   8e-33   
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    127   9e-33   
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    127   1e-32   
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        127   1e-32   
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    127   1e-32   
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    126   2e-32   
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    127   2e-32   
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        127   2e-32   
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    127   2e-32   
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    126   2e-32   
gb|AII80545.1|  LIM-domain protein 11                                   126   3e-32   
ref|XP_009772727.1|  PREDICTED: pollen-specific protein SF3-like        124   3e-32   
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             126   3e-32   
gb|KHG24101.1|  Pollen-specific SF3                                     126   3e-32   
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             126   3e-32   
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             125   4e-32   
gb|AGJ83944.1|  lim protein 4                                           125   4e-32   
gb|ABK58466.1|  LIM domain protein PLIM2a                               125   4e-32   
gb|KHG24611.1|  Pollen-specific SF3                                     125   4e-32   
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             125   5e-32   
ref|XP_002302574.1|  LIM domain-containing family protein               125   6e-32   
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             125   6e-32   
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        125   7e-32   
ref|XP_003623892.1|  LIM domain protein 2b                              125   7e-32   
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             125   7e-32   
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        125   8e-32   
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              124   1e-31   
ref|NP_001140551.1|  uncharacterized LOC100272616                       124   1e-31   
gb|AAF75284.1|AF116850_1  LIM domain protein PLIM-2                     125   1e-31   
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       124   1e-31   
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    124   1e-31   
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    124   1e-31   
ref|XP_002878372.1|  LIM domain-containing protein                      124   2e-31   
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             124   2e-31   
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        124   2e-31   
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             124   2e-31   
gb|ACU13968.1|  unknown                                                 123   3e-31   
emb|CDP14069.1|  unnamed protein product                                124   3e-31   
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         123   3e-31   
ref|XP_003558280.1|  PREDICTED: LIM domain-containing protein WLI...    122   3e-31   
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   122   4e-31   
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    123   4e-31   
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    123   4e-31   
ref|XP_003521910.2|  PREDICTED: pollen-specific protein SF3-like        123   4e-31   
ref|XP_009400630.1|  PREDICTED: pollen-specific protein SF3-like        122   4e-31   
gb|AFK33321.1|  unknown                                                 122   5e-31   
ref|XP_010107618.1|  Pollen-specific protein SF3                        123   5e-31   
tpg|DAA44554.1|  TPA: putative LIM-type zinc finger domain family...    120   5e-31   
gb|KDO36535.1|  hypothetical protein CISIN_1g034188mg                   119   5e-31   
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        123   5e-31   
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        122   6e-31   
ref|XP_004510816.1|  PREDICTED: pollen-specific protein SF3-like        122   9e-31   
ref|XP_010054850.1|  PREDICTED: pollen-specific protein SF3-like        122   1e-30   
gb|KDP28657.1|  hypothetical protein JCGZ_14428                         122   1e-30   
emb|CDX86962.1|  BnaC03g52320D                                          119   1e-30   
gb|EMS55690.1|  Pollen-specific protein SF3                             125   2e-30   
gb|KCW77560.1|  hypothetical protein EUGRSUZ_D01873                     121   2e-30   
gb|KDO39245.1|  hypothetical protein CISIN_1g040725mg                   120   2e-30   
ref|XP_006438563.1|  hypothetical protein CICLE_v10033840mg             120   2e-30   
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        121   2e-30   
ref|XP_011029229.1|  PREDICTED: LIM domain-containing protein WLI...    121   2e-30   
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    122   2e-30   
gb|KEH21040.1|  GATA type zinc finger transcription factor family...    120   3e-30   
gb|EMT19855.1|  Pollen-specific protein SF3                             120   5e-30   
gb|KHG08337.1|  Pollen-specific SF3                                     120   6e-30   



>ref|XP_009766668.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56950.1|AF184885_1 LIM domain protein PLIM1 [Nicotiana tabacum]
Length=191

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC+AC+KTVYLVDRLAADNRI+HKACFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK +D E   +G+K+SS+F GT  KCVGCTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEKPVDNEN-GSGSKVSSLFAGTREKCVGCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGTAYHKACF
Sbjct  120  IEKVSVNGTAYHKACF  135


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT +KC  C KTVY +++++ +   +HKACF+C H   T+  SN+ + EG
Sbjct  95   SGSKVSSLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QLFK  G+  +
Sbjct  155  RLYCKHHHIQLFKEKGNYSQ  174



>gb|AAF13231.1| pollen specific LIM domain protein 1a [Nicotiana tabacum]
Length=191

 Score =   211 bits (536),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC+AC+KTVYLVDRLAADNRI+HKACFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK +D E   +G K+SS+F GT  KCVGCTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEKPVDNEN-GSGTKVSSLFAGTREKCVGCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGTAYHKACF
Sbjct  120  IEKVSVNGTAYHKACF  135


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C KTVY +++++ +   +HKACF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_009606069.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF13232.1| pollen specific LIM domain protein 1b [Nicotiana tabacum]
Length=181

 Score =   209 bits (533),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC+AC+KTVYLVDRLAADNRI+HKACFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSFDGTPK TK EK+++ E   +G+K+SS+F GT  KCVGCTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFDGTPKVTKPEKSVENEN-GSGSKVSSLFAGTREKCVGCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGTAYHK CF
Sbjct  120  IEKVSVNGTAYHKGCF  135


 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT +KC  C KTVY +++++ +   +HK CF+C H   T+  SN+ + EG
Sbjct  95   SGSKVSSLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKGCFKCSHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QLFK  G+  +
Sbjct  155  RLYCKHHHIQLFKEKGNYSQ  174



>dbj|BAO02514.1| predicted LIM domain-containing protein ortholog [Nicotiana alata]
Length=189

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC+AC+KTVYLVDRLAADNRI+HKACFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK +D E   +G+K+S++F GT  KCVGCTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVTKPEKPVDNEN-GSGSKVSNLFAGTREKCVGCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGTAYHKACF
Sbjct  120  IEKVSVNGTAYHKACF  135


 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT +KC  C KTVY +++++ +   +HKACF+C H   T+  SN+ + EG
Sbjct  95   SGSKVSNLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QLFK  G+  +
Sbjct  155  RLYCKHHHIQLFKEKGNYSQ  174



>gb|AAD02543.1| PGPS/D1 [Petunia x hybrida]
Length=195

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC+ACDKTVYLVDRLAADNR++HKACFRCYHCK TLKLSNFNSFEGV+YCR 
Sbjct  1    MTFAGTTQKCSACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFEGVIYCRH  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK +D E   +GNK+SS+F GT  KCVGC+KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKFTKPEKPVDNEN-GSGNKVSSLFGGTRDKCVGCSKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNG AYHKACF
Sbjct  120  IEKVSVNGAAYHKACF  135


 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY +++++ +   +HKACF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCVGCSKTVYPIEKVSVNGAAYHKACFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_004250748.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=193

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVDRLAADNR++HKACFRCYHCK TLKLSNFNSF+GV+YCRP
Sbjct  1    MTFAGTTQKCNACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFDGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK +D E     NK+SS+F GT  KCV CTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKITKPEKTVDNEN-GTSNKVSSLFAGTREKCVCCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV VNG AYHKACF
Sbjct  120  IEKVTVNGAAYHKACF  135


 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  417  SNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            SN + S FAGT +KC  C KTVY ++++  +   +HKACF+C H   T+  SN+ + EG 
Sbjct  96   SNKVSSLFAGTREKCVCCTKTVYPIEKVTVNGAAYHKACFKCSHGGCTISPSNYIAHEGT  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QLFK  G+  +
Sbjct  156  LYCKHHHIQLFKEKGNYSQ  174



>ref|XP_006352087.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=193

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVDRLAADNRI+HKACFRCYHCK TLKLSNFNSFEGV+YCRP
Sbjct  1    MTFAGTTQKCNACDKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK TK EK++D E    G K+SS+F GT  KCV CTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKITKPEKSVDNEN-GTGAKVSSLFAGTREKCVCCTKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV VNG AYHK CF
Sbjct  120  IEKVTVNGAAYHKTCF  135


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C KTVY ++++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCVCCTKTVYPIEKVTVNGAAYHKTCFKCTHGGCTISPSNYIAHEGTLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_002285355.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CAN72849.1| hypothetical protein VITISV_013939 [Vitis vinifera]
 emb|CBI19396.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   205 bits (522),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ID+EK  A NK+SSMF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPIDSEKPIA-NKVSSMFAGTRDKCVGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGTAYHK+CF
Sbjct  120  TEKVTVNGTAYHKSCF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 1/101 (1%)
 Frame = -2

Query  420  LSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            ++N + S FAGT  KC  C  TVY  +++  +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   IANKVSSMFAGTRDKCVGCKNTVYPTEKVTVNGTAYHKSCFKCTHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             LYC+ H+ QL K  G+L +      K    + ++  ++AA
Sbjct  155  RLYCKHHHTQLIKEKGNLSQLEGDHEKDTANEKVNGREVAA  195



>gb|AAD39103.1|AF116849_1 LIM domain protein WLIM-1 [Helianthus annuus]
Length=188

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K  K ID EK  A NK+SSMFVGT  KC+GC  TVYP
Sbjct  61   HFDQLFKKTGSLDKSFEGTPKIVKQPKTIDGEKPMA-NKVSSMFVGTKDKCLGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGTAYHK+CF
Sbjct  120  TEKVSVNGTAYHKSCF  135


 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = -2

Query  447  IVRSPLHLS----LSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCK  283
            IV+ P  +     ++N + S F GT  KC  C  TVY  ++++ +   +HK+CF+C H  
Sbjct  82   IVKQPKTIDGEKPMANKVSSMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGG  141

Query  282  GTLKLSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             T+  SN+ + EG LYCR H+ QL K  G+L +
Sbjct  142  CTISPSNYIAHEGHLYCRHHHTQLIKEKGNLSQ  174



>gb|AFK47041.1| unknown [Lotus japonicus]
Length=195

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ ID EK AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVAKPERNIDNEKPAAA-KVSSMFGGTRDKCAGCQKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K   +  I+ +++AA
Sbjct  163  IQLIKEKGNLSQLEGDHEKNVVQGEINGDEVAA  195



>gb|AFK42495.1| unknown [Lotus japonicus]
Length=195

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ ID EK AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVAKPERNIDNEKPAAA-KVSSMFGGTRDKCAGCQKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K   +  I+ +K+AA
Sbjct  163  IQLIKEKGNLSQLEGDHEKNVVQGEINGDKVAA  195



>emb|CDP01275.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 122/136 (90%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK +D EK  A NK+SSMFVGT  KCVGC+KTVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPVDFEKPLA-NKVSSMFVGTRDKCVGCSKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGTAYHK+CF
Sbjct  120  TEKVSVNGTAYHKSCF  135


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = -2

Query  420  LSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            L+N + S F GT  KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG
Sbjct  95   LANKVSSMFVGTRDKCVGCSKTVYPTEKVSVNGTAYHKSCFKCTHGGCVISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QL K  G+L +
Sbjct  155  RLYCKHHHIQLIKEKGNLSQ  174



>gb|AAD56959.1|AF187105_1 LIM domain protein WLIM1 [Helianthus annuus]
Length=188

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTP   K  K ID EK  A NK+SSMFVGT  KC+GC  TVYP
Sbjct  61   HFDQLFKKTGSLDKSFEGTPNIVKQPKTIDGEKPMA-NKVSSMFVGTKDKCLGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGTAYHK+CF
Sbjct  120  TEKVSVNGTAYHKSCF  135


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = -2

Query  447  IVRSPLHLS----LSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCK  283
            IV+ P  +     ++N + S F GT  KC  C  TVY  ++++ +   +HK+CF+C H  
Sbjct  82   IVKQPKTIDGEKPMANKVSSMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGG  141

Query  282  GTLKLSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             T+  SN+ + EG LYCR H+ QL K  G+L +
Sbjct  142  CTISPSNYIAHEGHLYCRHHHTQLIKEKGNLSQ  174



>ref|XP_002266499.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI22440.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   201 bits (512),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVDRL ADNRI+HKACFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDRLTADNRIYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D  + AA NK+S+MFVGT  KCVGC KT YP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKTTDHSENAATNKVSNMFVGTKDKCVGCNKTAYP  120

Query  48   IEKVAVNGTAYHKACF  1
            +EKV VNGT YHK+CF
Sbjct  121  LEKVTVNGTPYHKSCF  136


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C+KT Y ++++  +   +HK+CF+C +   T+  SN+ + EG LYC+ H+
Sbjct  104  FVGTKDKCVGCNKTAYPLEKVTVNGTPYHKSCFKCTYGGCTISPSNYIAHEGKLYCKHHH  163

Query  219  DQLFKRTGSLDK  184
             QLFK  G+  +
Sbjct  164  IQLFKEKGNYSQ  175



>ref|XP_011074349.1| PREDICTED: LIM domain-containing protein WLIM1 [Sesamum indicum]
Length=193

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D EK  A NK+SSMF GT  KC+ C  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKPADIEKPLA-NKVSSMFAGTREKCLACKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = -2

Query  420  LSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            L+N + S FAGT +KC AC  TVY  ++++ +   +HK+CF+C H    +  SN+ + EG
Sbjct  95   LANKVSSMFAGTREKCLACKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QL K  G+L +
Sbjct  155  RLYCKHHHIQLIKEKGNLSQ  174



>ref|XP_002510088.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52275.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=197

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  KT+K  D EK  A  K+SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKTDKPADGEKPNAA-KVSSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            +QL K  G+L +      K  T +  +  ++AA
Sbjct  163  NQLIKEKGNLSQLEGDVEKESTTQNANGREVAA  195



>ref|XP_010544006.1| PREDICTED: LIM domain-containing protein WLIM1 [Tarenaya hassleriana]
Length=186

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACD+TVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSL+KSF+GTPK    +  D E+ AA NK+SSMF GT  KCVGC KTVYPI
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIGKPEKPDGERPAA-NKVSSMFAGTREKCVGCDKTVYPI  119

Query  45   EKVAVNGTAYHKACF  1
            EKV+VNGT YHK+CF
Sbjct  120  EKVSVNGTLYHKSCF  134


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 8/93 (9%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYVAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +  +G   TK       EK+AA
Sbjct  162  IQLIKEKGNLSQ-LEGDTATK-------EKMAA  186



>ref|XP_004290976.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=191

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRIFHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ ID+EK AA +K S MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAA-SKASGMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK CF
Sbjct  120  TEKVTVNGTPYHKMCF  135


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAE  133
             QL +  G+L +  +G    +   A+ AE
Sbjct  163  TQLIREKGNLSQ-LEGGGDNEKATAVAAE  190



>gb|ABK93551.1| unknown [Populus trichocarpa]
 gb|ACN97187.1| LIM transcription factor [Populus trichocarpa]
Length=197

 Score =   200 bits (509),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVDRLAADNR++HKACFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKILKPEKPVDGEKPIS-TKVSTMFAGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT+YHK+CF
Sbjct  120  TEKVSVNGTSYHKSCF  135


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTRDKCFGCKNTVYPTEKVSVNGTSYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
            +QL K  G+L +
Sbjct  163  NQLIKEKGNLSQ  174



>ref|XP_002302405.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
 ref|XP_011017108.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
 gb|ABK58468.1| LIM domain protein WLIM1b [Populus tremula x Populus alba]
 gb|EEE81678.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
Length=197

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVDRLAADNR++HKACFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPIS-TKVSTMFAGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTRDKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
            +QL K  G+L +
Sbjct  163  NQLIKEKGNLSQ  174



>ref|XP_011092491.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=194

 Score =   199 bits (507),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 119/136 (88%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGT QKCTAC+ TVYLVD+LAADNRI+HKACFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTNQKCTACNGTVYLVDKLAADNRIYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++ E     +K+SSMF GT  KCVGC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEKPLENEN---ASKVSSMFGGTKDKCVGCNKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGTAYHKACF
Sbjct  118  IEKVSVNGTAYHKACF  133


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F GT  KC  C+KTVY +++++ +   +HKACF+C H   T+  SN+ + EGVL
Sbjct  95   SKVSSMFGGTKDKCVGCNKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGVL  154

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H+ QL K  G+  +
Sbjct  155  YCKHHHIQLVKAKGNYSQ  172



>ref|XP_008444540.1| PREDICTED: pollen-specific protein SF3 [Cucumis melo]
Length=198

 Score =   199 bits (507),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ+FKRTGSLDKSF+GTPK  K EK ID+EK  A NK++SMF GT  KC+GC  TVYP
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKPEKPIDSEKPTA-NKVASMFGGTRDKCLGCDNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNG  YHK+CF
Sbjct  120  TEKVTVNGIPYHKSCF  135


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            + + +   F GT  KC  CD TVY  +++  +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   TANKVASMFGGTRDKCLGCDNTVYPTEKVTVNGIPYHKSCFKCCHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISS  103
             LYC+ H+ QL K  G+L +  +G      EK    EK+  G  ++S
Sbjct  155  RLYCKHHHIQLIKEKGNLSQ-LEG----DHEKITAKEKINGGEVVAS  196



>ref|XP_010094354.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB55842.1| Pollen-specific protein SF3 [Morus notabilis]
Length=198

 Score =   199 bits (507),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D++K A   K++SMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKAEKPLDSDKPAVA-KVTSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            +++ +   F GT  KC  C  TVY  +++  +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   AVAKVTSMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK-SFDGTPKTKTEKAIDAEKLAA  121
             LYC+ H+ QL K  G+L +   D      +E    A ++AA
Sbjct  155  RLYCKHHHIQLIKEKGNLSQLEGDHVKDAASENVTVATEVAA  196



>dbj|BAM05591.1| LIM transcription factor [Eucalyptus pyrocarpa]
 dbj|BAM05592.1| LIM transcription factor [Eucalyptus globulus subsp. globulus]
Length=188

 Score =   199 bits (506),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK ID E+ AA  K+SSMF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPIDGERPAA-TKVSSMFGGTRDKCVGCKSTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG LYCR H+
Sbjct  103  FGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>gb|EYU39077.1| hypothetical protein MIMGU_mgv1a014557mg [Erythranthe guttata]
Length=186

 Score =   199 bits (505),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKCTAC  TVYLVDRLAADNRIFHKACFRC+HCK TLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACSGTVYLVDRLAADNRIFHKACFRCHHCKSTLKLGNFNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++ E     +K+SSMF GT  KCVGCTKTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKTVENEN---ASKVSSMFGGTRDKCVGCTKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNG AYHK+CF
Sbjct  118  IEKVSVNGAAYHKSCF  133


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F GT  KC  C KTVY +++++ +   +HK+CF+C H   T+  SN+ + EG L
Sbjct  95   SKVSSMFGGTRDKCVGCTKTVYPIEKVSVNGAAYHKSCFKCSHGGCTISPSNYIAHEGTL  154

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H+ QLFK  G+  +
Sbjct  155  YCKHHHIQLFKSKGNYSQ  172



>ref|XP_003589058.1| Transcription factor lim1 [Medicago truncatula]
 gb|ACJ84036.1| unknown [Medicago truncatula]
 gb|AES59309.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK36922.1| unknown [Medicago truncatula]
Length=195

 Score =   199 bits (506),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRIFHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACNKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K E+ ID EK AA  K SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPERNIDNEKPAAA-KASSMFGGTRDKCSGCQKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC+ C KTVY  +++  +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K+ G+L +  +G  +    K I+ E++AA
Sbjct  163  IQLIKQKGNLSQ-LEGDHEKNAGK-INGEEVAA  193



>ref|XP_010548517.1| PREDICTED: LIM domain-containing protein WLIM1-like [Tarenaya 
hassleriana]
Length=186

 Score =   199 bits (505),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACD+TVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSL+KSF+GTPK    +  D E+ A  NK+SSMF GT  KCVGC KTVYPI
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPEKPDGERPAT-NKVSSMFAGTREKCVGCDKTVYPI  119

Query  45   EKVAVNGTAYHKACF  1
            EKV+VNGT YHK+CF
Sbjct  120  EKVSVNGTLYHKSCF  134


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKA  145
             QL K  G+L +  +G   TK   A
Sbjct  162  VQLIKEKGNLSQ-LEGDNSTKENTA  185



>ref|XP_008220373.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ +D+EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPERPVDSEKPAVA-KASSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK CF
Sbjct  120  TEKVTVNGTPYHKMCF  135


 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K   ++   A ++AA
Sbjct  163  TQLIKEKGNLSQLEGDYEKNTVDENASAREVAA  195



>ref|XP_007160919.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 ref|XP_007160920.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32913.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32914.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
Length=196

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++ +  AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTLEEKPGAA--KVSSMFGGTREKCAGCQKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  119  TEKVTVNGTPYHKSCF  134


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+++   I+ E+++A
Sbjct  162  IQLIKEKGNLSQLEGDHEKSESNGKINGEEVSA  194



>ref|XP_008347599.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ID EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPIDNEKPAVA-KASSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK CF
Sbjct  120  TEKVSVNGTPYHKMCF  135


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  ++++ +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLA  124
             QL K  G+L +      +   ++ + A ++A
Sbjct  163  TQLIKEKGNLSQLEGDHERIAEDENVGAREVA  194



>ref|NP_001238580.1| uncharacterized protein LOC100499957 [Glycine max]
 gb|ACU14335.1| unknown [Glycine max]
 gb|KHN45139.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+GTPK    +    EK AA  K+SSMF GT  KC GC KTVYP 
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAA-TKVSSMFGGTRDKCAGCQKTVYPT  119

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK+CF
Sbjct  120  EKVTVNGTPYHKSCF  134


