BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4524_g2_i1 len=106 path=[409:0-105]

Length=106
                                                                      Score     E

gb|EYU18018.1|  hypothetical protein MIMGU_mgv1a0240531mg             70.5    3e-14   
ref|XP_008467061.1|  PREDICTED: LOB domain-containing protein 4-like  69.3    1e-13   
ref|XP_011090495.1|  PREDICTED: LOB domain-containing protein 4-like  70.1    1e-13   
ref|XP_009603165.1|  PREDICTED: LOB domain-containing protein 4-like  69.7    2e-13   
ref|XP_009766014.1|  PREDICTED: LOB domain-containing protein 4-l...  69.7    2e-13   
ref|XP_006364248.1|  PREDICTED: LOB domain-containing protein 4-like  69.3    2e-13   
ref|XP_004250781.1|  PREDICTED: LOB domain-containing protein 4-like  69.3    2e-13   
ref|XP_006382971.1|  hypothetical protein POPTR_0005s10050g           67.4    2e-13   
ref|XP_009609750.1|  PREDICTED: LOB domain-containing protein 4-like  68.2    2e-13   
gb|EYU46299.1|  hypothetical protein MIMGU_mgv1a020761mg              69.3    2e-13   
ref|XP_011080319.1|  PREDICTED: LOB domain-containing protein 4-like  69.3    2e-13   
ref|XP_009371914.1|  PREDICTED: LOB domain-containing protein 4-like  69.3    2e-13   
ref|XP_009353911.1|  PREDICTED: LOB domain-containing protein 4       68.9    3e-13   
ref|XP_004150042.1|  PREDICTED: LOB domain-containing protein 4-like  68.9    3e-13   
ref|XP_008383342.1|  PREDICTED: LOB domain-containing protein 4       68.9    3e-13   
ref|XP_007212152.1|  hypothetical protein PRUPE_ppa012322mg           68.9    3e-13   
ref|XP_004293726.1|  PREDICTED: LOB domain-containing protein 4-like  68.9    3e-13   
ref|XP_003607861.1|  LOB domain-containing protein                    68.9    3e-13   
gb|KHN20496.1|  LOB domain-containing protein 4                       68.6    3e-13   
ref|NP_001236751.1|  uncharacterized protein LOC100306560             68.6    4e-13   
emb|CDP17397.1|  unnamed protein product                              68.6    4e-13   
ref|XP_004233892.1|  PREDICTED: LOB domain-containing protein 4       68.2    5e-13   
ref|XP_006353054.1|  PREDICTED: LOB domain-containing protein 4-like  68.2    5e-13   
ref|XP_004294159.1|  PREDICTED: LOB domain-containing protein 4-like  68.6    5e-13   
ref|XP_004505337.1|  PREDICTED: LOB domain-containing protein 4-like  68.2    5e-13   
ref|XP_009783465.1|  PREDICTED: LOB domain-containing protein 4-like  68.2    5e-13   
ref|XP_006853389.1|  hypothetical protein AMTR_s00032p00142260        67.8    5e-13   
ref|XP_010667079.1|  PREDICTED: LOB domain-containing protein 4       68.2    6e-13   
ref|XP_002264049.2|  PREDICTED: LOB domain-containing protein 4       67.8    7e-13   Vitis vinifera
ref|XP_006422218.1|  hypothetical protein CICLE_v100061131mg          66.6    8e-13   
gb|AES66393.2|  LOB domain protein                                    67.4    9e-13   
ref|XP_007022340.1|  LOB domain-containing protein 4                  67.8    9e-13   
ref|XP_007149195.1|  hypothetical protein PHAVU_005G049700g           67.8    1e-12   
ref|XP_003596142.1|  LOB domain-containing protein                    67.4    1e-12   
ref|XP_008226099.1|  PREDICTED: LOB domain-containing protein 4       67.4    1e-12   
ref|XP_007212145.1|  hypothetical protein PRUPE_ppa012253mg           67.4    1e-12   
ref|XP_008359794.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  67.4    1e-12   
ref|XP_002310683.1|  hypothetical protein POPTR_0007s08290g           67.0    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004488806.1|  PREDICTED: LOB domain-containing protein 4-like  67.0    1e-12   
ref|XP_003531496.1|  PREDICTED: LOB domain-containing protein 4-like  67.4    1e-12   
ref|XP_002513395.1|  LOB domain-containing protein, putative          67.0    1e-12   Ricinus communis
ref|XP_011030434.1|  PREDICTED: LOB domain-containing protein 4-like  67.0    1e-12   
ref|XP_009767942.1|  PREDICTED: protein NLP6-like isoform X5          70.1    1e-12   
gb|KDP25103.1|  hypothetical protein JCGZ_22638                       67.0    1e-12   
ref|XP_010093051.1|  hypothetical protein L484_016263                 67.0    1e-12   
ref|XP_009767935.1|  PREDICTED: protein NLP7-like isoform X1          70.1    1e-12   
ref|XP_009767937.1|  PREDICTED: protein NLP7-like isoform X3          70.1    2e-12   
ref|XP_007024851.1|  LOB domain-containing protein 4 isoform 2        66.2    2e-12   
ref|XP_008383080.1|  PREDICTED: LOB domain-containing protein 4-l...  67.0    2e-12   
gb|KDO61639.1|  hypothetical protein CISIN_1g044340mg                 66.6    2e-12   
ref|XP_008383078.1|  PREDICTED: LOB domain-containing protein 4-l...  67.0    2e-12   
ref|XP_006475320.1|  PREDICTED: LOB domain-containing protein 4-like  66.6    2e-12   
ref|XP_002270650.1|  PREDICTED: LOB domain-containing protein 4       66.6    2e-12   Vitis vinifera
ref|XP_011022119.1|  PREDICTED: LOB domain-containing protein 4-like  66.2    2e-12   
ref|XP_010274089.1|  PREDICTED: LOB domain-containing protein 4       66.2    3e-12   
ref|XP_003547318.1|  PREDICTED: LOB domain-containing protein 4-like  66.2    3e-12   
ref|XP_007024850.1|  LOB domain-containing protein 4 isoform 1        66.2    3e-12   
ref|XP_002985907.1|  hypothetical protein SELMODRAFT_49085            65.1    3e-12   
gb|KHG15354.1|  LOB domain-containing 4 -like protein                 66.2    3e-12   
gb|KHG10095.1|  LOB domain-containing 4 -like protein                 66.2    3e-12   
ref|XP_006448764.1|  hypothetical protein CICLE_v10016993mg           65.9    4e-12   
ref|XP_003535054.1|  PREDICTED: LOB domain-containing protein 4-like  65.9    4e-12   
ref|XP_002297935.1|  LOB domain protein 3                             65.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011022387.1|  PREDICTED: LOB domain-containing protein 4-like  65.9    4e-12   
gb|KDP36462.1|  hypothetical protein JCGZ_08592                       65.9    4e-12   
ref|XP_011011627.1|  PREDICTED: LOB domain-containing protein 4-like  65.9    4e-12   
ref|XP_011026753.1|  PREDICTED: LOB domain-containing protein 4-like  65.9    4e-12   
ref|XP_002304584.1|  LOB domain protein 3                             65.9    4e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010098482.1|  hypothetical protein L484_025918                 65.9    4e-12   
gb|EMS49433.1|  hypothetical protein TRIUR3_27421                     65.1    4e-12   
ref|XP_008372032.1|  PREDICTED: LOB domain-containing protein 4-like  65.9    4e-12   
gb|AFW68077.1|  putative LOB domain-containing family protein         65.9    5e-12   
ref|XP_009361815.1|  PREDICTED: LOB domain-containing protein 4       65.9    5e-12   
ref|XP_006305715.1|  hypothetical protein CARUB_v10010462mg           65.5    5e-12   
ref|NP_001170378.1|  uncharacterized protein LOC100384360             65.9    5e-12   Zea mays [maize]
ref|XP_010540687.1|  PREDICTED: LOB domain-containing protein 4       65.5    6e-12   
ref|XP_006415344.1|  hypothetical protein EUTSA_v10008917mg           65.5    6e-12   
ref|NP_001241363.1|  uncharacterized protein LOC100790989             65.5    6e-12   
ref|XP_009102666.1|  PREDICTED: LOB domain-containing protein 4       65.5    6e-12   
ref|XP_006583939.1|  PREDICTED: LOB domain-containing protein 4-like  65.5    6e-12   