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+  ++ I+ E +AA
Sbjct  162  VQLIKEKGNLSQLEGDHEKSAEQEKINGEVVAA  194



>gb|KHN04435.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+GTPK    +    EK AA  K+SSMF GT  KC GC KTVYP 
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKHAA-TKVSSMFGGTRDKCAGCQKTVYPT  119

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK+CF
Sbjct  120  EKVTVNGTPYHKSCF  134


 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+  E+ I+ E +AA
Sbjct  162  IQLIKEKGNLSQLEGDHEKSTEEEKINGEVVAA  194



>ref|NP_001235758.1| uncharacterized protein LOC100305720 [Glycine max]
 gb|ACU13553.1| unknown [Glycine max]
Length=196

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+GTPK    +    EK AA  K+SSMF GT  KC GC KTVYP 
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAA-TKVSSMFGGTRDKCAGCQKTVYPT  119

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK+CF
Sbjct  120  EKVTVNGTPYHKSCF  134


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+  E+ I+ E +AA
Sbjct  162  IQLIKEKGNLSQLEGDHEKSTEEEKINGEVVAA  194



>ref|XP_007225874.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
 gb|EMJ27073.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
Length=197

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ +D EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVA-KASSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK CF
Sbjct  120  TEKVTVNGTPYHKMCF  135


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +    + K   ++   A ++AA
Sbjct  163  TQLIKEKGNLSQLEGDSEKNTVDENASAREVAA  195



>ref|XP_009360821.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=195

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ +D EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVA-KASSMFGGTREKCFGCRNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK CF
Sbjct  120  TEKVSVNGTPYHKMCF  135


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>ref|XP_004141291.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004163244.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN55277.1| hypothetical protein Csa_4G643070 [Cucumis sativus]
Length=179

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D+EK  A  K++SMFVGT  KC+GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIGKPEKPGDSEKPTA-TKVASMFVGTKDKCLGCNKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT+YHK+CF
Sbjct  120  TEKVSVNGTSYHKSCF  135


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            + + +   F GT  KC  C+KTVY  ++++ +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   TATKVASMFVGTKDKCLGCNKTVYPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QL K  G+L +
Sbjct  155  RLYCKHHHTQLIKEKGNLSQ  174



>ref|XP_006595535.1| PREDICTED: uncharacterized protein LOC100527547 isoform X1 [Glycine 
max]
 ref|XP_006595536.1| PREDICTED: uncharacterized protein LOC100527547 isoform X2 [Glycine 
max]
 gb|KHN07659.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++ +  AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAA--KVSSMFGGTREKCAGCQKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  119  TEKVTVNGTPYHKSCF  134


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+ T   I+ E+++A
Sbjct  162  VQLIKEKGNLTQLEGDNEKSATNGKINGEEVSA  194



>ref|XP_008393720.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008351969.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=195

 Score =   197 bits (502),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K E+ +D EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVA-KASSMFGGTREKCFGCRNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK CF
Sbjct  120  TEKVSVNGTPYHKMCF  135


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>ref|XP_008452649.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=179

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HC GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D+EK  A  K++SMF+GT  KC+GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIGKPEKPGDSEKPTA-TKVASMFIGTKDKCLGCNKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT+YHK+CF
Sbjct  120  TEKVSVNGTSYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            + + +   F GT  KC  C+KTVY  ++++ +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   TATKVASMFIGTKDKCLGCNKTVYPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QL K  G+L +
Sbjct  155  RLYCKHHHTQLIKEKGNLSQ  174



>ref|XP_010061652.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 dbj|BAD91878.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91879.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91880.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAD91881.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAM05590.1| LIM transcription factor [Eucalyptus pilularis]
 gb|KCW68639.1| hypothetical protein EUGRSUZ_F02243 [Eucalyptus grandis]
Length=188

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK +D E+ AA  K SSMF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPVDGERPAA-TKASSMFGGTRDKCVGCKSTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG LYCR H+
Sbjct  103  FGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>ref|XP_004142897.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004156385.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN62442.1| hypothetical protein Csa_2G354680 [Cucumis sativus]
Length=198

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ+FKRTGSLDKSF+GTPK  K EK ID+E+  A NK++S F GT  KC+GC  TVYP
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKPEKPIDSERPTA-NKVASKFGGTRDKCLGCDNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            + + +   F GT  KC  CD TVY  +++  +   +HK+CF+C H   T+  SN+ + EG
Sbjct  95   TANKVASKFGGTRDKCLGCDNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISS  103
             LYC+ H+ QL K  G+L +  +G      EK    EK+  G  ++S
Sbjct  155  RLYCKHHHIQLIKEKGNLSQ-LEG----DHEKITAKEKINGGEVVAS  196



>dbj|BAM05589.1| LIM transcription factor [Eucalyptus pilularis]
Length=188

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK +D E+ AA  K SSMF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPVDGERPAA-TKASSMFGGTRDKCVGCKSTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG LYCR H 
Sbjct  103  FGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRHHX  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>ref|XP_010938994.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GT  KCTAC KTVYLVD+L ADNRI+HKACFRC+HC+GTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCQGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK AA N++SS F GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEKPVDTEKTAA-NRVSSQFAGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGTAYHK+CF
Sbjct  120  IERVTVNGTAYHKSCF  135


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +   FAGT +KC  C KTVY ++R+  +   +HK+CF+C H    +  SN+ + EG LYC
Sbjct  99   VSSQFAGTREKCFGCKKTVYPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            + H+ QLFK  G+  +      K + E    AE+L +
Sbjct  159  KHHHIQLFKEKGNYSQLETDQEKMENEAPTSAEELES  195



>gb|KHN36972.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++ +  AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAA--KVSSMFGGTRDKCAGCQKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  119  TEKVTVNGTPYHKSCF  134


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLA  124
             QL K  G+L +      K+ T   I+ E++A
Sbjct  162  VQLIKEKGNLSQLEGDNEKSATNGKINGEEVA  193



>dbj|BAB84581.1| transcription factor LIM [Populus kitakamiensis]
Length=197

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR +HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVS-TKVSTMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            +QL K  G+L +      K       +  ++AA
Sbjct  163  NQLIKEKGNLSQLEGDIEKDSMSNKTNGREVAA  195



>ref|XP_004501516.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=191

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC +CDKTVYLVD+L ADNRI+HK CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMSCDKTVYLVDKLTADNRIYHKGCFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK+   EK AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKSSYNEKPAAA-KVSSMFGGTREKCSGCQKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC+ C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FGGTREKCSGCQKTVYPTEKVSVNGTPYHKSCFKCIHGGCVISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  VQLIKEKGNLSQ  174



>ref|XP_002320687.1| transcription factor LIM family protein [Populus trichocarpa]
 dbj|BAB84582.1| transcription factor LIM [Populus kitakamiensis]
 gb|EEE99002.1| transcription factor LIM family protein [Populus trichocarpa]
 gb|ACN97188.1| LIM transcription factor [Populus trichocarpa]
 gb|ACT64134.1| transcription factor Lim1 [Populus deltoides]
 gb|ACT64135.1| transcription factor Lim1 [Populus deltoides]
Length=197

 Score =   197 bits (501),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR +HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVS-TKVSTMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            +QL K  G+L +      K       +  ++AA
Sbjct  163  NQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAA  195



>ref|XP_009375152.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=197

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HC+GTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K +K ID EK A   K SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPDKPIDNEKSAVA-KASSMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK CF
Sbjct  120  TEKVSVNGTPYHKMCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  ++++ +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K   ++ + A ++AA
Sbjct  163  TQLIKEKGNLSQLEGDHEKIAEDEKVGAREVAA  195



>ref|XP_009623970.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AFY06680.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K +K ID+EK     K++SMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QL K  G+L K
Sbjct  156  LYCKHHHIQLIKEKGNLSK  174



>ref|XP_010999890.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=197

 Score =   197 bits (500),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR +HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPMS-TKVSTMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 59/105 (56%), Gaps = 3/105 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P+   +S +   FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ 
Sbjct  94   PMSTKVSTM---FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            + EG LYC+PH++QL K  G+L +      K       +  ++AA
Sbjct  151  AHEGRLYCKPHHNQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAA  195



>gb|AGE09584.1| LIM1-like protein [Eucalyptus cladocalyx]
Length=188

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNFNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+G PK  K EK +D E+ AA  K+S MF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGNPKIAKPEKPVDGERPAA-TKVSGMFGGTRDKCVGCKSTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG LYCR H+
Sbjct  103  FGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  TQLIKEKGNLSQ  174



>ref|XP_007018479.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOY15704.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=193

 Score =   196 bits (499),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++H+ACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHEACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  DAEK AA  K S MF GT  KCVGC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKQADAEKPAA-TKASGMFAGTRDKCVGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             E+V VNGT YHK+CF
Sbjct  120  TERVTVNGTPYHKSCF  135


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C  TVY  +R+  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FAGTRDKCVGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  163  GQLIKEKGNLSQ  174



>ref|NP_001238429.1| uncharacterized protein LOC100499947 [Glycine max]
 gb|ACU14298.1| unknown [Glycine max]
Length=196

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK ++    AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKNLEERPAAA--KVSSMFGGTRDKCAGCQKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  119  TEKVTVNGTPYHKSCF  134


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLA  124
             QL K  G+L +      K+ T   I+ E++A
Sbjct  162  VQLIKEKGNLSQLEGDNEKSATNGKINGEEVA  193



>gb|KDP41612.1| hypothetical protein JCGZ_16019 [Jatropha curcas]
Length=197

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K +K  D EK +A  K+SSMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIVKPDKPADGEKPSAA-KVSSMFGGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S + +   F GT +KC  C  TVY  +++  +   +HK+CF+C H    +  SN+ + EG
Sbjct  95   SAAKVSSMFGGTREKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDK-SFDGTPKTKTEKAIDAEKLA  124
             LYC+ H++QL K  G+L +   D    +  EKA   E  A
Sbjct  155  RLYCKHHHNQLIKEKGNLSQLEGDNEKDSVNEKANGREAAA  195



>emb|CDY20647.1| BnaC08g14110D [Brassica napus]
Length=189

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K +K ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDKPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK--SFDGTPKTKTEKA  145
            + EG LYC+ H+ QL K  G+L +    D   K K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGDNAAKDKVDAA  189



>ref|XP_009765343.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=193

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K  K ID+EK     K++SMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPHKPIDSEKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QL K  G+L K
Sbjct  156  LYCKHHHIQLIKEKGNLSK  174



>ref|XP_008811666.1| PREDICTED: pollen-specific protein SF3 [Phoenix dactylifera]
Length=195

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GT  KCTAC KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  A N++SS F GT  KCVGC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEKPVDTEKPTA-NRVSSSFAGTREKCVGCMKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGTAYHK+CF
Sbjct  120  IERVTVNGTAYHKSCF  135


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SFAGT +KC  C KTVY ++R+  +   +HK+CF+C H    +  SN+ + EG LYC
Sbjct  99   VSSSFAGTREKCVGCMKTVYPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            + H+ QLFK  G+  +      K   E    A +L +
Sbjct  159  KHHHIQLFKEKGNYSQLETDQDKMGNEAPASAGELVS  195



>ref|XP_010028358.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
Length=195

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKCTAC+KTVYLVD+L A++R++HKACFRC+HC GTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQ+FKRTGSLDKSF+GTPK     A D E  A  N++S+ F GT  KC  C KT YPI
Sbjct  61   HFDQIFKRTGSLDKSFEGTPKIVKPGATDNENAATANRVSAFFAGTRDKCASCNKTAYPI  120

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK CF
Sbjct  121  EKVTVNGTGYHKRCF  135


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC +C+KT Y ++++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTRDKCASCNKTAYPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSL------DKSFDGTPKTKTE  151
             QLFK  G+       +K F+ T  T  E
Sbjct  163  TQLFKEKGNYSQLDTSNKQFEATKVTAVE  191



>ref|XP_006433641.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 ref|XP_006472306.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR46881.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 gb|KDO37193.1| hypothetical protein CISIN_1g029070mg [Citrus sinensis]
Length=199

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT QKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYC
Sbjct  1    MAAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K EK ID EK     K+S+MF GT  KCVGC  TV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKIAKPEKPIDGEKPNVA-KVSTMFGGTREKCVGCKNTV  119

Query  54   YPIEKVAVNGTAYHKACF  1
            YP EKV+VNGT YHK+CF
Sbjct  120  YPTEKVSVNGTPYHKSCF  137


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            +++ +   F GT +KC  C  TVY  ++++ +   +HK+CF+C H    +  SN+ + EG
Sbjct  97   NVAKVSTMFGGTREKCVGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEG  156

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H++QL K  G+L +
Sbjct  157  RLYCKHHHNQLIKEKGNLSQ  176



>gb|ABK58467.1| LIM domain protein WLIM1a [Populus tremula x Populus alba]
Length=197

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR +HKACFRC+HCKG LKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGALKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D EK  +  K+S+MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVS-TKVSTMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            +QL K  G+L +      K       +  ++AA
Sbjct  163  NQLIKEKGNLSQLEGDIEKDSMNNKTNGREVAA  195



>dbj|BAB84584.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+  ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKFTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K +K ID+EK     K++SMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QL K  G+L K
Sbjct  156  LYCKHHHIQLIKEKGNLSK  174



>gb|AFV60741.1| LIM domain protein LIM-2 [Gossypium hirsutum]
Length=190

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK +D EK  A  K+S MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPVDGEKPIA-TKVSGMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             E+V VNGT YHK+CF
Sbjct  120  TERVTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 8/94 (9%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P+   +S +   F GT  KC  C  TVY  +R+  +   +HK+CF+C H    +  SN+ 
Sbjct  94   PIATKVSGM---FGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSL-----DKSFDGT  169
            + EG LYC+ H+ QL K  G+L     D+  DGT
Sbjct  151  AHEGRLYCKHHHGQLIKEKGNLSQLEGDREKDGT  184



>ref|XP_006857164.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
 gb|ERN18631.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
Length=193

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR FHKACFRC+HCKGTLKLSN+ SFEGVLYCRP
Sbjct  1    MAFAGTTQKCHACEKTVYLVDKLTADNRSFHKACFRCHHCKGTLKLSNYCSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            HYDQLFKRTGSLDKSF+GTPK  K EK ID+E    G ++S +F GT  KCVGC KTVYP
Sbjct  61   HYDQLFKRTGSLDKSFEGTPKIAKPEKPIDSE--GQGARVSGLFAGTRDKCVGCKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+G+AYHK+CF
Sbjct  119  IEKVAVDGSAYHKSCF  134


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C KTVY ++++A D   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FAGTRDKCVGCKKTVYPIEKVAVDGSAYHKSCFKCCHGGCVISPSNYIAHEGRLYCKHHH  161

Query  219  DQLFKRTGS---LDKSFDGTPKTKTEKAI  142
             QLFK  G+   LDKS  G  K  TE  I
Sbjct  162  SQLFKEKGNYSQLDKS--GNEKGVTEDTI  188



>ref|XP_004238086.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=193

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K +K ID+EK     K++SMF GT  KC GC  TVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQKLIDSEKPQVA-KVTSMFGGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK CF
Sbjct  120  TEKVSVNGTPYHKNCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = -2

Query  459  QFLIIVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKG  280
            Q LI    P    ++ +   F GT +KC  C  TVY  ++++ +   +HK CF+C H   
Sbjct  86   QKLIDSEKP---QVAKVTSMFGGTREKCFGCKNTVYPTEKVSVNGTPYHKNCFKCSHGGC  142

Query  279  TLKLSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             + LSN+ + EG LYC+ H+ QL K  G+L K
Sbjct  143  VISLSNYIAHEGRLYCKHHHIQLIKEKGNLSK  174



>ref|NP_172491.1| transcription factor lim1 [Arabidopsis thaliana]
 sp|Q94JX5.1|WLIM1_ARATH RecName: Full=LIM domain-containing protein WLIM1; AltName: Full=Widely-expressed 
LIM protein 1; Short=AtWLIM1 [Arabidopsis 
thaliana]
 gb|AAK49575.1|AF370569_1 similar to transcription factor SF3 (pir|IS37656) [Arabidopsis 
thaliana]
 gb|AAM62606.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE28552.1| transcription factor lim1 [Arabidopsis thaliana]
Length=190

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      +K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGGENAAKDKVVAA  190



>ref|XP_006342667.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=187

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 5/136 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR+FHKACFRCYHCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D +  AA  K+SSMFVGT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK--DEKPQAA--KVSSMFVGTREKCFGCKNTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  117  TEKVSVNGTPYHKSCF  132


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  100  FVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHH  159

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  160  VQLIKEKGNLSQ  171



>gb|EYU25518.1| hypothetical protein MIMGU_mgv1a014425mg [Erythranthe guttata]
Length=190

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD L ADNRIFHKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDMLTADNRIFHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K +K  + EK  A NK+S+MF GT  KC+ C  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPDKPANIEKPNA-NKVSNMFAGTRDKCLACKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT+YHK CF
Sbjct  120  TEKVSVNGTSYHKNCF  135


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = -2

Query  444  VRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLS  265
            +  P    +SN+   FAGT  KC AC  TVY  ++++ +   +HK CF+C H    +  S
Sbjct  91   IEKPNANKVSNM---FAGTRDKCLACKNTVYPTEKVSVNGTSYHKNCFKCSHGGCVISPS  147

Query  264  NFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            N+ + EG LYC+ H+ QL K  G+L +
Sbjct  148  NYIAHEGRLYCKHHHIQLIKEKGNLSQ  174



>ref|XP_006304225.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
 gb|EOA37123.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
Length=190

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      EK + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGGDNATKEKVVAA  190



>ref|XP_010490782.1| PREDICTED: LIM domain-containing protein WLIM1 [Camelina sativa]
Length=190

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      EK + A
Sbjct  151  AHEGKLYCKHHHLQLIKEKGNLSQLEGGGDNAAKEKVVAA  190



>ref|XP_010458355.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK  184
            + EG LYC+ H+ QL K  G+L +
Sbjct  151  AHEGKLYCKHHHLQLIKEKGNLSQ  174



>ref|XP_009144466.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDY31040.1| BnaA08g25900D [Brassica napus]
Length=189

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK--SFDGTPKTKTEKA  145
            + EG LYC+ H+ QL K  G+L +    D   K K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGDNAAKDKVDAA  189



>gb|KFK43312.1| hypothetical protein AALP_AA1G108000 [Arabis alpina]
Length=186

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KC GC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCHGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 59/97 (61%), Gaps = 4/97 (4%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCHGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKA  145
            + EG LYC+ H+ QL K  G+L +  +G  K K   A
Sbjct  151  AHEGKLYCKHHHLQLIKEKGNLSQ-LEGGDKDKVVAA  186



>ref|XP_010475882.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK  184
            + EG LYC+ H+ QL K  G+L +
Sbjct  151  AHEGKLYCKHHHLQLIKEKGNLSQ  174



>gb|AGE09578.1| LIM-like protein [Eucalyptus cladocalyx]
Length=192

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ+FKRTGSL+KSF+G PK  K E+ +  EK AA  K+S MF GT  KC GC  TVYP
Sbjct  61   HFDQIFKRTGSLEKSFEGIPKIVKPERPLGGEKPAAA-KVSGMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG L+C+ H+
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGKLFCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL +  G+L +
Sbjct  163  AQLIREKGNLSQ  174



>ref|XP_010059807.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW66254.1| hypothetical protein EUGRSUZ_F00087 [Eucalyptus grandis]
Length=192

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ+FKRTGSL+KSF+G PK  K E+ + +EK AA  K+S MF GT  KC GC  TVYP
Sbjct  61   HFDQIFKRTGSLEKSFEGIPKIVKPERPLGSEKPAAA-KVSGMFAGTREKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG L+C+ H+
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLFCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QL +  G+L +
Sbjct  163  AQLIREKGNLSQ  174



>ref|NP_001237652.1| uncharacterized protein LOC100527547 [Glycine max]
 gb|ACU16643.1| unknown [Glycine max]
Length=196

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GT K  K EK ++ +  AA  K+SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTSKIAKPEKNLEEKPAAA--KVSSMFGGTREKCAGCQKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  119  TEKVTVNGTPYHKSCF  134


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  102  FGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K+ T   I+ E+++A
Sbjct  162  VQLIKEKGNLTQLEGDNEKSATNGKINGEEVSA  194



>ref|XP_006836719.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
 gb|ERM99572.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
Length=192

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR++HKACFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCQACEKTVYLVDQLTADNRVYHKACFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K +K++D E  A  NK+SS+F GT  KCV C KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKADKSVDHEGHAT-NKVSSLFAGTQDKCVACKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YH+ CF
Sbjct  120  IEKVAVDGTSYHRPCF  135


 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FAGTQDKCVACKKTVYPIEKVAVDGTSYHRPCFKCTHGGCVISPSNYVAHEGRLYCKHHH  162

Query  219  DQLFKRTGS---LDKSFDGTPKTKTEKAIDAE  133
            +QLFK  G+   LDK      K  TE  + AE
Sbjct  163  NQLFKEKGNFSQLDKH--DHSKGVTENTVVAE  192



>ref|XP_009148339.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDX93448.1| BnaA06g06000D [Brassica napus]
Length=190

 Score =   194 bits (492),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YH++CF
Sbjct  120  IEKVSVNGTLYHRSCF  135


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++H++CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      +K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGGENAAKDKVVAA  190



>gb|AII80544.1| LIM-domain protein 10 [Gossypium hirsutum]
Length=190

 Score =   194 bits (492),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQ+C ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQRCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K EK +D EK  A  K+S MF GT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPEKPVDGEKPIA-TKVSGMFGGTRDKCFGCKNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             E+V VNGT YHK+CF
Sbjct  120  TERVTVNGTPYHKSCF  135