ref|XP_010478882.1|  PREDICTED: LOB domain-containing protein 4       65.5    6e-12   
ref|XP_010460960.1|  PREDICTED: LOB domain-containing protein 4-like  65.5    6e-12   
ref|XP_010476763.1|  PREDICTED: LOB domain-containing protein 3       65.5    6e-12   
ref|XP_002984853.1|  hypothetical protein SELMODRAFT_49084            64.3    6e-12   
ref|XP_002893847.1|  LOB domain protein 4                             65.5    7e-12   
ref|NP_174417.1|  LOB domain-containing protein 4                     65.5    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056710.1|  PREDICTED: LOB domain-containing protein 4-like  65.1    7e-12   
ref|XP_010518982.1|  PREDICTED: LOB domain-containing protein 4-like  64.7    9e-12   
ref|XP_002466719.1|  hypothetical protein SORBIDRAFT_01g012810        65.1    9e-12   Sorghum bicolor [broomcorn]
ref|XP_001764110.1|  predicted protein                                63.9    9e-12   
ref|XP_001778407.1|  predicted protein                                63.9    9e-12   
emb|CBI31503.3|  unnamed protein product                              64.3    1e-11   
emb|CDY50718.1|  BnaCnng19520D                                        64.7    1e-11   
ref|XP_004982247.1|  PREDICTED: LOB domain-containing protein 4-like  64.7    1e-11   
ref|XP_004139827.1|  PREDICTED: LOB domain-containing protein 12-...  64.7    1e-11   
gb|KHG01642.1|  LOB domain-containing 4 -like protein                 64.7    1e-11   
ref|XP_004145462.1|  PREDICTED: LOB domain-containing protein 4-like  64.3    1e-11   
gb|AAT42184.1|  putative lateral organ boundaries (LOB) domain fa...  64.7    1e-11   Zea mays [maize]
ref|NP_001055264.1|  Os05g0346800                                     64.3    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008459081.1|  PREDICTED: LOB domain-containing protein 4       64.3    2e-11   
ref|XP_009629688.1|  PREDICTED: LOB domain-containing protein 12-...  64.3    2e-11   
ref|XP_001775491.1|  predicted protein                                64.3    2e-11   
ref|XP_006650374.1|  PREDICTED: LOB domain-containing protein 4-like  63.9    2e-11   
ref|XP_010099465.1|  hypothetical protein L484_011165                 63.9    2e-11   
gb|EYU31583.1|  hypothetical protein MIMGU_mgv1a018865mg              63.9    2e-11   
gb|AAS07117.1|  hypothetical protein                                  63.9    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008447124.1|  PREDICTED: LOB domain-containing protein 4-like  63.5    3e-11   
ref|XP_004491008.1|  PREDICTED: LOB domain-containing protein 12-...  63.5    3e-11   
gb|EMS54969.1|  hypothetical protein TRIUR3_11841                     63.5    3e-11   
ref|XP_004296053.1|  PREDICTED: LOB domain-containing protein 12-...  63.5    3e-11   
ref|XP_007218515.1|  hypothetical protein PRUPE_ppa012504mg           63.2    3e-11   
gb|KFK43864.1|  hypothetical protein AALP_AA1G184000                  63.2    3e-11   
ref|XP_010497950.1|  PREDICTED: LOB domain-containing protein 3-l...  63.2    4e-11   
ref|XP_010064044.1|  PREDICTED: LOB domain-containing protein 4-l...  62.4    4e-11   
ref|XP_010692935.1|  PREDICTED: LOB domain-containing protein 12-...  63.2    4e-11   
ref|XP_008233606.1|  PREDICTED: LOB domain-containing protein 12 ...  63.2    4e-11   
ref|XP_002892914.1|  predicted protein                                63.2    4e-11   
ref|XP_008649558.1|  PREDICTED: LOB domain-containing protein 12      63.2    5e-11   
ref|XP_004240278.1|  PREDICTED: LOB domain-containing protein 1-like  63.2    5e-11   
ref|XP_010923742.1|  PREDICTED: LOB domain-containing protein 4       63.2    5e-11   