 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 5/82 (6%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C  TVY  +R+  +   +HK+CF+C H    +  SN+ + E  LYC+ H+
Sbjct  103  FGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHECRLYCKHHH  162

Query  219  DQLFKRTGSL-----DKSFDGT  169
             QL K  G+L     D+  DGT
Sbjct  163  GQLIKEKGNLSQLEGDRETDGT  184



>dbj|BAA82827.1| transcription factor Ntlim1 [Nicotiana tabacum]
Length=200

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGT+KL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTVKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K +K ID+EK     K++SMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+ NGT YHK+CF
Sbjct  120  TEKVSANGTPYHKSCF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 56/101 (55%), Gaps = 1/101 (1%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++A+   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSANGTPYHKSCFQCSHGGCVISPSNYTAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK-SFDGTPKTKTEKAIDAEKLAA  121
            LYC+ H+ QL K  G+L K   D    + T   + AE   A
Sbjct  156  LYCKHHHIQLIKEKGNLSKLEGDHEMNSTTTTEVTAESYTA  196



>emb|CDX94916.1| BnaC05g07550D [Brassica napus]
Length=189

 Score =   194 bits (492),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YH++CF
Sbjct  120  IEKVSVNGTLYHRSCF  135


 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++H++CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK--SFDGTPKTKTEKA  145
            + EG LYC+ H+ QL K  G+L +    D   K K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGDNAAKDKVDAA  189



>ref|XP_010687903.1| PREDICTED: LIM domain-containing protein WLIM1 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +   T  KC ACDKTVYLVD+L ADN++FHKACFRC+HCKGTLKLSN+NSFEGVLYC
Sbjct  1    MATTITSTNPKCKACDKTVYLVDKLTADNKVFHKACFRCHHCKGTLKLSNYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            RPH+DQL+K+TGSLDKSFDGTPKTK E+ +D+EK  +  KISSMF GT  KC GC+KT Y
Sbjct  61   RPHFDQLYKQTGSLDKSFDGTPKTKPERHVDSEKPPS--KISSMFGGTRDKCAGCSKTAY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P EKV VNG+AYHK+CF
Sbjct  119  PTEKVTVNGSAYHKSCF  135


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S I   F GT  KC  C KT Y  +++  +   +HK+CF+CY    T+  SN+   EG L
Sbjct  97   SKISSMFGGTRDKCAGCSKTAYPTEKVTVNGSAYHKSCFKCYQGGCTISPSNYIGHEGRL  156

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H+ QL K  G+L +
Sbjct  157  YCKHHHAQLIKEKGNLSQ  174



>ref|XP_006417487.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
 dbj|BAJ34608.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35840.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
Length=189

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 4/100 (4%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +  +G      EK + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQ-LEGGDNAAREKVVAA  189



>ref|XP_002892554.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68813.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFVGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      +K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGGENAAKDKVVAA  190



>ref|XP_007042657.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX98488.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=196

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 115/137 (84%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK I+ E      K+ ++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKHIENEN---AQKVVNLFGGTREKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YHK+CF
Sbjct  118  PIEKVTVNGTPYHKSCF  134


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 64/112 (57%), Gaps = 3/112 (3%)
 Frame = -2

Query  447  IVRSPLHLSLSN---IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGT  277
            IV+   H+   N   ++  F GT +KC  C+KTVY ++++  +   +HK+CF+C H   T
Sbjct  83   IVKPEKHIENENAQKVVNLFGGTREKCVGCNKTVYPIEKVTVNGTPYHKSCFKCTHGGCT  142

Query  276  LKLSNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            +  SN+ + EG LYC+ H+ QLFK  G+  +      KT   + + + ++AA
Sbjct  143  ISPSNYIAHEGKLYCKHHHIQLFKEKGNYSQLESDREKTPMNEKLTSMEIAA  194



>ref|XP_004498991.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=195

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSL+KSF+GTPK  K E+  D EK AA  K SSMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKRTGSLEKSFEGTPKIAKPERNNDNEKPAA-VKASSMFGGTRDKCSGCQKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV VNGT YHK+CF
Sbjct  120  TEKVTVNGTPYHKSCF  135


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC+ C KTVY  +++  +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  103  FGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QL K  G+L +      K      I  E++ A
Sbjct  163  IQLIKEKGNLSQLEGDHEKNAMHGKISGEEVVA  195



>gb|ABB51614.1| LIM-domain protein [Brassica napus]
 gb|ABB51648.1| LIM domain protein [Brassica napus]
Length=189

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEG LYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGALYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ FKRTGSL+KSF+GTPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYP
Sbjct  61   HFDQNFKRTGSLEKSFEGTPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTLYHKSCF  135


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 5/99 (5%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  94   PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  150

Query  255  SFEGVLYCRPHYDQLFKRTGSLDK--SFDGTPKTKTEKA  145
            + EG LYC+ H+ QL K  G+L +    D   K K + A
Sbjct  151  AHEGKLYCKHHHIQLIKEKGNLSQLEGGDNAAKDKVDAA  189



>ref|XP_009408124.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK TGSLDKSF+GTPK  K EK +D E     NK+SS F GT  KCVGC+KTVYP
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKVVKPEKYVDNEN---ANKVSSAFAGTQEKCVGCSKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGTAYHK+CF
Sbjct  118  IERVTVNGTAYHKSCF  133


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C KTVY ++R+  +   +HK+CF+C H    +  SN+ + EG LYC
Sbjct  97   VSSAFAGTQEKCVGCSKTVYPIERVTVNGTAYHKSCFKCCHGGCVISPSNYIAHEGKLYC  156

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKA  145
            + H+ QLFK  G+  +  +   + K+E +
Sbjct  157  KHHHIQLFKEKGNYSQLENDEAEAKSESS  185



>ref|XP_004252738.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=187

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 5/136 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D +  AA  K+SSMFVGT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK--DEKPHAA--KVSSMFVGTREKCFGCKNTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  117  TEKVSVNGTPYHKSCF  132


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK+CF+C H    +  SN+ + EG LYC+ H+
Sbjct  100  FVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHH  159

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  160  VQLIKEKGNLSQ  171



>ref|XP_007136766.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
 gb|ESW08760.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
Length=196

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYC+P
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+GTPK         EK AA  K+ +MF GT  KC GC KTVYP 
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPDKTGEEKPAA-TKVLNMFGGTRDKCAGCQKTVYPT  119

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK+CF
Sbjct  120  EKVTVNGTPYHKSCF  134


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            + + ++  F GT  KC  C KTVY  +++  +   +HK+CF+C H    +  SN+ + +G
Sbjct  94   AATKVLNMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHDG  153

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             LYC+ H+ QL K  G+L +      K   ++  + E +AA
Sbjct  154  KLYCKHHHIQLIKEKGNLSQLEGDHEKNAIQEKTNGEVVAA  194



>ref|XP_002298780.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
 gb|EEE83585.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
Length=196

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN++SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C+KTVY ++++  +   +H++CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QLFK  G+  +  +   K      I A ++AA
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVEIAA  194



>ref|XP_011030325.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=196

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN++SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C+KTVY ++++  +   +H++CF+C H   T+  SN+ + EG LYC+ H 
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHL  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QLFK  G+  +  +   K      I A ++AA
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVEIAA  194



>gb|ABK94586.1| unknown [Populus trichocarpa]
Length=196

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN++SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTQYHRSCF  134


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C+KTVY ++++  +   +H++CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTQYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGN  115
             QLFK  G+  +  +   K      I A ++AAG+
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVEIAAGS  196



>gb|AAD56948.1|AF184109_1 LIM domain protein WLIM1 [Nicotiana tabacum]
Length=193

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKT YLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTAYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK+TGSLDKSF+GTPK  K +K ID+ K     K++SMF GT  KC GC KTVYP
Sbjct  61   HFDQLFKQTGSLDKSFEGTPKIVKPQKPIDSGKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QL K  G+L K
Sbjct  156  LYCKHHHIQLIKEKGNLSK  174



>ref|XP_009598300.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=187

 Score =   192 bits (487),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 5/136 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D +  AA  K+SSMFVGT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK--DEKPQAA--KVSSMFVGTREKCFGCKNTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  117  TEKVSVNGTPYHKSCF  132


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  100  FVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKHHH  159

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  160  IQLIKEKGNLSQ  171



>ref|XP_009769329.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 5/136 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D +  AA  K+SSMFVGT  KC GC  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIVKPEK--DEKPQAA--KVSSMFVGTREKCFGCKNTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  117  TEKVSVNGTPYHKSCF  132


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C  TVY  ++++ +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  100  FVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKHHH  159

Query  219  DQLFKRTGSLDK  184
             QL K  G+L +
Sbjct  160  IQLIKEKGNLSQ  171



>ref|XP_011002116.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=195

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HC+GTLKLSN+ SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK ID E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPIDNEN---ASKVSNLFAGTREKCVGCDKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  CDKTVY ++++  +   +H++CF+C H   T+  SN+ + EG L
Sbjct  96   SKVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H  QLFK  G+  +
Sbjct  156  YCKHHLIQLFKEKGNYSQ  173



>gb|EYU36386.1| hypothetical protein MIMGU_mgv1a009946mg [Erythranthe guttata]
Length=326

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            S  GTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HC GTLKL+N+NSFEGVLYCRPH
Sbjct  141  SIQGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLANYNSFEGVLYCRPH  200

Query  222  YDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            +DQLFKRTGSLDKSFDGTPK  K EK  D EK  A NK+  MFVGT  KC+ C  TVYP 
Sbjct  201  FDQLFKRTGSLDKSFDGTPKIAKPEKPSDTEKPQA-NKMIGMFVGTREKCLACKNTVYPT  259

Query  45   EKVAVNGTAYHKACF  1
            EKV+VNGTAYHK+CF
Sbjct  260  EKVSVNGTAYHKSCF  274


 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +I  F GT +KC AC  TVY  ++++ +   +HK+CF+C H    +  SN+ + EG LYC
Sbjct  238  MIGMFVGTREKCLACKNTVYPTEKVSVNGTAYHKSCFKCSHGGCVISPSNYIAHEGRLYC  297

Query  231  RPHYDQLFKRTGSLDK  184
            + H+ QL K  G+L +
Sbjct  298  KHHHLQLIKEKGNLSQ  313



>gb|ABK95336.1| unknown [Populus trichocarpa]
Length=195

 Score =   191 bits (486),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HC+GTLKLSN+ SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCDKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  CDKTVY ++++  +   +H++CF+C H   T+  SN+ + EG L
Sbjct  96   SKVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            +C+ H+ QLFK  G+  +
Sbjct  156  HCKHHHIQLFKEKGNYSQ  173



>ref|XP_002313186.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
 gb|ABK93559.1| unknown [Populus trichocarpa]
 gb|EEE87141.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
Length=195

 Score =   191 bits (486),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HC+GTLKLSN+ SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCDKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  CDKTVY ++++  +   +H++CF+C H   T+  SN+ + EG L
Sbjct  96   SKVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H+ QLFK  G+  +
Sbjct  156  YCKHHHIQLFKEKGNYSQ  173



>gb|ABY21316.1| LIM1 [Lilium longiflorum]
Length=181

 Score =   191 bits (485),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 112/136 (82%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTTQKC AC KTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTQKCMACTKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            HYDQLFKRTGSL+KSF+GTPK  K EK I  E     NK+S  F GT  KCVGC KTVYP
Sbjct  61   HYDQLFKRTGSLEKSFEGTPKIVKPEKPIGTEN---ANKVSGAFAGTKEKCVGCQKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGT YHK+CF
Sbjct  118  IERVTVNGTCYHKSCF  133


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +FAGT +KC  C KTVY ++R+  +   +HK+CF+C H   T+  SN+ + EG LYC+ H
Sbjct  100  AFAGTKEKCVGCQKTVYPIERVTVNGTCYHKSCFKCAHGGCTISPSNYIAHEGTLYCKHH  159

Query  222  YDQLFKRTGSLDKSFDGT  169
            + QL K  G+L +  +GT
Sbjct  160  HIQLIKEKGNLSQ-LEGT  176



>gb|ABK58465.1| LIM domain protein GLIM1b [Populus tremula x Populus alba]
Length=196

 Score =   191 bits (486),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNRI+HKACFRC+HC+GTLKLSN++SFEGVLYCR
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKPVDNEN---ASKVSNLFAGTREKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH+ CF
Sbjct  118  PIEKVTVNGTPYHRRCF  134


 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 0/99 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  C+KTVY ++++  +   +H+ CF+C H   T+  SN+ + EG L
Sbjct  96   SKVSNLFAGTREKCVGCNKTVYPIEKVTVNGTPYHRRCFKCTHGGCTVSPSNYIAHEGKL  155

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            YC+ H+ QLFK  G+  +  +   K      I A ++AA
Sbjct  156  YCKHHHIQLFKEKGNYSQLENEREKNPVTVNITAVEIAA  194



>gb|AGJ83946.1| lim protein 6 [Gossypium hirsutum]
Length=196

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK I+ E      K+ ++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIENEN---AQKVVNLFGGTKEKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV V+GT+YH+ CF
Sbjct  118  PIEKVTVDGTSYHRGCF  134


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  447  IVRSPLHLSLSN---IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGT  277
            I +   H+   N   ++  F GT +KC  C+KTVY ++++  D   +H+ CF+C H   T
Sbjct  83   IAKPEKHIENENAQKVVNLFGGTKEKCVGCNKTVYPIEKVTVDGTSYHRGCFKCSHGGCT  142

Query  276  LKLSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            +  SN+ + EG LYC+ H+ QLFK  G+  +
Sbjct  143  ISPSNYVAHEGKLYCKHHHVQLFKEKGNYSQ  173



>ref|XP_009414770.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=193

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK TGSLDKSF+GTPK  K EK ++ E  +   K+SS F GT  KCVGC KTVYP
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKIVKPEKHVENENAS---KVSSAFAGTREKCVGCNKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGTAYHK+CF
Sbjct  118  IERVTVNGTAYHKSCF  133


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (57%), Gaps = 3/102 (3%)
 Frame = -2

Query  447  IVRSPLHLSLSN---IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGT  277
            IV+   H+   N   +  +FAGT +KC  C+KTVY ++R+  +   +HK+CF+C      
Sbjct  82   IVKPEKHVENENASKVSSAFAGTREKCVGCNKTVYPIERVTVNGTAYHKSCFKCSRGGCV  141

Query  276  LKLSNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTE  151
            +  SN+ + EG LYC+ H+ QLFK  G+  +  +G  K   E
Sbjct  142  ISPSNYIAHEGRLYCKHHHIQLFKEKGNYSQLENGEEKISCE  183



>ref|XP_007201308.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
 gb|EMJ02507.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
Length=192

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 119/138 (86%), Gaps = 5/138 (4%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKCTAC+KTVYLVDRLAAD+R++HKACFRC+HC GTLKLSN+ SFEGVLYCR
Sbjct  1    MATFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEK-AIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            PHYDQLFKRTGSLDKSF+GTPK  K EK + D E    GN +S++F GT  KCVGC KTV
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKSSTDKEN---GNSVSNLFAGTREKCVGCQKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKV+VNGT YH++CF
Sbjct  118  YPIEKVSVNGTPYHRSCF  135


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S+SN+   FAGT +KC  C KTVY +++++ +   +H++CF+C H   T+  SN+ + EG
Sbjct  98   SVSNL---FAGTREKCVGCQKTVYPIEKVSVNGTPYHRSCFKCTHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAE  133
             LYC+ H+ QLFK  G+  +  +   K      I AE
Sbjct  155  KLYCKHHHIQLFKEKGNYSQLENEGEKHSMTMEIAAE  191



>gb|ABK58464.1| LIM domain protein GLIM1a [Populus tremula x Populus alba]
Length=195

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F+GT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HC+GTLKLSN+ SFEGVLYCR
Sbjct  1    MAAFSGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK +D E     +K+S++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNEN---ASKVSNLFAGTREKCVGCDKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YH++CF
Sbjct  118  PIEKVTVNGTPYHRSCF  134


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  CDKTVY ++++  +   +H++CF+C H   T+  SN+ + EG L
Sbjct  96   SKVSNLFAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H+ QLFK  G+  +
Sbjct  156  YCKHHHIQLFKEKGNYSQ  173



>ref|XP_010272870.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272878.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272885.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272891.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=196

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC KTVYLVD+L ADNRI+HK+CFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACAKTVYLVDQLTADNRIYHKSCFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+GTPK    +  ++E  A  NK+S+MF GT  KC+ C KTVYP+
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKIAKPEKPESEN-ATTNKVSNMFGGTRDKCICCKKTVYPL  119

Query  45   EKVAVNGTAYHKACF  1
            EKV V+G AYHK CF
Sbjct  120  EKVTVDGNAYHKICF  134


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY ++++  D   +HK CF+C H    +  SN+ + EG LYCR H+
Sbjct  102  FGGTRDKCICCKKTVYPLEKVTVDGNAYHKICFKCTHGGCVISPSNYIAHEGKLYCRHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QLFK  G+  +      K   ++ ++  ++AA
Sbjct  162  TQLFKEKGNYSQLEGDNEKEPAKETVNTVEVAA  194



>ref|XP_010274389.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=186

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSFAGTTQKC AC+KTV+LVD+L ADNRIFHK+CFRC+HC GTLKL NF+SFEGVLYCRP
Sbjct  1    MSFAGTTQKCQACNKTVHLVDQLTADNRIFHKSCFRCHHCNGTLKLGNFSSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            HYDQLFKRTG LDKSF+G PK  K+EK +D++ + + N++S+MF GT  KCVGC KTVYP
Sbjct  61   HYDQLFKRTGRLDKSFEGAPKVAKSEKPVDSQSVGS-NRVSNMFGGTQEKCVGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKV V+G  YHK CF
Sbjct  120  LEKVTVDGNVYHKICF  135


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C KTVY ++++  D  ++HK CFRC      L  S++ + EG LYCR H+
Sbjct  103  FGGTQEKCVGCKKTVYPLEKVTVDGNVYHKICFRCVRGGCVLSTSSYIAHEGKLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK  G+  +
Sbjct  163  TQLFKEKGNYSQ  174



>ref|NP_001235271.1| uncharacterized protein LOC100500501 [Glycine max]
 gb|ACU15600.1| unknown [Glycine max]
Length=192

 Score =   189 bits (479),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            ++ SFAGTTQKC AC+KTVYLVD+L ADN+I+HK+CFRCYHCKGTLKLSN+ SFEGVLYC
Sbjct  1    MMASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            +PH+DQLFK+TGSLDKSF+G P+T + E++ D  ++   NK+S++F GT  KCV C KTV
Sbjct  61   KPHFDQLFKKTGSLDKSFEGIPRTARLERSTD--QVQTNNKVSNLFAGTQEKCVACKKTV  118

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKVAV+GT YHKACF
Sbjct  119  YPIEKVAVDGTFYHKACF  136


 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 1/89 (1%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLK  271
            + RS   +  +N + + FAGT +KC AC KTVY ++++A D   +HKACFRC H    + 
Sbjct  87   LERSTDQVQTNNKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTFYHKACFRCTHGGCVIS  146

Query  270  LSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             SN+ + E  LYCR H+ QLFK+ G+  +
Sbjct  147  PSNYVAHEHRLYCRHHHTQLFKQKGNFSQ  175



>ref|XP_011028613.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   189 bits (479),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC ACDKTVYLVD+L  DN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACDKTVYLVDQLTVDNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+GTPKT       A+++ + +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKT-VRGDRSADQVLSNSKVSSMFAGTQEKCVACKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YHKACF
Sbjct  120  LEKVAVDGTSYHKACF  135


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  426  LSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFE  247
            LS S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E
Sbjct  94   LSNSKVSSMFAGTQEKCVACKKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHE  153

Query  246  GVLYCRPHYDQLFKRTGSLDK  184
              LYCR H++QLFK  G+  +
Sbjct  154  HSLYCRHHHNQLFKEKGNFSQ  174



>ref|XP_008236308.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   189 bits (479),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 5/138 (4%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKCTAC+KTVYLVDRLAAD+R++HKACFRC+HC GTLKLSN+ SFEGVLYCR
Sbjct  1    MATFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEK-AIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            PHYDQLFKRTGSLDKSF+GTPK  K EK   D E    GN +S++F GT  KCVGC KTV
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKPPTDKEN---GNSVSNLFAGTREKCVGCQKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKV+VNG  YHK+CF
Sbjct  118  YPIEKVSVNGIPYHKSCF  135


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S+SN+   FAGT +KC  C KTVY +++++ +   +HK+CF+C H   T+  SN+ + EG
Sbjct  98   SVSNL---FAGTREKCVGCQKTVYPIEKVSVNGIPYHKSCFKCTHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             LYC+ H+ QLFK  G+  +  +   K    + + A ++AA
Sbjct  155  KLYCKHHHIQLFKEKGNYSQLENEGEKHSMTEQVTAMEIAA  195



>ref|XP_006439752.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 ref|XP_006476731.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR52992.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 gb|KDO69762.1| hypothetical protein CISIN_1g029735mg [Citrus sinensis]
Length=189

 Score =   188 bits (478),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN+ SFEGVLYC+
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+GTPKT + E++ D       +++SSMF GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVERSADQ---VTNSRVSSMFAGTQDKCVACKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  118  PIEKVAVDGTSYHKACF  134


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RS   ++ S +   FAGT  KC AC KTVY ++++A D   +HKACFRC H    +  
Sbjct  86   VERSADQVTNSRVSSMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  146  SNYVAHEHRLYCRHHHNQLFKQKGNFSQ  173



>ref|XP_002511450.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52052.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=190

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+GTPKT + +++  A++  + +++SSMF GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRS--ADQFNSNSRVSSMFAGTQDKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  119  PIEKVAVDGTSYHKACF  135


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 3/93 (3%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT  KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E 
Sbjct  95   SNSRVSSMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQ  154

Query  243  VLYCRPHYDQLFKRTGS---LDKSFDGTPKTKT  154
             LYCR H++QLFK+ G+   LDK     P T+T
Sbjct  155  RLYCRHHHNQLFKQKGNFSQLDKHEHVKPVTET  187



>ref|XP_010254782.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=191

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 119/137 (87%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACQKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+G PK ++T+K++D     A NK+S++F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKVSRTDKSVDQGN--ANNKVSTLFAGTQDKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G++YHKACF
Sbjct  119  PIEKVAVDGSSYHKACF  135


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC AC KTVY ++++A D   +HKACF+C H    +  SN+ + E  LYCR H+
Sbjct  103  FAGTQDKCVACKKTVYPIEKVAVDGSSYHKACFKCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  219  DQLFKRTGS---LDKS  181
             QLFK  G+   LDK+
Sbjct  163  SQLFKEKGNFSQLDKN  178



>gb|KHN19331.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            ++ SFAGTTQKC AC+KTVYLVD+L ADN+I+HK+CFRCYHCKGTLKLSN+ SFEGVLYC
Sbjct  1    MMASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            +PH+DQLFK+TGSLDKSF+G P+T + E++ D  ++   +K+S++F GT  KCV C KTV
Sbjct  61   KPHFDQLFKKTGSLDKSFEGIPRTARLERSTD--QVQTNSKVSNLFAGTQEKCVACKKTV  118

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKVAV+GT+YHKACF
Sbjct  119  YPIEKVAVDGTSYHKACF  136


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  L
Sbjct  98   SKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRL  157

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK+ G+  +
Sbjct  158  YCRHHHTQLFKQKGNFSQ  175



>ref|XP_009590601.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++ D  +  + +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKLTGSLDKSFEGAPKTVRERSADQGQ--SNSKVSSLFGGTQDKCVACKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ACF
Sbjct  119  LEKVAVDGTSYHRACF  134


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   F GT  KC AC KTVY ++++A D   +H+ACF+C H    +  SN+ + E 
Sbjct  94   SNSKVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEH  153

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H+ QLFK  G+  +  D
Sbjct  154  KLYCRHHHTQLFKERGNFSQMED  176



>ref|XP_006664058.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=195

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K EK ++ E      K+SS F GT  KCVGC KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPEKTVENENAM---KVSSAFAGTREKCVGCNKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C+KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG LYC
Sbjct  99   VSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAE  133
            + H+ QL K  G+  +  +   K     +++ E
Sbjct  159  KHHHIQLIKEKGNFSQLENDHEKASQSGSVEDE  191



>gb|AII80541.1| LIM-domain protein 7 [Gossypium hirsutum]
Length=208

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 113/137 (82%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GT QKC AC+KTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFQGTQQKCNACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  + E+ ID+E   +  K+ + F GT  KC  C+KT Y
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVVRPERQIDSE---SALKVMNSFGGTREKCAACSKTAY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIE+V VNGT YHK+CF
Sbjct  118  PIERVTVNGTIYHKSCF  134


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            ++ SF GT +KC AC KT Y ++R+  +  I+HK+CF+C H   T+  SN+ + EG LYC
Sbjct  98   VMNSFGGTREKCAACSKTAYPIERVTVNGTIYHKSCFKCTHGGCTISPSNYIAHEGKLYC  157

Query  231  RPHYDQLFKRTGSLDK  184
            + H+ QLFK  G+  +
Sbjct  158  KHHHIQLFKEKGNYSQ  173



>ref|XP_004136935.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155415.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN43845.1| hypothetical protein Csa_7G071340 [Cucumis sativus]
Length=201

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF+GTTQKC AC+KTVYLVD+L ADNR+FHKACFRCYHCKGTLKLSN+ SFEGVLYCR
Sbjct  1    MASFSGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  ++EK  + E   +   +S+MF GT  KC GCTKTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVMRSEKPSENENAKS---VSNMFGGTRDKCSGCTKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
             IEKV VNG AYHK+CF
Sbjct  118  LIEKVTVNGNAYHKSCF  134


 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 63/107 (59%), Gaps = 10/107 (9%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S+SN+   F GT  KC+ C KTVYL++++  +   +HK+CF+C H   T+  S++ + EG
Sbjct  97   SVSNM---FGGTRDKCSGCTKTVYLIEKVTVNGNAYHKSCFKCSHGGCTISPSSYIAHEG  153

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISS  103
             LYC+ H+ QLF   G+         + +TE+  +   +AA  K+++
Sbjct  154  KLYCKHHHIQLFMEKGNYS-------QLETERQKNNSAIAAAIKLTT  193



>emb|CDO97286.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTTQKCT C+KTVYLVD+LAADNRI+HKACFRC+HC+ TLKL NFNSF+GVLYCRP
Sbjct  1    MAFVGTTQKCTVCEKTVYLVDKLAADNRIYHKACFRCHHCQRTLKLGNFNSFDGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK +D E      K+SS+FVGT  KC+GC KTVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKVVKPEKPVDHEN---ATKVSSLFVGTRDKCIGCDKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IEKV VNG  YH++CF
Sbjct  118  IEKVTVNGKPYHRSCF  133


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 3/102 (3%)
 Frame = -2

Query  429  HLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSF  250
            H + + +   F GT  KC  CDKTVY ++++  + + +H++CF+C H   T+  SN+ + 
Sbjct  91   HENATKVSSLFVGTRDKCIGCDKTVYPIEKVTVNGKPYHRSCFKCSHGGCTISPSNYIAH  150

Query  249  EGVLYCRPHYDQLFKRTGS---LDKSFDGTPKTKTEKAIDAE  133
            EG LYC+ H+ QL K  G+   L+   D  P       I AE
Sbjct  151  EGTLYCKHHHAQLVKEKGNYSQLENDMDKEPSLPAHMEIAAE  192



>gb|KDP31140.1| hypothetical protein JCGZ_11516 [Jatropha curcas]
Length=191

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 120/137 (88%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+GTPKT + +K+  A+++   +K+SSMF GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDKS--ADQVHTNSKVSSMFAGTQDKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKVAV+G +YHKACF
Sbjct  119  PLEKVAVDGMSYHKACF  135


 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT  KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  L
Sbjct  97   SKVSSMFAGTQDKCVACKKTVYPLEKVAVDGMSYHKACFRCTHGGCVISPSNYVAHEQRL  156

Query  237  YCRPHYDQLFKRTGS---LDKSFDGTPKTK  157
            YCR H++QLFK+ G+   LDK     P T+
Sbjct  157  YCRHHHNQLFKQKGNFSQLDKQEHAKPVTE  186



>gb|KHN16307.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            ++ SFAGTTQKC AC+KTVYLVD+L ADN+I+HK+CFRCYHCKGTLKLSN+ SFEGVLYC
Sbjct  1    MMASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            +PH+DQLFK+TGSLDKSF+G P+T + E++  A+++    K+S++F GT  KCV C KTV
Sbjct  61   KPHFDQLFKKTGSLDKSFEGIPRTARLERS--ADQVQTNTKVSNLFAGTQEKCVACKKTV  118

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKVAV+GT+YHKACF
Sbjct  119  YPIEKVAVDGTSYHKACF  136


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  LYCR H+
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  219  DQLFKRTGSLDK  184
             QLFK+ G+  +
Sbjct  164  TQLFKQKGNFSQ  175



>ref|NP_001238190.1| uncharacterized protein LOC100500444 [Glycine max]
 gb|ACU15531.1| unknown [Glycine max]
Length=192

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            ++ SFAGTTQKC AC+KTVYLVD+L ADN+I+HK+CFRCYHCKGTLKLSN+ SFEGVLYC
Sbjct  1    MMASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            +PH+DQLFK+TGSLDKSF+G P+T + E++  A+++    K+S++F GT  KCV C KTV
Sbjct  61   KPHFDQLFKKTGSLDKSFEGIPRTARLERS--ADQVQTNTKVSNLFAGTQEKCVACKKTV  118

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIEKVAV+GT+YHKACF
Sbjct  119  YPIEKVAVDGTSYHKACF  136


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  LYCR H+
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  219  DQLFKRTGSLDK  184
             QLFK+ G+  +
Sbjct  164  TQLFKQKGNFSQ  175



>ref|XP_010322559.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
 gb|AAX73300.1| putative pollen specific LIM domain-containing protein [Solanum 
lycopersicum]
Length=179

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 115/136 (85%), Gaps = 3/136 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MASFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++ D     + +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQ---GSNSKVSSLFGGTQDKCVACKKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ CF
Sbjct  118  LEKVAVDGTSYHRPCF  133


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -2

Query  441  RSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSN  262
            RS    S S +   F GT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN
Sbjct  87   RSADQGSNSKVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSN  146

Query  261  FNSFEGVLYCRPHYDQLFKRTGSLDKSFD  175
            + + E  LYCR H+ QLFK  G+  +  D
Sbjct  147  YVAHEHRLYCRHHHTQLFKERGNFSQMED  175



>ref|XP_009803543.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=189

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC  C+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFGGTTQKCKGCEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++ D  +  + +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQGQ--SNSKVSSLFGGTQDKCVACKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ACF
Sbjct  119  LEKVAVDGTSYHRACF  134


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   F GT  KC AC KTVY ++++A D   +H+ACF+C H    +  SN+ + E 
Sbjct  94   SNSKVSSLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEH  153

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H+ QLFK  G+  +  D
Sbjct  154  KLYCRHHHTQLFKERGNFSQMED  176



>ref|XP_002532425.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
 gb|EEF29966.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
Length=196

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +F GT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+ SFEGVLYC
Sbjct  1    MATTFGGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPHYDQLFK TGSLDKSF+GTPK  K EK ID+E     +K+S+ F GT  KCVGC+KTV
Sbjct  61   RPHYDQLFKLTGSLDKSFEGTPKVAKPEKPIDSEN---ASKVSNKFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VNGT YH++CF
Sbjct  118  YPIERVTVNGTPYHRSCF  135


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 1/99 (1%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC  C KTVY ++R+  +   +H++CF+C +   T+  SN+ + EG L
Sbjct  97   SKVSNKFAGTREKCVGCSKTVYPIERVTVNGTPYHRSCFKCTYGGCTISPSNYIAHEGKL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            YC+ H+ QLFK  G+  +  +      TEK I A ++AA
Sbjct  157  YCKHHHIQLFKEKGNYSQLENERQPATTEK-ITAVEIAA  194



>ref|XP_004962903.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=195

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 116/138 (84%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ ++ E      K+SS+F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVENENAI---KVSSVFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 56/90 (62%), Gaps = 0/90 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
             QL K  G+  +  +   KT    +++ E+
Sbjct  163  IQLIKEKGNFSQLENDHEKTSQAGSLEDEE  192



>ref|XP_007138113.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
 gb|ESW10107.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
Length=191

 Score =   187 bits (475),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 120/137 (88%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKC AC+KTVYLVD+L ADN+I+HK+CFRCYHCKGTLKLSN+ SFEGVLYC+
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK+TGSLDKSF+G P+T + E++  A+++   +K+S++F GT  KCV C KTVY
Sbjct  61   PHFDQLFKKTGSLDKSFEGIPRTARLERS--ADQVHTNSKVSNLFAGTQEKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  119  PIEKVAVDGTSYHKACF  135


 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  L
Sbjct  97   SKVSNLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRL  156

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK+ G+  +
Sbjct  157  YCRHHHTQLFKQKGNFSQ  174



>ref|XP_002321571.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
 gb|EEF05698.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
Length=191

 Score =   187 bits (474),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 116/136 (85%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC ACDKTVYLVD+L  DN+ +HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACDKTVYLVDQLTVDNKFYHKACFRCHHCKGTLKLSNYSSFEGVLYCQ  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+GTPKT       A+++ + +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKT-VRGDRSADQVLSNSKVSSMFAGTQEKCVACNKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YHKACF
Sbjct  120  LEKVAVDGTSYHKACF  135


 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  426  LSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFE  247
            LS S +   FAGT +KC AC+KTVY ++++A D   +HKACFRC H    +  SN+ + E
Sbjct  94   LSNSKVSSMFAGTQEKCVACNKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHE  153

Query  246  GVLYCRPHYDQLFKRTGSLDK  184
              LYCR H++QLFK  G+  +
Sbjct  154  HRLYCRHHHNQLFKEKGNFSQ  174



>ref|XP_004289780.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=195

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT+QKCTAC+KTVYLVD+L AD+R +HKACFRC+HCKGTLKLSN+ SFEGVLYCR
Sbjct  1    MATFAGTSQKCTACEKTVYLVDKLTADSRSYHKACFRCHHCKGTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK  + E   A   +SS+F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKPTENENTKA---VSSLFGGTKDKCVGCEKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV+VNGTAYH+ CF
Sbjct  118  PIEKVSVNGTAYHRRCF  134


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C+KTVY +++++ +   +H+ CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FGGTKDKCVGCEKTVYPIEKVSVNGTAYHRRCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QLFK  G+  +  +   K  T +   + ++A+
Sbjct  162  IQLFKEKGNYSQLENEREKQSTNEQATSVEIAS  194



>ref|XP_010027995.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW83415.1| hypothetical protein EUGRSUZ_B00345 [Eucalyptus grandis]
Length=182

 Score =   186 bits (472),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT QKC ACDKTVYLVD+L ADN++FHKACFRC+HCKGTLKLSN+ SFEGVLYC
Sbjct  1    MATAFAGTQQKCKACDKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYCSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            +PH++QLFK TGSLDKSF+GTPKT       +E+  +  K+SSMF GT  KCV C KTVY
Sbjct  61   KPHFNQLFKMTGSLDKSFEGTPKTVNR---SSEQGQSNAKVSSMFAGTQDKCVACKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  118  PIEKVAVDGTSYHKACF  134


 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S + +   FAGT  KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E 
Sbjct  94   SNAKVSSMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEH  153

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYCR H++QLFK  G+  +
Sbjct  154  RLYCRHHHNQLFKEKGNFSQ  173



>ref|XP_002442217.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
 gb|EES16055.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
Length=194

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENAV---KVSSAFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG LYC
Sbjct  99   VSSAFAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
            + H+ QL K  G+  +  +   KT    +++ E+
Sbjct  159  KHHHIQLIKEKGNFSQLENDHEKTSQAGSLEDEE  192



>ref|XP_010942770.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GT  KCTAC KTVYLVD+L ADNRI+HKACF+C+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTQTKCTACSKTVYLVDKLTADNRIYHKACFKCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK TGSLDKSF+GTPK  K EK +  EK AA +K+SS F GT  KCVGC KTVYP
Sbjct  61   HFDQLFKMTGSLDKSFEGTPKIVKPEKPVITEKPAA-HKVSSAFAGTREKCVGCRKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             E+V VNGTAYH++CF
Sbjct  120  TERVTVNGTAYHRSCF  135


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 58/110 (53%), Gaps = 3/110 (3%)
 Frame = -2

Query  450  IIVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLK  271
            +I   P    +S+   +FAGT +KC  C KTVY  +R+  +   +H++CF+C H    + 
Sbjct  89   VITEKPAAHKVSS---AFAGTREKCVGCRKTVYPTERVTVNGTAYHRSCFKCTHGGCVIS  145

Query  270  LSNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             SN+ + EG LYC+ H+ QL K  G+  +      K  +E    A +L +
Sbjct  146  PSNYIAHEGRLYCKHHHIQLIKEKGNYSQLETDQEKMGSEAPASAGELVS  195



>ref|XP_007036121.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 ref|XP_007036122.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20622.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20623.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
Length=189

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 119/137 (87%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L AD++++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFKRTGSLDKSF+GTPKT + +++ D       +++SS+F GT  KCV C KTVY
Sbjct  61   PHFDQLFKRTGSLDKSFEGTPKTVRVDRSADQ---VTNSRVSSLFAGTQEKCVACKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G++YHKACF
Sbjct  118  PIEKVAVDGSSYHKACF  134


 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RS   ++ S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  
Sbjct  86   VDRSADQVTNSRVSSLFAGTQEKCVACKKTVYPIEKVAVDGSSYHKACFRCTHGGCVISP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  146  SNYVAHEQRLYCRHHHNQLFKQKGNFSQ  173



>gb|ABA99040.1| Pollen-specific protein SF3, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ20639.1| hypothetical protein OsJ_36255 [Oryza sativa Japonica Group]
Length=195

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K EK ++ E      K+SS F GT  KCVGC KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPEKTVENENAI---KVSSAFAGTREKCVGCNKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 57/93 (61%), Gaps = 0/93 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C+KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG LYC
Sbjct  99   VSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAE  133
            + H+ QL K  G+  +  +   K     +++ E
Sbjct  159  KHHHIQLIKEKGNFSQLENDHEKASQSGSVEDE  191



>ref|XP_004299580.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PK   +++ D       +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGNPKIVRDRSAD----QVNSKVSSMFAGTQDKCVACKKTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
            IEKV V+GT+YHKACF
Sbjct  117  IEKVGVDGTSYHKACF  132


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT  KC AC KTVY ++++  D   +HKACFRC H    +  SN+ + E  L
Sbjct  94   SKVSSMFAGTQDKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCVISPSNYVAHEHRL  153

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H++QLFK+ G+  +
Sbjct  154  YCKHHHNQLFKQKGNFSQ  171



>ref|XP_006422808.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 ref|XP_006486914.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR36048.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 gb|KDO57910.1| hypothetical protein CISIN_1g029230mg [Citrus sinensis]
Length=197

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT QKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSNFNSFEGVLYCRPH+
Sbjct  5    FGGTQQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNFNSFEGVLYCRPHF  64

Query  219  DQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            DQLFKRTGSL+KSF+GTPK  K EK ++ E      K+S+ FVGT  KCVGC +TVYP E
Sbjct  65   DQLFKRTGSLEKSFEGTPKIVKPEKLVENEN---AQKVSNKFVGTRDKCVGCDRTVYPTE  121

Query  42   KVAVNGTAYHKACF  1
            KV+VNG AYH++CF
Sbjct  122  KVSVNGAAYHRSCF  135


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 0/93 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  CD+TVY  ++++ +   +H++CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FVGTRDKCVGCDRTVYPTEKVSVNGAAYHRSCFKCSHGGCTISPSNYIAHEGKLYCKHHH  162

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
             QLF+  G+  +      K++  +     ++AA
Sbjct  163  IQLFREKGNYSQLESDLEKSQISEKPTPVQIAA  195



>ref|NP_001104937.2| LOC541782 [Zea mays]
 gb|AAF67835.2|AF135591_1 LIM transcription factor homolog [Zea mays]
Length=197

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNEN---ATKVSSAFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YP E+V VN T YHK+CF
Sbjct  118  YPTERVTVNNTMYHKSCF  135


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            + +  +FAGT +KC  C KTVY  +R+  +N ++HK+CF+C H   T+  SN+ + EG L
Sbjct  97   TKVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  237  YCRPHYDQLFKRTGS  193
            YC+ H+ QL K  G+
Sbjct  157  YCKHHHIQLIKERGT  171



>ref|XP_003576026.1| PREDICTED: LIM domain-containing protein WLIM1 [Brachypodium 
distachyon]
Length=196

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ ++ E      K+SS F GT  KCVGC KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVENENAI---KVSSAFAGTREKCVGCNKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C+KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG L+C
Sbjct  99   VSSAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEK  130
            + H+ QL K  G+  +  + + KT ++  ++D E+
Sbjct  159  KHHHIQLIKEKGNFSQLENDSEKTSQSAGSVDDEE  193



>ref|XP_008648273.1| PREDICTED: LOC541782 isoform X1 [Zea mays]
 gb|ACG33608.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG42218.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG46790.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG47580.1| pollen-specific protein SF3 [Zea mays]
 gb|ACL54041.1| unknown [Zea mays]
 gb|AFW74663.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05891.1| LIM transcription factor, partial [Zea mays]
Length=195

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNEN---ATKVSSAFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YP E+V VN T YHK+CF
Sbjct  118  YPTERVTVNNTMYHKSCF  135


 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            + +  +FAGT +KC  C KTVY  +R+  +N ++HK+CF+C H   T+  SN+ + EG L
Sbjct  97   TKVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
            YC+ H+ QL K  G+  +  +   KT    +++ ++
Sbjct  157  YCKHHHIQLIKEKGNFSQLENDHEKTSQAGSLEEDE  192



>gb|ACG34183.1| pollen-specific protein SF3 [Zea mays]
Length=195

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNEN---ATKVSSAFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YP E+V VN T YHK+CF
Sbjct  118  YPTERVTVNNTMYHKSCF  135


 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            + +  +FAGT +KC  C KTVY  +R+  +N ++HK+CF+C H   T+  SN+ + EG L
Sbjct  97   TKVSSAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
            YC+ H+ Q  K  G+  +  +   KT    +++ ++
Sbjct  157  YCKHHHIQXIKEKGNFSQLENDHEKTSQAGSLEEDE  192



>ref|XP_011087164.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=188

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN++FHKACFRC+HCKGTLKLSN++S+EGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYSSYEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+G PKT + E+++  E     +K+SS+F GT  KCV C K VY
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTARAERSV--EPGVTNSKVSSLFAGTQDKCVACNKKVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKVAV+GT+YH+ACF
Sbjct  119  PLEKVAVDGTSYHRACF  135