ref|XP_011080777.1|  PREDICTED: LOB domain-containing protein 12      62.8    5e-11   
ref|XP_010539579.1|  PREDICTED: LOB domain-containing protein 3-like  62.8    5e-11   
ref|XP_009784491.1|  PREDICTED: LOB domain-containing protein 12      62.8    5e-11   
ref|XP_006360671.1|  PREDICTED: LOB domain-containing protein 11-...  63.2    5e-11   
ref|XP_006410082.1|  hypothetical protein EUTSA_v100172670mg          62.8    5e-11   
ref|XP_009397348.1|  PREDICTED: LOB domain-containing protein 4-like  62.8    6e-11   
ref|XP_010497944.1|  PREDICTED: LOB domain-containing protein 3-l...  62.8    6e-11   
ref|XP_006416807.1|  hypothetical protein EUTSA_v10009386mg           62.8    6e-11   
ref|XP_002315279.1|  LOB domain protein 11                            62.8    6e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003616690.1|  LOB domain-containing protein                    62.8    6e-11   
ref|XP_009597089.1|  PREDICTED: LOB domain-containing protein 12-...  62.4    6e-11   
gb|ADU54137.1|  lateral organ boundaries domain 1                     62.8    6e-11   
ref|XP_002440913.1|  hypothetical protein SORBIDRAFT_09g016240        62.8    6e-11   Sorghum bicolor [broomcorn]
ref|XP_010942471.1|  PREDICTED: LOB domain-containing protein 4-like  62.8    6e-11   
ref|XP_009611728.1|  PREDICTED: LOB domain-containing protein 1-like  62.8    6e-11   
ref|XP_008233670.1|  PREDICTED: LOB domain-containing protein 12 ...  62.4    7e-11   
ref|XP_004963862.1|  PREDICTED: LOB domain-containing protein 12-...  62.8    7e-11   
ref|XP_011096755.1|  PREDICTED: LOB domain-containing protein 4-like  62.4    7e-11   
ref|XP_008787332.1|  PREDICTED: LOB domain-containing protein 4       62.8    7e-11   
ref|XP_007131990.1|  hypothetical protein PHAVU_011G0575000g          61.6    7e-11   
ref|XP_007008874.1|  Lateral organ boundaries domain family protein   62.4    7e-11   
ref|XP_011077047.1|  PREDICTED: LOB domain-containing protein 1-like  62.4    7e-11   
ref|XP_007205998.1|  hypothetical protein PRUPE_ppa012275mg           62.4    7e-11   
ref|XP_010499684.1|  PREDICTED: LOB domain-containing protein 4-like  62.4    7e-11   
ref|XP_009132714.1|  PREDICTED: LOB domain-containing protein 12-...  62.8    8e-11   
ref|XP_003600972.1|  LOB domain-containing protein                    62.4    8e-11   
ref|XP_007133379.1|  hypothetical protein PHAVU_011G174300g           62.4    8e-11   
ref|XP_010229521.1|  PREDICTED: LOB domain-containing protein 4-like  62.4    8e-11   
emb|CDY72536.1|  BnaA03g56340D                                        62.0    8e-11   
emb|CDY24027.1|  BnaC03g16640D                                        62.4    9e-11   
ref|XP_006344071.1|  PREDICTED: LOB domain-containing protein 12-...  61.6    9e-11   
ref|XP_003552226.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    9e-11   
ref|XP_009369560.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    9e-11   
ref|XP_008384740.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    9e-11   
ref|XP_010064043.1|  PREDICTED: LOB domain-containing protein 4-l...  61.6    1e-10   
ref|XP_008354824.1|  PREDICTED: LOB domain-containing protein 12      62.0    1e-10   
ref|XP_009784336.1|  PREDICTED: LOB domain-containing protein 1-like  62.0    1e-10   
ref|XP_004252871.1|  PREDICTED: LOB domain-containing protein 4-like  62.0    1e-10   
ref|XP_010064042.1|  PREDICTED: LOB domain-containing protein 4-l...  62.0    1e-10   
ref|XP_002311246.2|  hypothetical protein POPTR_0008s07280g           62.4    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009588230.1|  PREDICTED: LOB domain-containing protein 1-like  62.0    1e-10   