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT  KC AC+K VY ++++A D   +H+ACF+C H   T+  SN+ + E  L
Sbjct  97   SKVSSLFAGTQDKCVACNKKVYPLEKVAVDGTSYHRACFKCSHGGCTISPSNYVAHEHQL  156

Query  237  YCRPHYDQLFKRTGS---LDKSFDGTPKTKT  154
            YCR H+ QLFK+ G+   LDK   G  +  T
Sbjct  157  YCRHHHTQLFKQKGNFSQLDKHEQGKGENGT  187



>ref|XP_002283525.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI15078.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   184 bits (466),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G P  KT +++D  +    +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGAP--KTVRSVDQGQ--TNSKVSSMFAGTQEKCVACKKTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
            IEKV V+GT+YHKACF
Sbjct  117  IEKVGVDGTSYHKACF  132


 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC AC KTVY ++++  D   +HKACFRC H   T+  SN+ + E  L
Sbjct  94   SKVSSMFAGTQEKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCTISPSNYIAHEHRL  153

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK  G+  +
Sbjct  154  YCRHHHSQLFKEKGNFSQ  171



>gb|AII80542.1| LIM-domain protein 8 [Gossypium hirsutum]
Length=189

 Score =   184 bits (466),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+GTPKT + +++ D       +K S +F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRSADQ---VTNSKFSGLFAGTQEKCVACKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  118  PIEKVAVDGTSYHKACF  134


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RS   ++ S     FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  
Sbjct  86   VDRSADQVTNSKFSGLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  146  SNYVAHEHRLYCRHHHNQLFKQKGNFSQ  173



>gb|KHG14633.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   184 bits (466),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 116/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+GTPKT + +++ D       +K S +F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRSADQ---VTNSKFSGLFAGTQEKCVACKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YHKACF
Sbjct  118  PIEKVAVDGTSYHKACF  134


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 0/88 (0%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RS   ++ S     FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  
Sbjct  86   VDRSADQVTNSKFSGLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  146  SNYVAHEHRLYCRHHHNQLFKQKGNFSQ  173



>dbj|BAB84583.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   184 bits (466),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNRI+HKACFRC+HCK TLKL N NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKATLKLGNSNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H   LFK+TGSLDKSF+GTPK  + +K ID+EK     K++SMF GT  KC GC KTVYP
Sbjct  61   HLIGLFKQTGSLDKSFEGTPKIVRPQKPIDSEKPQVA-KVTSMFGGTREKCFGCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             EKV+VNGT YHK+CF
Sbjct  120  TEKVSVNGTPYHKSCF  135


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            ++ +   F GT +KC  C KTVY  ++++ +   +HK+CF+C H    +  SN+ + EG 
Sbjct  96   VAKVTSMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGR  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QL K  G+L K
Sbjct  156  LYCKHHHIQLIKEKGNLSK  174



>ref|XP_010272036.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=183

 Score =   183 bits (465),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLV++L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVEQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+G PK  +T+++ D     A +K+SS+F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKVARTDRSSDQGN--ANSKVSSLFSGTQEKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+GT+YH+ACF
Sbjct  119  PIEKVAVDGTSYHRACF  135


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F+GT +KC AC KTVY ++++A D   +H+ACF+C H    +  SN+ + E  +
Sbjct  97   SKVSSLFSGTQEKCVACKKTVYPIEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEQRI  156

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK  G+  +
Sbjct  157  YCRHHHSQLFKEKGNFSQ  174



>gb|ABW69660.1| transcription factor LIM [Triticum aestivum]
Length=196

 Score =   183 bits (465),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KC GC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNEN---ATKVSSAFAGTREKCFGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG L+C
Sbjct  99   VSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAE  133
            + H+ QL K  G+  +  +   KT ++  ++D E
Sbjct  159  KHHHTQLIKEKGNFSQLENDHDKTSQSAGSVDDE  192



>ref|XP_007209651.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
 ref|XP_008239721.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
 gb|EMJ10850.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
Length=187

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT      D  +    +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKT----VRDRSEQVNNSKVSSLFAGTQDKCVACKKTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YHK CF
Sbjct  117  IEKVAVDGTSYHKPCF  132


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT  KC AC KTVY ++++A D   +HK CFRC H    +  SN+ + E  L
Sbjct  94   SKVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRL  153

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK  G+  +
Sbjct  154  YCRHHHSQLFKEKGNFSQ  171



>ref|NP_001148027.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG29494.1| pollen-specific protein SF3 [Zea mays]
 tpg|DAA55370.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB05750.1| LIM transcription factor, partial [Zea mays]
Length=196

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSF+GVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFDGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF GTPK  K E+ +  E      K+SS F GT  KCVGC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFQGTPKVVKPERNVGNEN---ATKVSSAFAGTREKCVGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK CF
Sbjct  118  YPIERVTVNNTMYHKCCF  135


 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            + +  +FAGT +KC  C KTVY ++R+  +N ++HK CF+C H   T+  SN+ + EG L
Sbjct  97   TKVSSAFAGTREKCVGCSKTVYPIERVTVNNTMYHKCCFKCCHGGCTISPSNYIAHEGKL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
            YC+ H+ QL K  G+  +  +   KT    +++ ++
Sbjct  157  YCKHHHVQLIKEKGNFSQLENDHEKTSQAGSLEDDE  192



>dbj|BAJ94823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 4/138 (3%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktV  55
            RPH+DQLFKRTGSLDKSF+GTPK  K E+ +  E      K+SS F GT  KC GC+KTV
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENAI---KVSSAFAGTREKCFGCSKTV  117

Query  54   YPIEKVAVNGTAYHKACF  1
            YPIE+V VN T YHK+CF
Sbjct  118  YPIERVTVNNTMYHKSCF  135


 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG L+C
Sbjct  99   VSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFC  158

Query  231  RPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAE  133
            + H+ QL K  G+  +  +   KT ++  ++D E
Sbjct  159  KHHHTQLIKEKGNFSQLENDHDKTSQSAGSVDDE  192



>ref|XP_004236135.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=189

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD+R++HKACFRC HCKGTLKL N+NS+EGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSRVYHKACFRCNHCKGTLKLGNYNSYEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSL+KSF+G P+T  E+++D  K  A NK+S++F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLNKSFEGGPRTVKERSLD--KAQANNKVSALFGGTQDKCVACKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ CF
Sbjct  119  LEKVAVDGTSYHRPCF  134


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN+ + +  LYCR H+
Sbjct  102  FGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHDHKLYCRHHH  161

Query  219  DQLFKRTGSLDKSFD  175
             QLFK+ G+     D
Sbjct  162  TQLFKQRGNFSHMED  176



>ref|XP_008364385.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364386.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364388.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364390.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFA TTQKCTAC+KTVYLVDRLAAD+RI+HKACFRC+HCK TLKL N+ SFEGVLYCR
Sbjct  1    MASFASTTQKCTACEKTVYLVDRLAADSRIYHKACFRCHHCKSTLKLINYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PHYDQLFKRTGSLDKSF+GTPK   + A  + +      +S++F GT  KCVGC KTVYP
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKV-VKPARPSTENENAKSVSNLFAGTRDKCVGCEKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+VNGT YHK+CF
Sbjct  120  IEKVSVNGTPYHKSCF  135


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S+SN+   FAGT  KC  C+KTVY +++++ +   +HK+CF+C H   T+  SN+ + EG
Sbjct  98   SVSNL---FAGTRDKCVGCEKTVYPIEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEG  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLA  124
             LYC+ H+ QLFK  G+  +  +   K T TE+A   E  A
Sbjct  155  KLYCKHHHIQLFKEKGNYSQLENEHEKLTMTEQATHMEIAA  195



>sp|P29675.1|SF3_HELAN RecName: Full=Pollen-specific protein SF3 [Helianthus annuus]
 gb|AAD56958.1|AF187104_1 LIM domain protein PLIM1a [Helianthus annuus]
 emb|CAA45731.1| Transcription factor SF3 [Helianthus annuus]
Length=219

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKCT C+KTVYLVD+L A+ R++HKACFRC+HC  TLKLSNFNSF+GV+YCR
Sbjct  1    MKSFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
             H+DQLFKRTGSL+KSFDGTPK K E+    E  +A N++SS F GT  KC  C K VYP
Sbjct  61   HHFDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSA-NRLSSFFEGTRDKCNACAKIVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IE+V V+GTAYH+ACF
Sbjct  120  IERVKVDGTAYHRACF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC AC K VY ++R+  D   +H+ACF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FEGTRDKCNACAKIVYPIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK+ G+  +
Sbjct  163  IQLFKKKGNYSQ  174



>gb|AAD56957.1|AF187103_1 LIM domain protein PLIM1b [Helianthus annuus]
Length=214

 Score =   182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKCT C+KTVYLVD+L A+ R++HKACFRC+HC  TLKLSNFNSF+GV+YCR
Sbjct  1    MKSFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
             H+DQLFKRTGSL+KSFDGTPK K E+    E  +A N++SS F GT  KC  C K VYP
Sbjct  61   HHFDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSA-NRLSSFFEGTRDKCNACAKIVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IE+V V+GTAYH+ACF
Sbjct  120  IERVKVDGTAYHRACF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC AC K VY ++R+  D   +H+ACF+C H   T+  SN+ + EG LYC+ H+
Sbjct  103  FEGTRDKCNACAKIVYPIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK+ G+  +
Sbjct  163  IQLFKKKGNYSQ  174



>gb|AAX95760.2| Pollen-specific protein SF3, putative [Solanum lycopersicum]
Length=184

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 115/141 (82%), Gaps = 8/141 (6%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MASFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++ D     + +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQ---GSNSKVSSLFGGTQDKCVACKKTVYP  117

Query  48   IEK-----VAVNGTAYHKACF  1
            +EK     VAV+GT+YH+ CF
Sbjct  118  LEKTRAEQVAVDGTSYHRPCF  138


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = -2

Query  441  RSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDR-----LAADNRIFHKACFRCYHCKGT  277
            RS    S S +   F GT  KC AC KTVY +++     +A D   +H+ CF+C H    
Sbjct  87   RSADQGSNSKVSSLFGGTQDKCVACKKTVYPLEKTRAEQVAVDGTSYHRPCFKCSHGGCV  146

Query  276  LKLSNFNSFEGVLYCRPHYDQLFKRTGSLDKSFD  175
            +  SN+ + E  LYCR H+ QLFK  G+  +  D
Sbjct  147  ISPSNYVAHEHRLYCRHHHTQLFKERGNFSQMED  180



>ref|XP_006345025.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD+R++HK+CFRC HCKGTLKL N+NS+EGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSRVYHKSCFRCNHCKGTLKLGNYNSYEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSL+KSF+G P+T  E+++D  K  A NK+S++F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLNKSFEGGPRTVKERSLD--KAQAANKVSALFGGTQDKCVACKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ CF
Sbjct  119  LEKVAVDGTSYHRPCF  134


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN+ + +  LYCR H+
Sbjct  102  FGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCIISPSNYVAHDHKLYCRHHH  161

Query  219  DQLFKRTGSLDKSFD  175
             QLFK+ G+     D
Sbjct  162  TQLFKQRGNFSHMED  176



>ref|XP_009610584.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=189

 Score =   181 bits (460),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD++++HKACFRC+HCKGTLKLSN+NS+EGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSL+KSF+G P+T  E++ D  +  + +K+S++F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLNKSFEGAPRTARERSADQGQ--SNSKVSALFGGTQDKCVSCKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ACF
Sbjct  119  LEKVAVDGTSYHRACF  134


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   F GT  KC +C KTVY ++++A D   +H+ACF+C H    +  SN+ + + 
Sbjct  94   SNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDH  153

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H+ QLFK+ G+     D
Sbjct  154  KLYCRHHHTQLFKQRGNFSHMED  176



>ref|XP_010111544.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC31177.1| Pollen-specific protein SF3 [Morus notabilis]
Length=201

 Score =   181 bits (460),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC+HCK TLKLS+++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKRTLKLSDYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQL K TGSLDKSF+GTPKT  +++  A+++   +++S +F GT  KCV C KTVYP
Sbjct  61   PHFDQLLKMTGSLDKSFEGTPKTVRDRS--ADQIQTNSRVSRLFAGTQEKCVACKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YHKACF
Sbjct  119  IEKVAVDGTSYHKACF  134


 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ + E  L
Sbjct  96   SRVSRLFAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQRL  155

Query  237  YCRPHYDQLFKRTGS---LDKSFD  175
            YC+ H+ QLFK  G+   LDK  D
Sbjct  156  YCKHHHTQLFKAKGNFSQLDKHED  179



>gb|ABK23670.1| unknown [Picea sitchensis]
 gb|ABK26097.1| unknown [Picea sitchensis]
Length=191

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADN ++HK+CFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCKACEKTVYLVDQLTADNSVYHKSCFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF+  P+          +    N++S+MF GT  KCV C KTVYPI
Sbjct  61   HFDQLFKRTGSLDKSFEAIPRASRNDKTQENESKTPNRVSTMFSGTQDKCVACGKTVYPI  120

Query  45   EKVAVNGTAYHKACF  1
            EKVAV+GT+YH+ CF
Sbjct  121  EKVAVDGTSYHRPCF  135


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F+GT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN+ + EG LYCR H 
Sbjct  103  FSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRHHS  162

Query  219  DQLFKRTGSLDKSFDGTP-KTKTEKAID  139
             QLF+  G+  +   GTP K  TE   D
Sbjct  163  SQLFREKGNFSQLAKGTPTKGVTENTDD  190



>ref|XP_010091018.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB41829.1| Pollen-specific protein SF3 [Morus notabilis]
Length=196

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 113/137 (82%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKCTAC+KTVYLVD+L AD R +HKACFRC+HC+ TLKLS++ SFEGVLYCR
Sbjct  1    MASFAGTTQKCTACNKTVYLVDKLTADTRAYHKACFRCHHCRNTLKLSSYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSL+KSF+GTPK +K EK   +E       +SS+F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLEKSFEGTPKISKPEKPTTSENAKI---VSSLFGGTRDKCVGCNKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV VNGT YHK+CF
Sbjct  118  PIEKVTVNGTPYHKSCF  134


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C+KTVY ++++  +   +HK+CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  102  FGGTRDKCVGCNKTVYPIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  219  DQLFKRTGSLDK-SFDGTPKTKTEKAIDAEKLA  124
             QLFK  G+  +    G   + TEK    E +A
Sbjct  162  IQLFKEKGNYSQLEGIGENNSMTEKVPAVETVA  194



>ref|XP_007036120.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY20621.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=207

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 122/152 (80%), Gaps = 16/152 (11%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L AD++++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAID-AEKL--------------AAGNKISSMF  97
            PH+DQLFKRTGSLDKSF+GTPKT + +++ D A K+                 +++SS+F
Sbjct  61   PHFDQLFKRTGSLDKSFEGTPKTVRVDRSADHALKVVLPYLLLILSGTLQVTNSRVSSLF  120

Query  96   vgtttkcvgctktVYPIEKVAVNGTAYHKACF  1
             GT  KCV C KTVYPIEKVAV+G++YHKACF
Sbjct  121  AGTQEKCVACKKTVYPIEKVAVDGSSYHKACF  152


 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -2

Query  468  LLLQFLIIVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYH  289
            +L   L+I+   L ++ S +   FAGT +KC AC KTVY ++++A D   +HKACFRC H
Sbjct  97   VLPYLLLILSGTLQVTNSRVSSLFAGTQEKCVACKKTVYPIEKVAVDGSSYHKACFRCTH  156

Query  288  CKGTLKLSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
                +  SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  157  GGCVISPSNYVAHEQRLYCRHHHNQLFKQKGNFSQ  191



>gb|ABK22236.1| unknown [Picea sitchensis]
Length=187

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGT QKC AC+KTVY+VD+L AD  +FHKACFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTQQKCKACEKTVYVVDQLTADGSVFHKACFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFKRTGSLDKSF+GTPK  K EK  D E +   +++S++F GT  KC+ C  TVYP
Sbjct  61   HFDQLFKRTGSLDKSFEGTPKAVKNEKLNDGE-IKTPSRVSALFSGTQEKCLACGNTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            IEKV+V G  YHK CF
Sbjct  120  IEKVSVEGVGYHKQCF  135


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F+GT +KC AC  TVY +++++ +   +HK CF+C H    +  SN+ + EG L
Sbjct  97   SRVSALFSGTQEKCLACGNTVYPIEKVSVEGVGYHKQCFKCIHGGCVISPSNYIAIEGRL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPKTK  157
            YC+ H+ QLFK  G+  +    TP  K
Sbjct  157  YCKHHHAQLFKEKGNYSQLIK-TPSVK  182



>emb|CDP17006.1| unnamed protein product [Coffea canephora]
Length=190

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 114/136 (84%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC  C+KTVYLVD+L AD++++HK+CFRC+HC+GTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKTCEKTVYLVDQLQADSKVYHKSCFRCHHCRGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT     + A +    +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTARADRV-ANQGQTNSKVSSMFAGTQDKCVACKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT+YH+ACF
Sbjct  120  LEKVAVDGTSYHRACF  135


 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   FAGT  KC AC KTVY ++++A D   +H+ACFRC H    +  SN+ + +  L
Sbjct  97   SKVSSMFAGTQDKCVACKKTVYPLEKVAVDGTSYHRACFRCSHGGCMISPSNYIAHDHKL  156

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK+ G+  +
Sbjct  157  YCRHHHSQLFKKKGNFSQ  174



>ref|XP_008393059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 112/136 (82%), Gaps = 5/136 (4%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+  ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQXTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++         +K+SS+F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKTVRERSDQ-----TNSKVSSLFAGTQDKCVACKKTVYP  115

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YHK CF
Sbjct  116  IEKVAVDGTSYHKPCF  131


 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = -2

Query  444  VRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLS  265
            VR     + S +   FAGT  KC AC KTVY ++++A D   +HK CFRC H    +  S
Sbjct  84   VRERSDQTNSKVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCTHGGCVISPS  143

Query  264  NFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            N+ + E  LYCR H+ QLFK  G+  +
Sbjct  144  NYVAHEHRLYCRHHHSQLFKEKGNFSQ  170



>ref|XP_008374471.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   178 bits (452),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 113/136 (83%), Gaps = 5/136 (4%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGTTQKC AC+KTVYLVD+L ADN+I+HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKIYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSLDKSF+G PKT  E++         +K+S++F GT  KCV C KTVY 
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKTVRERSDQ-----TNSKVSNLFAGTQDKCVACKKTVYX  115

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YHK CF
Sbjct  116  IEKVAVDGTSYHKPCF  131


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = -2

Query  444  VRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLS  265
            VR     + S +   FAGT  KC AC KTVY ++++A D   +HK CFRC H    +  S
Sbjct  84   VRERSDQTNSKVSNLFAGTQDKCVACKKTVYXIEKVAVDGTSYHKPCFRCSHGGCVISPS  143

Query  264  NFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAE  133
            N+ + E  LYCR H+ QLFK  G+  +        +  +  DAE
Sbjct  144  NYVAHEHRLYCRHHHSQLFKEKGNFSQLSKHDEVKEVTENTDAE  187



>ref|XP_011044348.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   178 bits (451),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            +  FAGTTQKC +C+KTVY VD+L ADN+++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MAPFAGTTQKCKSCEKTVYFVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQL K TGSLDKSF GT KT       A+++ + +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFDQLLKMTGSLDKSFKGTSKT-VRGDRSADQVQSNSKVSSMFAGTQEKCVACKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +E+VAV+GT+YHKACF
Sbjct  120  LERVAVDGTSYHKACF  135


 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT +KC AC KTVY ++R+A D   +HKACFRC H    +  SNF + E 
Sbjct  95   SNSKVSSMFAGTQEKCVACKKTVYPLERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEH  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H++QLFK+ G+  + FD
Sbjct  155  RLYCRHHHNQLFKQKGNFSQ-FD  176



>ref|XP_002318024.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
 gb|EEE96244.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
Length=191

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            +  FAGTTQKC +C+KTVY VD+L AD++++HKACFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MAPFAGTTQKCKSCEKTVYFVDQLTADDKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQL K TGSLDKSF GT KT + +++  A+++ + +K+SSMF GT  KCV C KTVY
Sbjct  61   PHFDQLLKMTGSLDKSFKGTSKTVRVDRS--ADQVQSNSKVSSMFAGTQEKCVACKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIE+VAV+GT+YHKACF
Sbjct  119  PIERVAVDGTSYHKACF  135


 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 3/96 (3%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   FAGT +KC AC KTVY ++R+A D   +HKACFRC H    +  SNF + E 
Sbjct  95   SNSKVSSMFAGTQEKCVACKKTVYPIERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEH  154

Query  243  VLYCRPHYDQLFKRTGS---LDKSFDGTPKTKTEKA  145
             LYCR H++QLFK+ G+   LDK    TP  +T  A
Sbjct  155  RLYCRHHHNQLFKQKGNFSQLDKHEHVTPVKETAAA  190



>ref|XP_003550749.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN18484.1| Pollen-specific protein SF3 [Glycine soja]
Length=209

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKCTAC+K VY V++L ADN+++HK+CFRC+HCKGTLKLSN+ SFEGVLYC+
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+G P++ + E++  A+++ + NK+S +F GT  KCVGC KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPRSARVERS--ADQVQSNNKVSRLFSGTQEKCVGCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G +YHK+CF
Sbjct  119  PIEKVAVDGKSYHKSCF  135


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F+GT +KC  C KTVY ++++A D + +HK+CFRC H    +  SN+ + E  LYCR H+
Sbjct  103  FSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  219  DQLFKRTGS---LDKSFDGTPKTKTEKAIDAEKLAAGN  115
             QLFK+ G+   LDK  D      TE        + GN
Sbjct  163  TQLFKQKGNFSQLDK-HDSVQVVITENTTQHPDPSNGN  199



>ref|XP_009610583.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=190

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD++++HKACFRC+HCKGTLKLSN+NS+EGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFD-GTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSL+KSF+ G P+T  E++ D  +  + +K+S++F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLNKSFEVGAPRTARERSADQGQ--SNSKVSALFGGTQDKCVSCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKVAV+GT+YH+ACF
Sbjct  119  PLEKVAVDGTSYHRACF  135


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   F GT  KC +C KTVY ++++A D   +H+ACF+C H    +  SN+ + + 
Sbjct  95   SNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDH  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H+ QLFK+ G+     D
Sbjct  155  KLYCRHHHTQLFKQRGNFSHMED  177



>ref|XP_007143127.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
 gb|ESW15121.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
Length=187

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC ACDKTVYLVD+L AD R++HKACFRC+HC+ TLKLSN+ SFEGVLYCR
Sbjct  1    MASFGGTTQKCMACDKTVYLVDKLTADGRVYHKACFRCHHCRNTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQL+KRTGSLDKSF+GTPK  K EK I   + + G  ++++F+GT  KCV C KTVY
Sbjct  61   PHYDQLYKRTGSLDKSFEGTPKVQKPEKPITENENSKG--LANVFLGTRDKCVCCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P E+V +NGT YHK+CF
Sbjct  119  PTERVTINGTPYHKSCF  135


 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            L+N+   F GT  KC  C KTVY  +R+  +   +HK+CF+C +   T+  SNF + EG 
Sbjct  99   LANV---FLGTRDKCVCCKKTVYPTERVTINGTPYHKSCFKCTYGGCTISSSNFITHEGK  155

Query  240  LYCRPHYDQLFKRTGSLDK-SFDGTPKTK  157
            LYC+ H+ QLFK  G+  +   D  P T+
Sbjct  156  LYCKHHHIQLFKEKGNYSQLENDQVPTTE  184



>gb|AAD32870.1|AC005489_8 F14N23.8 [Arabidopsis thaliana]
Length=223

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 120/169 (71%), Gaps = 35/169 (21%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRP
Sbjct  1    MAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFD---------------------------------GTPKT-KTEK  148
            H+DQ FKRTGSL+KSF+                                 GTPK  K ++
Sbjct  61   HFDQNFKRTGSLEKSFEGKLPKTDQNVKSFVSGDFKFGIIYLKFDSYICTGTPKIGKPDR  120

Query  147  AIDAEKLAAGNKISSMFvgtttkcvgctktVYPIEKVAVNGTAYHKACF  1
             ++ E+  AG K+S+MF GT  KCVGC KTVYPIEKV+VNGT YHK+CF
Sbjct  121  PLEGER-PAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCF  168


 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -2

Query  435  PLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFN  256
            P    +SN+   F GT +KC  CDKTVY +++++ +  ++HK+CF+C H   T+  SN+ 
Sbjct  127  PAGTKVSNM---FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYI  183

Query  255  SFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDA  136
            + EG LYC+ H+ QL K  G+L +   G      +K + A
Sbjct  184  AHEGKLYCKHHHIQLIKEKGNLSQLEGGGENAAKDKVVAA  223



>gb|KDP44510.1| hypothetical protein JCGZ_16343 [Jatropha curcas]
Length=191

 Score =   176 bits (447),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 108/135 (80%), Gaps = 4/135 (3%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            SF GT QKC AC+KTVYLVD+LAADNRI+H+ CF+C+HCK TLKL N+ SFEGVLYCRPH
Sbjct  6    SFGGTQQKCMACEKTVYLVDKLAADNRIYHRTCFKCHHCKNTLKLGNYCSFEGVLYCRPH  65

Query  222  YDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            YDQLFKRTG L+KSF+G PK  K  K ID E     NK+S+ F GT  +CVGC+KT YPI
Sbjct  66   YDQLFKRTGCLNKSFEGIPKIAKPGKPIDVE---VANKVSNKFGGTRERCVGCSKTAYPI  122

Query  45   EKVAVNGTAYHKACF  1
            E+V VNGT YHK+CF
Sbjct  123  ERVTVNGTPYHKSCF  137


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = -2

Query  435  PLHLSLSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNF  259
            P+ + ++N + + F GT ++C  C KT Y ++R+  +   +HK+CF+C H   T+  SN+
Sbjct  92   PIDVEVANKVSNKFGGTRERCVGCSKTAYPIERVTVNGTPYHKSCFKCIHGGCTISPSNY  151

Query  258  NSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLA  124
             ++EG LYC+ H+ QLFK  G+         + ++EK I  E  A
Sbjct  152  IAYEGKLYCKHHHIQLFKERGNYS-------QLESEKIITVEIAA  189



>gb|ACA33841.1| LIM2 transcription factor [Pinus pinaster]
Length=182

 Score =   176 bits (445),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADN +FHK+CFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCKACEKTVYLVDQLTADNSVFHKSCFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF   P+      +   +    +++S++F GT  KCV C KTVYPI
Sbjct  61   HFDQLFKRTGSLDKSFAAIPRASRNDKMHENENRTPSRVSALFSGTQDKCVACGKTVYPI  120

Query  45   EKVAVNGTAYHKACF  1
            EKVAV+GT+YH+ CF
Sbjct  121  EKVAVDGTSYHRPCF  135


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F+GT  KC AC KTVY ++++A D   +H+ CF+C H    +  SN+ + EG L
Sbjct  97   SRVSALFSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRL  156

Query  237  YCRPHYDQLFKRTGSLDKSFDGTPK  163
            YCR H  QLF+  G+  +    TP+
Sbjct  157  YCRHHSSQLFREKGNFSQLSKATPQ  181



>ref|XP_009786244.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   176 bits (446),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 117/137 (85%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD++++HK+CFRC+HCKGTLKLSN+NS+EGVLYCR
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKSCFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFD-GTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSL+KSF+ G P+T  E++ D  +  + +K+S++F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLNKSFEVGAPRTARERSADQGQ--SNSKVSALFGGTQDKCVSCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKVAV+GT+YH+ACF
Sbjct  119  PLEKVAVDGTSYHRACF  135


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S +   F GT  KC +C KTVY ++++A D   +H+ACF+C H    +  SN+ + + 
Sbjct  95   SNSKVSALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDH  154

Query  243  VLYCRPHYDQLFKRTGSLDKSFD  175
             LYCR H+ QLFK+ G+     D
Sbjct  155  KLYCRHHHTQLFKQRGNFSHMED  177



>ref|XP_008453121.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=186

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTTQKC ACDKTVYLVD+L ADN+++HKACFRC+HCK TLKL N++SFEGVLYC+P
Sbjct  3    MAFLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKP  62

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK TGSL+KSF+GTP+T +T+++ +  ++   +K+SS+F GT  KCV C KTVYP
Sbjct  63   HFDQLFKMTGSLEKSFEGTPRTVRTDRSTN--QVQTNSKLSSLFAGTQDKCVTCKKTVYP  120

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+  +YH+ACF
Sbjct  121  IEKVAVDSKSYHRACF  136


 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C KTVY ++++A D++ +H+ACFRC H    +  SN+ + E  LYCR H+
Sbjct  104  FAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRHHH  163

Query  219  DQLFKRTGSLDK  184
            +QLFK+ G+  +
Sbjct  164  NQLFKQKGNFSQ  175



>ref|XP_004501954.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   176 bits (445),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKC AC+K VYLVD+L ADN+++HK+CFRC+HCKGTLKLSNF+SFEGVLYC+
Sbjct  1    MTSFAGTTQKCKACEKIVYLVDQLTADNKVYHKSCFRCHHCKGTLKLSNFSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK+TGSLDKSF+G P+T + E++ +  ++ + ++ S++F GT  KCV C +TVY
Sbjct  61   PHFDQLFKKTGSLDKSFEGIPRTSRVERSTN--QVQSNSQFSNLFAGTQEKCVACKRTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV V G +YHK CF
Sbjct  119  PIEKVGVYGISYHKGCF  135


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC AC +TVY ++++      +HK CFRC H    +  SN+ + E  LYCR H+
Sbjct  103  FAGTQEKCVACKRTVYPIEKVGVYGISYHKGCFRCNHGGCVISPSNYVAHEHRLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QLFK+ G   +
Sbjct  163  TQLFKQKGKFSQ  174



>ref|XP_010037591.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW49320.1| hypothetical protein EUGRSUZ_K02874 [Eucalyptus grandis]
Length=191

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F+GTTQKC AC+KTVY V++L ADN+++H+ CFRC+HCKGTLKLSN++SFEGVLYC+
Sbjct  1    MATFSGTTQKCKACEKTVYFVEQLTADNKVYHRTCFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSL+KSF+GTP+T  +    ++++   +K+S  F GT  KCV C KTVYP
Sbjct  61   PHFDQLFKMTGSLNKSFEGTPRTVNK----SDQVQTNSKVSRFFSGTQEKCVACKKTVYP  116

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+GT+YHKACF
Sbjct  117  IEKVAVDGTSYHKACF  132


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F+GT +KC AC KTVY ++++A D   +HKACFRC H    +  SN+ +    L
Sbjct  94   SKVSRFFSGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCSHGGCVISPSNYITHLNRL  153

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+ H++QLFK  G+  +
Sbjct  154  YCKHHHNQLFKVKGNFSQ  171



>ref|XP_004496871.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=181

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKCTAC+KTVYLVD+L AD R +H ACFRC+HC+ TLKLSN+ SFEGVLYCR
Sbjct  1    MASFAGTTQKCTACEKTVYLVDKLTADGRTYHMACFRCHHCRNTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PHYDQL+KRTGSLDKSFDGTPK +  +   +E   A   ++++FVGTT KC+ C KTVYP
Sbjct  61   PHYDQLYKRTGSLDKSFDGTPKIQKAEKQTSENENA-KTLANVFVGTTDKCMCCKKTVYP  119

Query  48   IEKVAVNGTAYHKACF  1
             E+V VNGT YHK CF
Sbjct  120  TERVTVNGTPYHKGCF  135


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            +L+N+   F GTT KC  C KTVY  +R+  +   +HK CF+C +   T+  +NF + E 
Sbjct  98   TLANV---FVGTTDKCMCCKKTVYPTERVTVNGTPYHKGCFKCTYGGCTISSANFVTHET  154

Query  243  VLYCRPHYDQLFKRTGSLDK  184
             LYC+ H+ QLFK  G+  +
Sbjct  155  KLYCKHHHIQLFKEKGNYSQ  174



>ref|XP_007155394.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
 gb|ESW27388.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
Length=204

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKCTAC+K VY V++L ADN+++HK+CFRC+HCKGTLKL N+ SFEGVLYC+
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKLYHKSCFRCHHCKGTLKLGNYCSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSL+KSF+G P+  + E++  A+++   NKIS +F GT  KCV C KTVY
Sbjct  61   PHFDQLFKMTGSLEKSFEGIPRIARVERS--ADQVQTNNKISRLFSGTQEKCVVCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G +YHK+CF
Sbjct  119  PIEKVAVDGKSYHKSCF  135


 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 1/89 (1%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLK  271
            + RS   +  +N I   F+GT +KC  C KTVY ++++A D + +HK+CFRC H    + 
Sbjct  86   VERSADQVQTNNKISRLFSGTQEKCVVCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVIS  145

Query  270  LSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             SN+ + E  LYCR H+ QLFK+ G+  +
Sbjct  146  PSNYVAHEHRLYCRHHHTQLFKQKGNFSQ  174



>ref|XP_004138126.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155009.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN63605.1| Pollen-specific protein SF3 [Cucumis sativus]
Length=186

 Score =   173 bits (439),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 115/136 (85%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTTQKC ACDKTVYLVD+L ADN+++HKACFRC+HCK TLKL N++SFEGVLYC+P
Sbjct  3    MAFLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKP  62

Query  225  HYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQLFK TGSL+KSF+ TP+T +T+++ +  ++   +K+SS+F GT  KCV C KTVYP
Sbjct  63   HFDQLFKMTGSLEKSFEATPRTVRTDRSTN--QVQTNSKLSSLFAGTQDKCVTCKKTVYP  120

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+  +YH+ACF
Sbjct  121  IEKVAVDSKSYHRACF  136


 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC  C KTVY ++++A D++ +H+ACFRC H    +  SN+ + E  LYCR H+
Sbjct  104  FAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRHHH  163

Query  219  DQLFKRTGSLDK  184
            +QLFK+ G+  +
Sbjct  164  NQLFKQKGNFSQ  175



>gb|KHG30571.1| Pollen-specific SF3 [Gossypium arboreum]
Length=151

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 4/128 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +FAGT QKC ACDKTVYLVD+L ADNR+FHKACFRC+HCKGTLKLSN+NSFEGVLYCR
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PHYDQLFKRTGSLDKSF+GTPK  K EK I+ E      K+ ++F GT  KCVGC KTVY
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIENEN---AQKVVNLFGGTKEKCVGCNKTVY  117

Query  51   PIEKVAVN  28
            PIEK   N
Sbjct  118  PIEKEKGN  125



>ref|XP_010678700.1| PREDICTED: LIM domain-containing protein WLIM1-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + +F GTTQKC AC+KTVYLVD+L AD ++FHKACFRC+HCK TLKL NF+SFEGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLTADGKVFHKACFRCHHCKSTLKLHNFSSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+ QLFK TGSLDKSF+  P+T  +++   E+    +K+SSMF GT  KCV C KTVYP
Sbjct  61   PHFAQLFKMTGSLDKSFEAAPRTVRDRSY--EQGQTNSKVSSMFGGTQEKCVSCKKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            IEKVAV+G +YHKACF
Sbjct  119  IEKVAVDGDSYHKACF  134


 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F GT +KC +C KTVY ++++A D   +HKACFRC H    +  SN+ + E  L
Sbjct  96   SKVSSMFGGTQEKCVSCKKTVYPIEKVAVDGDSYHKACFRCSHGGCVISPSNYVAHEHRL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YCR H+ QLFK+ G+  +
Sbjct  156  YCRHHHSQLFKQKGNFSQ  173



>ref|XP_003525489.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN48618.1| Pollen-specific protein SF3 [Glycine soja]
Length=215

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 4/137 (3%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKCTAC+K VY V++L ADN+++HK+CFRC+HCKGTLKLSN+ SFEGVLYC+
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+ QLFK TGSLDKSF+G P++ + E++ D       NK+S +F GT  KCVGC KTVY
Sbjct  61   PHFHQLFKMTGSLDKSFEGVPRSVRVERSADQ---VQTNKVSRLFSGTQEKCVGCKKTVY  117

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G +YHK+CF
Sbjct  118  PIEKVAVDGKSYHKSCF  134


 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RS   +  + +   F+GT +KC  C KTVY ++++A D + +HK+CFRC H    +  
Sbjct  86   VERSADQVQTNKVSRLFSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
            SN+ + E  LYCR H+ QLFK+ G+  +
Sbjct  146  SNYIAHEHRLYCRHHHTQLFKQKGNFSQ  173



>ref|XP_010928557.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=248

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +F GTTQKC AC+KTVYLVD+L AD R++HKACFRC+HCKGTLKLSN++S +GVLYC+PH
Sbjct  5    AFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQLFK TGSLDKSF+G+ ++      +  +  A  + SSMFVGT  KCV C KTVYPIE
Sbjct  65   YDQLFKMTGSLDKSFEGSSRSAKADRSNGHENTANRRFSSMFVGTQDKCVVCKKTVYPIE  124

Query  42   KVAVNGTAYHKACF  1
            KVAV+GT+YH+ CF
Sbjct  125  KVAVDGTSYHRPCF  138


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -2

Query  441  RSPLHLSLSNIIMS--FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            RS  H + +N   S  F GT  KC  C KTVY ++++A D   +H+ CF+C      +  
Sbjct  90   RSNGHENTANRRFSSMFVGTQDKCVVCKKTVYPIEKVAVDGTSYHRPCFKCSRGGCVISP  149

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDKSFD  175
            SN+ + EG LYC+ H+ QLF   G+  +  D
Sbjct  150  SNYIAHEGRLYCKHHHSQLFMAKGNFSQLED  180



>gb|KCW55096.1| hypothetical protein EUGRSUZ_I01055 [Eucalyptus grandis]
Length=177

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 102/135 (76%), Gaps = 18/135 (13%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKCTAC+KTVYLVD+L A++R++HKACFRC+HC GTLKL NFNSFEGVLYCRP
Sbjct  1    MAFAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQ+FKRTGSLDKSF+                   N++S+ F GT  KC  C KT YPI
Sbjct  61   HFDQIFKRTGSLDKSFE------------------ANRVSAFFAGTRDKCASCNKTAYPI  102

Query  45   EKVAVNGTAYHKACF  1
            EKV VNGT YHK CF
Sbjct  103  EKVTVNGTGYHKRCF  117


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT  KC +C+KT Y ++++  +   +HK CF+C H   T+  SN+ + EG LYC+ H+
Sbjct  85   FAGTRDKCASCNKTAYPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKHHH  144

Query  219  DQLFKRTGSL------DKSFDGTPKTKTE  151
             QLFK  G+       +K F+ T  T  E
Sbjct  145  TQLFKEKGNYSQLDTSNKQFEATKVTAVE  173



>ref|XP_009418011.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M F GTTQKC AC KTVYLVD+LAAD RI+H+ACFRC+HC+GTLK SN++S EGVLYC+P
Sbjct  4    MLFGGTTQKCQACRKTVYLVDQLAADGRIYHRACFRCHHCRGTLKFSNYSSIEGVLYCKP  63

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HYDQLFK TGSLDKSF+G PK+        ++  A ++ +S+F+GT  KCV C KTVYPI
Sbjct  64   HYDQLFKMTGSLDKSFEGAPKSAKIDRSSGQQGVANSRYASIFLGTRDKCVECKKTVYPI  123

Query  45   EKVAVNGTAYHKACF  1
            EKVAV+G +YH+ CF
Sbjct  124  EKVAVDGNSYHRPCF  138


 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY ++++A D   +H+ CFRC H   T+  SNF + EG LYC+ H+
Sbjct  106  FLGTRDKCVECKKTVYPIEKVAVDGNSYHRPCFRCTHGGCTISPSNFVTHEGRLYCKHHH  165

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAI  142
             QLF   G+   SF    + K E  +
Sbjct  166  AQLFMTKGNFS-SFTKVEEDKHEDIL  190



>ref|NP_001236461.1| uncharacterized protein LOC100306027 [Glycine max]
 gb|ACU14005.1| unknown [Glycine max]
Length=179

 Score =   171 bits (434),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC AC KTVYLVD+L AD+R++HKACFRCYHC+ TLKLSN+ SFEGVLYCR
Sbjct  1    MASFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCYHCRNTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNK----ISSMFvgtttkcvgctk  61
            PHYDQL+KRTGSLDKSF+G PK +       EK   GN+    ++++F+GT  KCV C K
Sbjct  61   PHYDQLYKRTGSLDKSFEGIPKIQ-----KPEKPVTGNENTKVLANVFLGTRDKCVCCNK  115

Query  60   tVYPIEKVAVNGTAYHKACF  1
            TVYP E+V VNGT YHK CF
Sbjct  116  TVYPTERVTVNGTPYHKGCF  135


 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            L+N+   F GT  KC  C+KTVY  +R+  +   +HK CF+C +   T+  SNF + EG 
Sbjct  99   LANV---FLGTRDKCVCCNKTVYPTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGK  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QLFK  G+  +
Sbjct  156  LYCKHHHIQLFKEKGNYSQ  174



>ref|XP_009415386.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=202

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 111/134 (83%), Gaps = 2/134 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GTTQKC AC KTVYLVD+LAAD RI+H+ACFRC+HCKGTLK SN++S +GVLYC+PHY
Sbjct  5    FGGTTQKCQACQKTVYLVDQLAADGRIYHRACFRCHHCKGTLKFSNYSSIDGVLYCKPHY  64

Query  219  DQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            DQLFK TGSLDK F+G PK +K +++I  + + A N+ S++F+GT  KCV C KTVYPIE
Sbjct  65   DQLFKMTGSLDKIFEGAPKSSKIDRSIGQQGI-ANNRYSTIFLGTQDKCVECKKTVYPIE  123

Query  42   KVAVNGTAYHKACF  1
            KVAV+G +YH+ CF
Sbjct  124  KVAVDGNSYHRPCF  137


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C KTVY ++++A D   +H+ CFRC H   T+  SNF + EG LYC+ H+
Sbjct  105  FLGTQDKCVECKKTVYPIEKVAVDGNSYHRPCFRCSHGGCTISPSNFITHEGRLYCKHHH  164

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKL  127
             QLF   G+   SF    +   +  + A+K+
Sbjct  165  AQLFMTKGNFS-SFSKVEEKNEDITLPADKV  194



>ref|XP_008793824.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Phoenix 
dactylifera]
Length=214

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +F GTTQKC AC+KTVYLVD+L AD R++HKACFRC+HCKGTLKLSN++S +GVLYC+PH
Sbjct  5    AFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQLFK TGSLDKSF+G+ ++      +  +  A ++  SMFVGT  KCV C KTVYPIE
Sbjct  65   YDQLFKMTGSLDKSFEGSSRSAKADRSNGHESNANSRFLSMFVGTQDKCVVCKKTVYPIE  124