ref|XP_009760471.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    1e-10   
ref|XP_006350925.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    1e-10   
ref|XP_004242550.1|  PREDICTED: LOB domain-containing protein 12      62.0    1e-10   
ref|XP_009144327.1|  PREDICTED: LOB domain-containing protein 12      62.0    1e-10   
gb|EYU39788.1|  hypothetical protein MIMGU_mgv1a019167mg              62.0    1e-10   
ref|XP_010542672.1|  PREDICTED: LOB domain-containing protein 12-...  62.0    1e-10   
ref|XP_006843741.1|  hypothetical protein AMTR_s00007p00227160        62.0    1e-10   
ref|XP_010510404.1|  PREDICTED: LOB domain-containing protein 12      62.0    1e-10   
emb|CBI31504.3|  unnamed protein product                              63.2    1e-10   
ref|NP_565695.1|  LOB domain-containing protein 12                    61.6    1e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81767.1|  BnaC08g38340D                                        61.6    1e-10   
ref|XP_006654943.1|  PREDICTED: LOB domain-containing protein 11-...  61.6    1e-10   
ref|XP_010244970.1|  PREDICTED: LOB domain-containing protein 1-like  61.6    1e-10   
ref|XP_011076652.1|  PREDICTED: LOB domain-containing protein 12-...  61.6    1e-10   
ref|XP_010045372.1|  PREDICTED: LOB domain-containing protein 12-...  61.6    1e-10   
ref|XP_002441669.1|  hypothetical protein SORBIDRAFT_08g000575        61.6    1e-10   Sorghum bicolor [broomcorn]
gb|AAV33307.1|  putatvie LOB domain protein                           62.0    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAM64523.1|  unknown                                               61.6    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414305.1|  PREDICTED: LOB domain-containing protein 12-...  61.6    1e-10   
ref|XP_006296371.1|  hypothetical protein CARUB_v10025543mg           61.6    1e-10   
ref|XP_006655214.1|  PREDICTED: uncharacterized protein LOC102704525  64.3    2e-10   
ref|XP_006365826.1|  PREDICTED: LOB domain-containing protein 4-like  61.6    2e-10   
ref|XP_010469890.1|  PREDICTED: LOB domain-containing protein 12-...  61.6    2e-10   
ref|XP_003591977.1|  LOB domain-containing protein                    62.0    2e-10   
emb|CAN82602.1|  hypothetical protein VITISV_019140                   61.6    2e-10   Vitis vinifera
ref|NP_173102.1|  ASYMMETRIC LEAVES 2-like 9                          61.2    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010658649.1|  PREDICTED: LOB domain-containing protein 1-like  61.6    2e-10   
gb|AAS72371.1|  putatvie LOB domain protein                           61.2    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007146826.1|  hypothetical protein PHAVU_006G073100g           61.2    2e-10   
ref|XP_010909448.1|  PREDICTED: LOB domain-containing protein 1-like  61.6    2e-10   
ref|XP_003537315.1|  PREDICTED: LOB domain-containing protein 12-...  61.2    2e-10   
ref|XP_010920920.1|  PREDICTED: LOB domain-containing protein 1       61.6    2e-10   
ref|XP_011027000.1|  PREDICTED: LOB domain-containing protein 1-like  61.6    2e-10   
ref|XP_010658225.1|  PREDICTED: LOB domain-containing protein 12-...  61.2    2e-10   
ref|XP_006435806.1|  hypothetical protein CICLE_v10032929mg           61.2    2e-10   
ref|XP_010685903.1|  PREDICTED: LOB domain-containing protein 12      60.8    2e-10   
ref|XP_009388947.1|  PREDICTED: LOB domain-containing protein 4       61.2    2e-10   
emb|CBI25425.3|  unnamed protein product                              60.8    2e-10   
emb|CDP13973.1|  unnamed protein product                              61.2    2e-10   
emb|CDP04291.1|  unnamed protein product                              61.2    2e-10   