Query  42   KVAVNGTAYHKACF  1
            KVA++GT+YH+ CF
Sbjct  125  KVALDGTSYHRPCF  138


 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = -2

Query  441  RSPLHLSLSN--IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            RS  H S +N   +  F GT  KC  C KTVY ++++A D   +H+ CF+C H    +  
Sbjct  90   RSNGHESNANSRFLSMFVGTQDKCVVCKKTVYPIEKVALDGTSYHRPCFKCSHGGCVISP  149

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDKSFD  175
            SN+ + +G LYC+ H+ QLF   G+  +  D
Sbjct  150  SNYIAHDGRLYCKHHHSQLFMAKGNFSQLED  180



>ref|XP_011071800.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Sesamum indicum]
Length=182

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGTTQKC AC+KTVYLVD+L AD +++HK CFRC+HCKGTLKLSN+ S+EGVLYC+
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADTKVYHKTCFRCHHCKGTLKLSNYCSYEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH++QLFK TGSLDKSF+G P+T        E+    +K SS+F GT  KCV C K VYP
Sbjct  61   PHFNQLFKMTGSLDKSFEGAPRT-ARADRSTEQAPTYSKFSSLFAGTQDKCVACNKKVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+G++YH+ CF
Sbjct  120  LEKVAVDGSSYHRTCF  135


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -2

Query  441  RSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSN  262
            ++P +   S++   FAGT  KC AC+K VY ++++A D   +H+ CF+C H    +  SN
Sbjct  92   QAPTYSKFSSL---FAGTQDKCVACNKKVYPLEKVAVDGSSYHRTCFKCSHSGCVISPSN  148

Query  261  FNSFEGVLYCRPHYDQLFKRTGSLDK  184
            + + E  LYCR H+ QLFK+ G+  +
Sbjct  149  YIAHEHRLYCRHHHTQLFKQKGNFSQ  174



>gb|EYU29934.1| hypothetical protein MIMGU_mgv1a014656mg [Erythranthe guttata]
Length=182

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            + GTTQKC AC+KTVYLVD+L ADN+++HK CFRC+HC  TLKLSN++S+EGVLYC+PH+
Sbjct  5    YGGTTQKCKACEKTVYLVDQLTADNKVYHKPCFRCHHCNATLKLSNYSSYEGVLYCKPHF  64

Query  219  DQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            DQLFK TGSLDKSF+G PKT + +++ D    AA +K SSMF GT  KCV C+KTVYP+E
Sbjct  65   DQLFKMTGSLDKSFEGGPKTSRIDRSTDHG--AANSKFSSMFAGTQDKCVACSKTVYPLE  122

Query  42   KVAVNGTAYHKACF  1
            KV V+G +YH+ CF
Sbjct  123  KVGVDGVSYHRPCF  136


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMS-FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLK  271
            I RS  H + ++   S FAGT  KC AC KTVY ++++  D   +H+ CF+C H    + 
Sbjct  87   IDRSTDHGAANSKFSSMFAGTQDKCVACSKTVYPLEKVGVDGVSYHRPCFKCSHGGCVIS  146

Query  270  LSNFNSFEGVLYCRPHYDQLFKRTGSLDK  184
             SN+ + E  LYCR H++QLFK+ G+  +
Sbjct  147  PSNYVAHEHQLYCRHHHNQLFKQKGNFSQ  175



>gb|AEA86290.1| transcription factor LIM [Solanum nigrum]
Length=119

 Score =   166 bits (420),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = -2

Query  381  KCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHYDQLFKR  202
            KC ACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL N+NSFEGVLYCRPH+DQLFK+
Sbjct  1    KCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHFDQLFKQ  60

Query  201  TGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIEKVAVNG  25
            TGSLDKSF+GTPK  K +K ID+EK     K++SMF GT  KC GC  TVYP EKV+VNG
Sbjct  61   TGSLDKSFEGTPKIVKPQKLIDSEKPQVA-KVTSMFGGTREKCFGCKNTVYPTEKVSVNG  119



>gb|KHN06818.1| Pollen-specific protein SF3 [Glycine soja]
Length=179

 Score =   168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 9/140 (6%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC AC KTVYLVD+L AD+R++HKACFRC+HC  TLKLSN+ SFEGVLYCR
Sbjct  1    MASFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCHHCGNTLKLSNYCSFEGVLYCR  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNK----ISSMFvgtttkcvgctk  61
            PHYDQL+KRTGSLDKSF+G PK +       EK   GN+    ++++F+GT  KCV C K
Sbjct  61   PHYDQLYKRTGSLDKSFEGIPKIQ-----KPEKPVTGNENTKVLANVFLGTRDKCVCCNK  115

Query  60   tVYPIEKVAVNGTAYHKACF  1
            TVYP E+V VNGT YHK CF
Sbjct  116  TVYPTERVTVNGTPYHKGCF  135


 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            L+N+   F GT  KC  C+KTVY  +R+  +   +HK CF+C +   T+  SNF + EG 
Sbjct  99   LANV---FLGTRDKCVCCNKTVYPTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGK  155

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ H+ QLFK  G+  +
Sbjct  156  LYCKHHHIQLFKEKGNYSQ  174



>ref|XP_009389653.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GTT KCTAC KTVYLV++L ADNR++HKACFRC+HCKGTLKL N+NSFEGVLYCRP
Sbjct  1    MAFQGTTTKCTACTKTVYLVEKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  60

Query  225  HYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H+DQ++K TGSLDKSF+GTPK  K EK +D E     NK+SS F GT  KCVGC KTVYP
Sbjct  61   HFDQIYKSTGSLDKSFEGTPKVVKPEKFVDNEN---ANKVSSAFAGTREKCVGCKKTVYP  117

Query  48   IEKVAVNGTAYHKACF  1
            IE+V VNGTAYHK+CF
Sbjct  118  IERVTVNGTAYHKSCF  133


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +FAGT +KC  C KTVY ++R+  +   +HK+CF+C H   T+  SN+ + EG LYC
Sbjct  97   VSSAFAGTREKCVGCKKTVYPIERVTVNGTAYHKSCFKCSHGGCTISPSNYIAHEGTLYC  156

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKA  145
            + H+ QL K+ G+  K  D   KT  E A
Sbjct  157  KHHHIQLIKQKGNYSKLEDEKEKTSDEAA  185



>ref|XP_010913501.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=202

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +F  TTQKC AC+KTVYLVD+L AD RI+HKACFRC+HCKGTL+LSN++S +GVLYC+PH
Sbjct  5    AFGRTTQKCKACEKTVYLVDQLTADGRIYHKACFRCHHCKGTLRLSNYSSIDGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQLFK TGSLDKSF+  P++         +  A ++ SSMFVGT  KCV C KTVYPIE
Sbjct  65   YDQLFKMTGSLDKSFEDAPRSARADRSSGHESNANSRFSSMFVGTQDKCVVCKKTVYPIE  124

Query  42   KVAVNGTAYHKACF  1
            KVAV+GT+ H+ CF
Sbjct  125  KVAVDGTSCHRPCF  138


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -2

Query  441  RSPLHLSLSNIIMS--FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            RS  H S +N   S  F GT  KC  C KTVY ++++A D    H+ CF+C H    +  
Sbjct  90   RSSGHESNANSRFSSMFVGTQDKCVVCKKTVYPIEKVAVDGTSCHRPCFKCSHGGCVISP  149

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDKSFD  175
            SN+ + EG +YC+ H+ QLF   G+  +  D
Sbjct  150  SNYVAHEGKVYCKHHHSQLFMIKGNFSQLQD  180



>ref|XP_004508840.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SF GTTQKC  C+K VY V++L ADN+++HK+CF+C+HCKGTLKLSN+ S+EGVLYC+
Sbjct  1    MASFTGTTQKCKVCEKKVYWVEQLTADNKVYHKSCFKCHHCKGTLKLSNYCSYEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPK-TKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSLDKSF+G  +  + E++  A+++ A  K+S +F+GT  KCVGC KTVY
Sbjct  61   PHFDQLFKMTGSLDKSFEGIARIARFERS--ADQVQANKKVSRLFIGTQEKCVGCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKV V+G +YHK+CF
Sbjct  119  PIEKVGVDGKSYHKSCF  135


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C KTVY ++++  D + +HK+CFRC H    +  SN+ + E  LYCR H+
Sbjct  103  FIGTQEKCVGCKKTVYPIEKVGVDGKSYHKSCFRCTHGGCVISPSNYVTHEHSLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
            +QLFK  G+  +
Sbjct  163  NQLFKHKGNFSQ  174



>ref|XP_003608956.1| LIM domain protein [Medicago truncatula]
 gb|AES91153.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=181

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGT QKC  C+K VY V++L ADN++FHK+CFRC+HCKGTLKLSN+ SFE VLYC+
Sbjct  1    MASFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSL KSF+G  +  + E++ D  ++ A NK+S  F GT  KCVGC KTVY
Sbjct  61   PHFDQLFKMTGSLYKSFEGITRIYRVERSTD--QVQAYNKVSRFFAGTQEKCVGCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G +YHK CF
Sbjct  119  PIEKVAVDGESYHKNCF  135


 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C KTVY ++++A D   +HK CFRC H    +  SN+ + E  LYCR H+
Sbjct  103  FAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRHHH  162

Query  219  DQLFKRTGSLDKSFD  175
             Q+FK+ G+  + FD
Sbjct  163  TQIFKQKGNFSQ-FD  176



>gb|AFK42303.1| unknown [Medicago truncatula]
Length=181

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 3/137 (2%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + SFAGT QKC  C+K VY V++L ADN++FHK+CFRC+HCKGTLKLSN+ SFE VLYC+
Sbjct  1    MASFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            PH+DQLFK TGSL KSF+G  +  + E++ D  ++ A NK+S  F GT  KCVGC KTVY
Sbjct  61   PHFDQLFKMTGSLYKSFEGITRIYRVERSTD--QVQAYNKVSRFFAGTQEKCVGCKKTVY  118

Query  51   PIEKVAVNGTAYHKACF  1
            PIEKVAV+G +YHK CF
Sbjct  119  PIEKVAVDGESYHKNCF  135


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            FAGT +KC  C KTVY ++++A D   +HK CFRC H    +  SN+ + E  LYCR H+
Sbjct  103  FAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRRHH  162

Query  219  DQLFKRTGSLDKSFD  175
             Q+FK+ G+  + FD
Sbjct  163  TQIFKQKGNFSQ-FD  176



>gb|EYU42534.1| hypothetical protein MIMGU_mgv1a021971mg [Erythranthe guttata]
Length=188

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -2

Query  408  IMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCR  229
            + ++ GT QKC  C KTVYLVD+L ADN+++H  CFRC+HCKGTLKLSN++S+EGVLYC+
Sbjct  1    MANYGGTNQKCKTCYKTVYLVDQLTADNKVYHNFCFRCHHCKGTLKLSNYSSYEGVLYCK  60

Query  228  PHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYP  49
            PH+DQLFK TGSL+KSF+G PKT   +  + E+    +K SS+F GT  KC+ C K VYP
Sbjct  61   PHFDQLFKMTGSLNKSFEGAPKTARAERSN-EQGPTNSKFSSLFGGTQDKCIACDKKVYP  119

Query  48   IEKVAVNGTAYHKACF  1
            +EKVAV+GT YH+ CF
Sbjct  120  LEKVAVDGTLYHRCCF  135


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC ACDK VY ++++A D  ++H+ CF+C H    +  SN+ + E  LYCR H+
Sbjct  103  FGGTQDKCIACDKKVYPLEKVAVDGTLYHRCCFKCSHGGCVISPSNYIAHEHRLYCRHHH  162

Query  219  DQLFKRTGSLDK  184
             QLF++ G+  K
Sbjct  163  TQLFRQKGNFSK  174



>gb|EEC69362.1| hypothetical protein OsI_38483 [Oryza sativa Indica Group]
Length=132

 Score =   159 bits (402),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 82/91 (90%), Gaps = 1/91 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYCRPH
Sbjct  4    SFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPH  63

Query  222  YDQLFKRTGSLDKSFDGTPK-TKTEKAIDAE  133
            +DQLFKRTGSLDKSF+GTPK  K EK ++ E
Sbjct  64   FDQLFKRTGSLDKSFEGTPKVVKPEKTVENE  94



>gb|EPS69807.1| hypothetical protein M569_04956, partial [Genlisea aurea]
Length=88

 Score =   157 bits (397),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 81/86 (94%), Gaps = 1/86 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +FAGTTQKCTACDKTVYLVD+L ADNR++HKACFRC+HC GTLKL N+NSFEGVLYCRPH
Sbjct  1    AFAGTTQKCTACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLGNYNSFEGVLYCRPH  60

Query  222  YDQLFKRTGSLDKSFDGTPK-TKTEK  148
            +DQLFKRTGSLDKSF+GTPK  KT+K
Sbjct  61   FDQLFKRTGSLDKSFEGTPKIVKTDK  86



>gb|EMT23508.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=240

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 112/179 (63%), Gaps = 42/179 (23%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGT---------------------------PKT---KTEKAI  142
            RPH+DQLFKRTGSLDKSF+ +                           PK     T K I
Sbjct  61   RPHFDQLFKRTGSLDKSFEESNGGMLIQALQRLSSQKGMLGMRWSTIVPKMIQKHTPKII  120

Query  141  D------------AEKLAAGNKISSMFvgtttkcvgctktVYPIEKVAVNGTAYHKACF  1
                         A +L    K+SS F GT  KC GC+KTVYPIE+V VN T YHK+CF
Sbjct  121  QNIHRFFFFFSNHATELHNATKVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCF  179


 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 58/91 (64%), Gaps = 1/91 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +FAGT +KC  C KTVY ++R+  +N ++HK+CF+C H   T+  SN+ + EG L+C+ H
Sbjct  146  AFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKHH  205

Query  222  YDQLFKRTGSLDKSFDGTPKT-KTEKAIDAE  133
            + QL K  G+  +  +   KT ++  ++D E
Sbjct  206  HTQLIKEKGNFSQLENDHDKTSQSAGSVDDE  236



>gb|EMS67160.1| Pollen-specific protein SF3 [Triticum urartu]
Length=188

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 10/137 (7%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KC ACDKTVYLVD+L ADNR++HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            RPH+DQLFKRTGSLDKSF+ +      +A+  ++L++   +  M             T  
Sbjct  61   RPHFDQLFKRTGSLDKSFEESNGGMLIQAL--QRLSSRKGMLGM--------SALIMTPA  110

Query  51   PIEKVAVNGTAYHKACF  1
            P  +V VN T YHK+CF
Sbjct  111  PTLQVTVNNTMYHKSCF  127


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (53%), Gaps = 15/99 (15%)
 Frame = -2

Query  426  LSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFE  247
            L +S +IM+ A T Q              +  +N ++HK+CF+C H   T+  SN+ + E
Sbjct  100  LGMSALIMTPAPTLQ--------------VTVNNTMYHKSCFKCCHGGCTISPSNYIAHE  145

Query  246  GVLYCRPHYDQLFKRTGSLDKSFDGTPKT-KTEKAIDAE  133
            G L+C+ H+ QL K  G+  +  +   KT ++  ++D E
Sbjct  146  GKLFCKHHHTQLIKEKGNFSQLENDHDKTSQSAGSVDDE  184



>gb|ACA33852.1| LIM2 transcription factor [Pinus taeda]
Length=122

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FAGTTQKC AC+KTVYLVD+L ADN +FHK+CFRC+HC GTLKLSN++SFEGVLYC+P
Sbjct  1    MAFAGTTQKCKACEKTVYLVDQLTADNSVFHKSCFRCHHCNGTLKLSNYSSFEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFKRTGSLDKSF   P+      +   +    +++S++F GT  KCV C KTVYPI
Sbjct  61   HFDQLFKRTGSLDKSFAAIPRASRNDKMHENENRTPSRVSALFSGTQDKCVACGKTVYPI  120

Query  45   EK  40
            EK
Sbjct  121  EK  122



>ref|XP_002965335.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
 ref|XP_002977179.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ21788.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ34173.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
Length=185

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
             SFAGT QKC ACDKTVYLVD+L AD  ++HKACFRC+HCKGTLKLSN+ S EGVLYC+P
Sbjct  4    FSFAGTQQKCKACDKTVYLVDQLTADGVVYHKACFRCHHCKGTLKLSNYASLEGVLYCKP  63

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFK TGS DKSF+        K +  E     +K S +F GT  KC  C KTVYPI
Sbjct  64   HFDQLFKLTGSFDKSFESGL---LHKPVGEEASKTPSKTSLLFSGTQEKCFACGKTVYPI  120

Query  45   EKVAVNGTAYHKACF  1
            EKV V  T+YHK+CF
Sbjct  121  EKVTVENTSYHKSCF  135


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S   + F+GT +KC AC KTVY ++++  +N  +HK+CF+C H   T+  SN+ + EG L
Sbjct  97   SKTSLLFSGTQEKCFACGKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPSNYQAHEGRL  156

Query  237  YCRPHYDQLFKRTGSLD  187
            YCR HY QL K  G   
Sbjct  157  YCRHHYAQLVKEKGDFS  173



>ref|XP_002969252.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
 gb|EFJ29340.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
Length=194

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FA   QKC +C+KTVYLVD+L+AD  ++HKACFRC HCKGTLKLSN+ S EGVLYC+P
Sbjct  1    MAFAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFD--GTPKTKTEKAIDAEKLAAG---NKISSMFvgtttkcvgctk  61
            H +QLF++TGS DKSFD  GTPK   ++  + E + +    +K+S +F GT  KCV C+K
Sbjct  61   HLEQLFRKTGSFDKSFDSVGTPKNSLKQERERETVPSKPVVSKLSRLFSGTQEKCVSCSK  120

Query  60   tVYPIEKVAVNGTAYHKACF  1
            TVYP+EKV+V G +YHK+CF
Sbjct  121  TVYPLEKVSVEGQSYHKSCF  140


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            +S +   F+GT +KC +C KTVY +++++ + + +HK+CF+C H    +  SN+ + EG+
Sbjct  101  VSKLSRLFSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGM  160

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ HY QLF   G+  +
Sbjct  161  LYCKHHYSQLFMEKGNYSQ  179



>ref|XP_008793825.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Phoenix 
dactylifera]
Length=133

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            +F GTTQKC AC+KTVYLVD+L AD R++HKACFRC+HCKGTLKLSN++S +GVLYC+PH
Sbjct  5    AFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQLFK TGSLDKSF+G+ ++      +  +  A ++  SMFVGT  KCV C KTVYPIE
Sbjct  65   YDQLFKMTGSLDKSFEGSSRSAKADRSNGHESNANSRFLSMFVGTQDKCVVCKKTVYPIE  124

Query  42   KV  37
            KV
Sbjct  125  KV  126



>gb|ACU17588.1| unknown [Glycine max]
Length=139

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY VD+L+AD   +HKACF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TGS  K+F    K   +     E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQAVK--TTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYH  289
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSH  137



>ref|XP_001765937.1| predicted protein [Physcomitrella patens]
 gb|EDQ69258.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GTTQKC AC+KTVYLV++L AD  ++HK+CFRC HCKGTLKL+N+ S EGVLYC+P
Sbjct  1    MAFSGTTQKCKACEKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLANYASLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QL K TGS DKSF+  P    +KA   E  A  +K S MF GT  KC+ C+KTVYPI
Sbjct  61   HFEQLLKVTGSFDKSFEHKPSEGLKKAEKGENKAP-SKASLMFSGTQEKCIACSKTVYPI  119

Query  45   EKVAVNGTAYHKACF  1
            EK  V G  YHK CF
Sbjct  120  EKTTVEGLPYHKQCF  134


 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S   + F+GT +KC AC KTVY +++   +   +HK CF+C H   T+  SN+ + EG L
Sbjct  96   SKASLMFSGTQEKCIACSKTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPSNYAALEGRL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+PHY QLFK  G+  +
Sbjct  156  YCKPHYSQLFKEKGNYSQ  173



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY VD+L+AD   +HKACF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TGS  K+F    K   +     E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGSFKKNFQSPAKQAVK--TTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EGVLYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGVLYCKHHFSQLFKEKGSYN  171



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC ACDKTVYL+D+L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF  +P    EK+ + E   + +K + MF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQ-SPAKSAEKS-NPELTRSRSKAAGMFSGTLEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F+GT +KC  C KT Y ++++  + + +HK+CFRC H    +  SN+ + EG+LYC+ H+
Sbjct  101  FSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHF  160

Query  219  DQLFKRTGSLD  187
             QLFK  GS +
Sbjct  161  SQLFKEKGSYN  171



>gb|AFW74662.1| putative LIM-type zinc finger domain family protein [Zea mays]
Length=92

 Score =   150 bits (378),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  SF GTT KCTACDKTVYLVD+L ADNRI+HKACFRC+HCKGTLKL+N+NSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDG  172
            RPH+DQLFKRTGSLDKSF+G
Sbjct  61   RPHFDQLFKRTGSLDKSFEG  80



>gb|AAZ95169.1| putative transcription factor LIM [Brassica rapa]
Length=113

 Score =   150 bits (380),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = -2

Query  351  LVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDG  172
            LVD+L ADNR++HKACFRC+HCKGTLKLSN+NSFEGVLYCRPH+DQ FKRTGSL+KSF+G
Sbjct  1    LVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTGSLEKSFEG  60

Query  171  TPKT-KTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIEKVAVNGTAY  16
            TPK  K ++ ++ E+  AG K+S+MF GT  KCVGC KTVYPIEKV+VNGT Y
Sbjct  61   TPKIGKPDRPLEGER-PAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLY  112



>gb|EEE65408.1| hypothetical protein OsJ_20745 [Oryza sativa Japonica Group]
Length=268

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            ++ GTTQKC +C +TVY V+ LAAD R++H+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  5    AWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKATLQFSNYSSVEGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQ+ K TGSL+KSF+GT K+   +  +  K    N+ SSMFVGT  KCV C KTVYP+E
Sbjct  65   YDQILKSTGSLEKSFEGTSKSAKAEKSNGNK-GQPNRFSSMFVGTQDKCVVCNKTVYPLE  123

Query  42   KVAVNGTAYHKACF  1
            KV +NG++YHK+CF
Sbjct  124  KVNLNGSSYHKSCF  137


 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C+KTVY ++++  +   +HK+CFRC H   TL  SN  + EG LYC+ H+
Sbjct  105  FVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHH  164

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
             QLF   G+     D TP  K    +D EK
Sbjct  165  SQLFMVKGNFSNFEDSTPNAK----VDIEK  190



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC AC+KTVYL+D+L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF  +P    EK +  E   + +K + MF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQ-SPAKSAEK-LTPELTRSPSKAAGMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAAGMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC AC+KTVYL+D+L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF  +P    EK +  E   + +K + MF GT  KCV C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQ-SPAKSAEK-LTPELTRSPSKAAGMFSGTQEKCVACGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC AC KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAAGMFSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>gb|EYU19976.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
 gb|EYU19977.1| hypothetical protein MIMGU_mgv1a014151mg [Erythranthe guttata]
Length=199

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GTTQKC AC+KTVY V+ L+AD   FHK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFLGTTQKCKACEKTVYHVELLSADGISFHKSCFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TGS  K+F  +P    EK+   E   + +K + MF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGSFTKNFT-SPAKSAEKSSTPEMTRSPSKAAGMFSGTQDKCATCAKTAYPL  119

Query  45   EKVAVNGTAYHKACF  1
            EKV V   +YHK+CF
Sbjct  120  EKVTVENQSYHKSCF  134


 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT  KC  C KT Y ++++  +N+ +HK+CF+C H   +L  
Sbjct  91   MTRSP-----SKAAGMFSGTQDKCATCAKTAYPLEKVTVENQSYHKSCFKCSHGGCSLTP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + +G+LYC+PH+ QLFK  GS +
Sbjct  146  SNYAALDGILYCKPHFSQLFKEKGSYN  172



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK +GS  K+F  +P    +K    E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HYEQLFKESGSFSKNFQ-SPAKLADKTTP-ELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GT QKC ACDKTVY VD+L+AD   +HK+CFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLF+ +G+ +K+F     +K    +  E   + +K+S MF GT  KC  C KT YP+
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKVIDGLSPELTRSPSKVSMMFSGTQDKCATCGKTAYPL  120

Query  45   EKVAVNGTAYHKACF  1
            EKV V   +YHK+CF
Sbjct  121  EKVTVESLSYHKSCF  135


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S + M F+GT  KC  C KT Y ++++  ++  +HK+CF+C H   ++  
Sbjct  92   LTRSP-----SKVSMMFSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISP  146

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  147  SNYAALEGILYCKHHFSQLFKEKGSYN  173



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TG+  K+F  +P    +K    E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGTFSKNFQ-SPAKLADKTTP-ELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC ACDKTVYL+D+L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF  +P    EK    E   + +K + MF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQ-SPAKPAEKPTP-ELTRSRSKAAGMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK CF
Sbjct  119  EKVTVEGQAYHKFCF  133


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F+GT +KC  C KT Y ++++  + + +HK CFRC H   ++  SN+ + EG+LYC+ H+
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHF  160

Query  219  DQLFKRTGSLD  187
             QLFK  GS +
Sbjct  161  SQLFKEKGSYN  171



>emb|CBL95262.1| lim domain protein [Pinus pinaster]
Length=197

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F GT QKC ACDKTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MAFTGTQQKCKACDKTVYFVDQLSADGVSYHKACFRCNHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLF+ +G+ +K+F     +K    +  E   + +K+S MF GT  KC  C KT YP+
Sbjct  61   HFDQLFRESGNFNKNFQSQRSSKAIDGLQPEMTRSPSKVSMMFFGTQDKCGTCGKTAYPL  120

Query  45   EKVAVNGTAYHKACF  1
            EKV V   ++HK+CF
Sbjct  121  EKVTVGNLSFHKSCF  135


 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S + M F GT  KC  C KT Y ++++   N  FHK+CFRC H   ++  
Sbjct  92   MTRSP-----SKVSMMFFGTQDKCGTCGKTAYPLEKVTVGNLSFHKSCFRCSHGGCSISP  146

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  147  SNYAALEGILYCKHHFSQLFKEKGSYN  173



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK +GS  K+F  +P    +K    E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKESGSFSKNFQ-SPAKLADKTTH-ELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK +GS  K+F  +P    +K    E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKESGSFSKNFQ-SPAKLADKTTH-ELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G AYHK+CF
Sbjct  119  EKVTVEGQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC AC+KTVY++D+L+AD  ++HK+CF+C HCKGTLKL N++S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF  +P    EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQ-SPAKSVEK-LTPELTRSPSKAASMFSGTQDKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   +YHK+CF
Sbjct  119  EKVTVESQSYHKSCF  133


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT  KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            S + + EG+LYC+ H+ QLFK  GS +
Sbjct  145  STYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC  CDKTVY+VD L+AD   +HK+CF+C HCKGTL +SN++S EGVLYC+P
Sbjct  1    MAFSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +KSF   PK+  +K  D  +  A +K+SS+F GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKSFQLPPKS-ADKQHDLAR--APSKLSSLFSGTQDKCATCYKTAYPL  117

Query  45   EKVAVNGTAYHKACF  1
            EKV V G +YHK+CF
Sbjct  118  EKVTVEGESYHKSCF  132


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 5/109 (5%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + R+P  LS       F+GT  KC  C KT Y ++++  +   +HK+CF+C H    L  
Sbjct  89   LARAPSKLS-----SLFSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTP  143

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAA  121
            S + + +G+LYC+ H+ QLFK  G+ +         +    I AE+ AA
Sbjct  144  STYAALDGILYCKHHFAQLFKEKGNYNHLIKTASMKRNAALIPAEEAAA  192



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY V++L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TGS +K+F  +P    EK ++ E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGSFNKNFQ-SPAKSAEK-LNPELTRSPSKAASMFSGTQDKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V    YHK+CF
Sbjct  119  EKVTVESLTYHKSCF  133


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT  KC  C KT Y ++++  ++  +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EGVLYC+ H+ QLFK  G+ +
Sbjct  145  SNYAALEGVLYCKHHFAQLFKEKGNYN  171



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 3/137 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +F GT QKC ACDKTVYL+D+L AD  +FHK+CF+C HCKGTL LS ++S EGVLYC
Sbjct  1    MAFNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            +PH++QLFK +G+ +K+F  +P    EKA +  +  + +K +SMF GT  KC  C KT Y
Sbjct  61   KPHFEQLFKESGNFNKNFQ-SPAKSAEKAPELTR--SPSKAASMFSGTQEKCATCAKTAY  117

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKV V G AYHK+CF
Sbjct  118  PLEKVTVEGQAYHKSCF  134


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H   ++  
Sbjct  91   LTRSP-----SKAASMFSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  146  SNYAALEGILYCKHHFSQLFKEKGSYN  172



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = -2

Query  411  IIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYC  232
            +  +F GT QKC ACDKTVYL+D+L AD  +FHK+CF+C HCKGTL LS ++S EGVLYC
Sbjct  1    MAFNFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYC  60

Query  231  RPHYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVY  52
            +PH++QLFK +G+ +K+F  +P    EKA +  +  + +K +SMF GT  KC  CTKT Y
Sbjct  61   KPHFEQLFKESGNFNKNFQ-SPAKSAEKAPELTR--STSKAASMFSGTQEKCATCTKTAY  117

Query  51   PIEKVAVNGTAYHKACF  1
            P+EKV V G AYHK+CF
Sbjct  118  PLEKVTVEGQAYHKSCF  134


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  423  SLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEG  244
            S S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H   ++  SN+ + EG
Sbjct  94   STSKAASMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEG  153

Query  243  VLYCRPHYDQLFKRTGSLD  187
            +LYC+ H+ QLFK  GS +
Sbjct  154  ILYCKHHFSQLFKEKGSYN  172



>ref|XP_010227809.1| PREDICTED: enolase-phosphatase E1-like [Brachypodium distachyon]
Length=1414

 Score =   159 bits (401),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            ++ GTTQKC AC +TVY V+ LAAD R +H+ CFRC+HCK TL+ SN++S EGVLYC+PH
Sbjct  4    AWGGTTQKCAACGRTVYPVEELAADGRAYHRPCFRCHHCKSTLQFSNYSSIEGVLYCKPH  63

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQ+ K TGSLDKSF+G  ++   +  +  K+   ++ SSMFVGT  KCV C KTVYP+E
Sbjct  64   YDQILKSTGSLDKSFEGVTRSAKSENSNGHKVLKSSRFSSMFVGTQEKCVVCNKTVYPLE  123

Query  42   KVAVNGTAYHKACF  1
            KV +NG +YHK+CF
Sbjct  124  KVDLNGGSYHKSCF  137


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 6/104 (6%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT +KC  C+KTVY ++++  +   +HK+CFRC H   TL  SN  + EG LYC+ H+
Sbjct  105  FVGTQEKCVVCNKTVYPLEKVDLNGGSYHKSCFRCTHGGCTLSPSNHITHEGKLYCKTHH  164

Query  219  DQLFKRTGSLDKSFDGTP------KTKTEKAIDAEKLAAGNKIS  106
             QLF   G+  +  + T       K + E   D +K + G+ ++
Sbjct  165  SQLFMVKGNFSQFEENTVNAKVALKKQEETEGDTKKPSQGDGLT  208



>ref|XP_002960609.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
 gb|EFJ38148.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
Length=180

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 103/135 (76%), Gaps = 9/135 (7%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+FA   QKC +C+KTVYLVD+L+AD  ++HKACFRC HCKGTLKLSN+ S EGVLYC+P
Sbjct  1    MAFAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H +QLF++TGS DKSFD + K  ++  +        +K+S +F GT  KCV C+KTVYP+
Sbjct  61   HLEQLFRKTGSFDKSFD-SGKVPSKPVV--------SKLSRLFSGTQEKCVSCSKTVYPL  111

Query  45   EKVAVNGTAYHKACF  1
            EKV+V G +YHK+CF
Sbjct  112  EKVSVEGQSYHKSCF  126


 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  420  LSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGV  241
            +S +   F+GT +KC +C KTVY +++++ + + +HK+CF+C H    +  SN+ + EG+
Sbjct  87   VSKLSRLFSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGM  146

Query  240  LYCRPHYDQLFKRTGSLDK  184
            LYC+ HY QLF   G+  +
Sbjct  147  LYCKHHYSQLFMEKGNYSQ  165



>ref|XP_008392902.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_008392903.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Malus 
domestica]
 ref|XP_009351060.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Pyrus x bretschneideri]
Length=200

 Score =   148 bits (373),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY V+ L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P  K+ + +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPL  119

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  120  EKVTVESQAYHKSCF  134


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT  KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  91   LTRSP-----SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  146  SNYAALEGILYCKHHFSQLFKEKGSYN  172



>ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like 
[Cucumis sativus]
Length=195

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY VD+L+AD   FHK+CF+C HCKGTLKLSN++S +GVLYC+P
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+  K+F  +P   +EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFSKNFL-SPAKSSEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H   +L  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + +G+L C+ H+ QLFK  GS +
Sbjct  145  SNYAALDGILXCKHHFSQLFKEKGSYN  171



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (75%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC  C+KTVY V++L+AD  ++HK+CF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK +G+ +K+F  +P    EK +  E   + +K +SMF GT  KC  C+KTVYP+
Sbjct  61   HFEQLFKESGNFNKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCASCSKTVYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKVAV   AYHK CF
Sbjct  119  EKVAVENQAYHKTCF  133


 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC +C KTVY ++++A +N+ +HK CF+C H   ++  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY V+ L+AD   +HKACF+C HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P    EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF+GT QKC ACDKTVY+VD L+AD   +HK+CF+C HCKGTL +SN++S +GVLYC+P
Sbjct  1    MSFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLA-AGNKISSMFvgtttkcvgctktVYP  49
            H++QLFK TGS  K+F      K+EK  D  +LA A +K+SSMF GT  KC  C KT YP
Sbjct  61   HFEQLFKETGSFSKNFQ---TGKSEKQND--QLARAPSKLSSMFSGTQDKCAACKKTAYP  115

Query  48   IEKVAVNGTAYHKACF  1
            +EKV + G +YHK+CF
Sbjct  116  LEKVTLEGESYHKSCF  131


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 6/113 (5%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + R+P  LS       F+GT  KC AC KT Y ++++  +   +HK+CF+C H    L  
Sbjct  88   LARAPSKLS-----SMFSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHGGCPLTP  142

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLDKSFDGTPKTKTEKAI-DAEKLAAGNK  112
            S + + +G+LYC+ H+ QLFK  G+ +    G    K    + D+E+   G +
Sbjct  143  STYAALDGILYCKHHFAQLFKEKGNYNHLAKGASLRKNNAPLPDSEEKTEGEQ  195



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLS+++S EGVLYC+P
Sbjct  1    MSFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TG+  K+F  T   K       E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGTFKKNF--TSPAKLADKTTPELTRSPSKAASMFSGTQDKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT  KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY ++ L+AD   +HK CF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P    EK ++ E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAKSAEK-LNPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EGVLYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGVLYCKHHFSQLFKEKGSYN  171



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY VD+L+AD   +HKACFRC HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            HY+QLFK TG+  K+F    K   +   +  +  + +K + MF GT  KC  C KT YP+
Sbjct  61   HYEQLFKETGTFKKNFQSPAKLADKNTPELTR--SPSKAAGMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY ++ L+AD   +HK+CF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H+DQLFK TG+ +K+F      KT + +  E   + +K + MF GT  KC  C KT YP+
Sbjct  61   HFDQLFKETGNFNKNFQSP--AKTAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAAGMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            S++ + EGVLYC+ H+ QLFK  GS +
Sbjct  145  SSYAALEGVLYCKHHFSQLFKEKGSYN  171



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT QKC AC+KTVY+VD+L+AD   +HK+CF+C HCKGTLKLSN++S EGVLYC+PH+
Sbjct  4    FGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPHF  63

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIEK  40
            +QLFK TGS  K+F  +P    EK +  E   + +K +SMF GT  KC  C KT YP+EK
Sbjct  64   EQLFKETGSFKKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEK  121

Query  39   VAVNGTAYHKACF  1
            V V   AYHK+CF
Sbjct  122  VTVESQAYHKSCF  134


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H    +  
Sbjct  91   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITP  145

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  146  SNYAALEGILYCKHHFSQLFKEKGSYN  172



>ref|XP_004150238.1| PREDICTED: pollen-specific protein SF3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004150239.1| PREDICTED: pollen-specific protein SF3-like isoform 2 [Cucumis 
sativus]
 gb|KGN50627.1| hypothetical protein Csa_5G198170 [Cucumis sativus]
Length=195

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY VD+L+AD   FHK+CF+C HCKGTLKLSN++S +GVLYC+P
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+  K+F  +P   +EK    E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFSKNFL-SPAKSSEKPT-PELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H   +L  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + +G+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALDGILYCKHHFSQLFKEKGSYN  171



>ref|XP_010273176.1| PREDICTED: LIM domain-containing protein PLIM2c [Nelumbo nucifera]
Length=200

 Score =   146 bits (368),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC ACDKTVY+VD L+AD   +HK+CF+C HCKGTL +SN++S +GVLYC+P
Sbjct  1    MAFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSLDGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK +G+  K+F      K+EK  D  K  A +K+SSMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKESGNFSKNFQ---TGKSEKPSDGSK--APSKLSSMFCGTQDKCATCHKTAYPL  115

Query  45   EKVAVNGTAYHKACF  1
            EKV V G +YHK+CF
Sbjct  116  EKVTVEGESYHKSCF  130


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S +   F GT  KC  C KT Y ++++  +   +HK+CF+C H   +L  SN+ + +G+L
Sbjct  92   SKLSSMFCGTQDKCATCHKTAYPLEKVTVEGESYHKSCFKCSHGGCSLTPSNYAALDGIL  151

Query  237  YCRPHYDQLFKRTGSLD  187
            YC+ H+ QLFK  GS +
Sbjct  152  YCKHHFAQLFKEKGSYN  168



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY ++ L+AD   +HK+CF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P    EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H   +L  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EGVLYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGVLYCKHHFSQLFKEKGSYN  171



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY ++ L+AD   +HK+CF+C+HCKGTLKLSN++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P    EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H   +L  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EGVLYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGVLYCKHHFSQLFKEKGSYN  171



>ref|XP_008463203.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463204.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008463205.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=195

 Score =   145 bits (366),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC ACDKTVY VD+L+AD   FHK+CF+C HCKGTLKLSN++S +GVLYC+P
Sbjct  1    MSFIGTQQKCKACDKTVYPVDQLSADGVSFHKSCFKCSHCKGTLKLSNYSSMDGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+  K+F  +P   +EK    E   + ++ +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFSKNFL-SPAKSSEKPT-PELTRSPSRAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V   AYHK+CF
Sbjct  119  EKVTVESQAYHKSCF  133


 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  +++ +HK+CF+C H   +L  
Sbjct  90   LTRSP-----SRAASMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            MSF GT QKC AC+KTVY V+ L+AD   +HK+CF+C HCKGTLKL N++S EGVLYC+P
Sbjct  1    MSFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPI  46
            H++QLFK TG+ +K+F  +P    EK +  E   + +K +SMF GT  KC  C KT YP+
Sbjct  61   HFEQLFKETGNFNKNFQ-SPAKSAEK-LTPELTRSPSKAASMFSGTQEKCATCGKTAYPL  118

Query  45   EKVAVNGTAYHKACF  1
            EKV V G +YHK+CF
Sbjct  119  EKVTVEGQSYHKSCF  133


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -2

Query  447  IVRSPLHLSLSNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKL  268
            + RSP     S     F+GT +KC  C KT Y ++++  + + +HK+CF+C H    +  
Sbjct  90   LTRSP-----SKAASMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISP  144

Query  267  SNFNSFEGVLYCRPHYDQLFKRTGSLD  187
            SN+ + EG+LYC+ H+ QLFK  GS +
Sbjct  145  SNYAALEGILYCKHHFSQLFKEKGSYN  171



>ref|XP_001771340.1| predicted protein [Physcomitrella patens]
 gb|EDQ63900.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = -2

Query  405  MSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRP  226
            M+F+GT QKC ACDKTVYLV++L AD  ++HK+CFRC HCKGTLKL+++ S EGVLYC+P
Sbjct  1    MAFSGTQQKCKACDKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLASYASLEGVLYCKP  60

Query  225  HYDQLFKRTGSLDKSFDGTPKTKTEKAID-AEKLAAGNKISSMFvgtttkcvgctktVYP  49
            H++QL K TGS DKSF+  P    +K  +  EK+ +  K S MF GT  KC+ C+KTVYP
Sbjct  61   HFEQLLKLTGSFDKSFEHKPSEGLKKLPEKGEKVPS--KASLMFSGTQDKCIACSKTVYP  118

Query  48   IEKVAVNGTAYHKACF  1
            I+K  V G  YHK CF
Sbjct  119  IDKTTVEGLPYHKHCF  134


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  417  SNIIMSFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVL  238
            S   + F+GT  KC AC KTVY +D+   +   +HK CF+C H   T+  SN+ + EG L
Sbjct  96   SKASLMFSGTQDKCIACSKTVYPIDKTTVEGLPYHKHCFKCVHGGCTISPSNYAALEGRL  155

Query  237  YCRPHYDQLFKRTGSLDK  184
            YC+PHY QLFK  G+  +
Sbjct  156  YCKPHYSQLFKEKGNYSQ  173



>gb|EEC80296.1| hypothetical protein OsI_22314 [Oryza sativa Indica Group]
Length=1863

 Score =   155 bits (393),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 79/134 (59%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -2

Query  402  SFAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPH  223
            ++ GTTQKC +C +TVY V+ LAAD R++H+ CFRC HCK TL+ SN++S EGVLYC+PH
Sbjct  5    AWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKTTLQFSNYSSVEGVLYCKPH  64

Query  222  YDQLFKRTGSLDKSFDGTPKTKTEKAIDAEKLAAGNKISSMFvgtttkcvgctktVYPIE  43
            YDQ+ K TGSL+KSF+GT K+   +  +  K    N+ SSMFVGT  KCV C KTVYP+E
Sbjct  65   YDQILKSTGSLEKSFEGTSKSAKAEKSNGNK-GQPNRFSSMFVGTQDKCVVCNKTVYPLE  123

Query  42   KVAVNGTAYHKACF  1
            KV +NG++YHK+CF
Sbjct  124  KVNLNGSSYHKSCF  137


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = -2

Query  399  FAGTTQKCTACDKTVYLVDRLAADNRIFHKACFRCYHCKGTLKLSNFNSFEGVLYCRPHY  220
            F GT  KC  C+KTVY ++++  +   +HK+CFRC H   TL  SN  + EG LYC+ H+
Sbjct  105  FVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKTHH  164

Query  219  DQLFKRTGSLDKSFDGTPKTKTEKAIDAEK  130
             QLF   G+     D TP  K    +D EK
Sbjct  165  SQLFMVKGNFSNFEDNTPNAK----VDIEK  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 595294847732