ref|XP_003545220.1|  PREDICTED: LOB domain-containing protein 12-...  61.2    2e-10   
ref|XP_003556215.1|  PREDICTED: LOB domain-containing protein 11-...  61.6    2e-10   
ref|XP_002520780.1|  LOB domain-containing protein, putative          61.2    2e-10   Ricinus communis
ref|XP_006344072.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    2e-10   
gb|EYU20059.1|  hypothetical protein MIMGU_mgv1a020601mg              61.2    2e-10   
ref|XP_003616758.1|  LOB domain-containing protein                    61.2    2e-10   
ref|XP_002274989.2|  PREDICTED: LOB domain-containing protein 1       62.0    2e-10   Vitis vinifera
ref|XP_009354277.1|  PREDICTED: LOB domain-containing protein 12      61.2    2e-10   
ref|XP_008789049.1|  PREDICTED: LOB domain-containing protein 1-like  61.2    2e-10   
gb|KDO67017.1|  hypothetical protein CISIN_1g0385651mg                60.5    2e-10   
ref|XP_008795252.1|  PREDICTED: LOB domain-containing protein 1       61.2    2e-10   
gb|KDP46170.1|  hypothetical protein JCGZ_06681                       63.9    2e-10   
ref|XP_008454827.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  60.8    2e-10   
ref|XP_004148190.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    2e-10   
ref|XP_002448864.1|  hypothetical protein SORBIDRAFT_05g000550        60.8    2e-10   Sorghum bicolor [broomcorn]
ref|NP_001182919.1|  uncharacterized protein LOC100501207             61.2    2e-10   
ref|XP_007143674.1|  hypothetical protein PHAVU_007G092000g           61.2    2e-10   
ref|XP_004496332.1|  PREDICTED: LOB domain-containing protein 11-...  61.2    2e-10   
ref|XP_008233367.1|  PREDICTED: LOB domain-containing protein 1-like  61.2    2e-10   
ref|XP_002879253.1|  hypothetical protein ARALYDRAFT_481923           60.8    2e-10   
emb|CDY51008.1|  BnaC04g54590D                                        60.5    3e-10   
ref|XP_009399059.1|  PREDICTED: LOB domain-containing protein 4-like  60.8    3e-10   
ref|XP_008792173.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    3e-10   
ref|XP_010906837.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    3e-10   
gb|AFK47293.1|  unknown                                               60.8    3e-10   
ref|XP_009408790.1|  PREDICTED: LOB domain-containing protein 4-like  60.8    3e-10   
ref|XP_009369215.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    3e-10   
ref|XP_007219697.1|  hypothetical protein PRUPE_ppa023989mg           61.2    3e-10   
ref|XP_004978582.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    3e-10   
ref|XP_004147298.1|  PREDICTED: LOB domain-containing protein 1-like  60.8    3e-10   
ref|XP_010459193.1|  PREDICTED: LOB domain-containing protein 3-like  60.5    3e-10   
emb|CDP09242.1|  unnamed protein product                              60.5    3e-10   
ref|XP_011002671.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    3e-10   
ref|XP_011102212.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    3e-10   
ref|XP_010658441.1|  PREDICTED: LOB domain-containing protein 1-like  60.5    3e-10   
gb|AFW55923.1|  putative protein kinase superfamily protein           62.4    4e-10   
ref|XP_010253538.1|  PREDICTED: LOB domain-containing protein 1-like  60.8    4e-10   
ref|XP_010921015.1|  PREDICTED: LOB domain-containing protein 12      60.5    4e-10   
emb|CAN78080.1|  hypothetical protein VITISV_021299                   60.5    4e-10   Vitis vinifera
ref|XP_010910576.1|  PREDICTED: LOB domain-containing protein 1-like  60.5    4e-10   
ref|XP_010558874.1|  PREDICTED: LOB domain-containing protein 13-...  60.5    4e-10   
ref|XP_009141041.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    4e-10   
ref|XP_003519421.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    4e-10   
ref|XP_002316191.1|  hypothetical protein POPTR_0010s19180g           60.5    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003536369.1|  PREDICTED: LOB domain-containing protein 11-...  60.8    4e-10   
ref|XP_008363768.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    4e-10   
gb|KDP44709.1|  hypothetical protein JCGZ_01209                       60.5    4e-10   
ref|XP_007163576.1|  hypothetical protein PHAVU_001G245800g           60.5    4e-10   
emb|CDX93609.1|  BnaA06g04390D                                        60.8    4e-10   
ref|XP_010067560.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    4e-10   
gb|ACU24293.1|  unknown                                               60.8    4e-10   Glycine max [soybeans]
ref|XP_006425146.1|  hypothetical protein CICLE_v10029962mg           60.5    4e-10   
gb|KHN17110.1|  LOB domain-containing protein 1                       60.5    4e-10   
ref|XP_011020741.1|  PREDICTED: LOB domain-containing protein 1-like  60.8    4e-10   
gb|EYU36210.1|  hypothetical protein MIMGU_mgv1a013837mg              60.5    4e-10   
ref|XP_011089355.1|  PREDICTED: LOB domain-containing protein 1       60.5    4e-10   
ref|XP_009794710.1|  PREDICTED: LOB domain-containing protein 1-l...  60.5    4e-10   
ref|XP_009794708.1|  PREDICTED: LOB domain-containing protein 1-l...  60.5    4e-10   
ref|XP_011102060.1|  PREDICTED: LOB domain-containing protein 1-like  59.7    4e-10   
ref|XP_007016975.1|  Lateral organ boundaries domain family protein   60.5    4e-10   
gb|KDP46164.1|  hypothetical protein JCGZ_06675                       60.5    4e-10   
ref|XP_008662282.1|  PREDICTED: uncharacterized protein LOC100501...  62.8    4e-10   
ref|XP_010937978.1|  PREDICTED: LOB domain-containing protein 15-...  60.5    4e-10   
ref|XP_002275182.2|  PREDICTED: LOB domain-containing protein 1       60.1    4e-10   Vitis vinifera
ref|XP_010257046.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    5e-10   
ref|XP_008679328.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    5e-10   
ref|XP_010666030.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    5e-10   
ref|XP_008805041.1|  PREDICTED: LOB domain-containing protein 11-...  60.1    5e-10   
ref|XP_009148039.1|  PREDICTED: LOB domain-containing protein 1-like  60.5    5e-10   
gb|KFK43106.1|  hypothetical protein AALP_AA1G080800                  59.7    5e-10   
ref|XP_008233810.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    5e-10   
ref|XP_009378147.1|  PREDICTED: LOB domain-containing protein 1-like  60.5    5e-10   
ref|XP_009345367.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    5e-10   
emb|CDY50999.1|  BnaA09g56280D                                        60.1    5e-10   
ref|XP_010032234.1|  PREDICTED: LOB domain-containing protein 1-like  60.5    5e-10   
ref|XP_008456762.1|  PREDICTED: LOB domain-containing protein 15-...  60.8    5e-10   
gb|KHN22797.1|  LOB domain-containing protein 12                      60.1    5e-10   
ref|XP_009763968.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    5e-10   
ref|XP_004160756.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  60.8    5e-10   
ref|XP_004138554.1|  PREDICTED: LOB domain-containing protein 15-...  60.8    5e-10   
ref|XP_004307714.1|  PREDICTED: LOB domain-containing protein 15-...  60.5    5e-10   
ref|XP_004500442.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    5e-10   
ref|XP_010264550.1|  PREDICTED: LOB domain-containing protein 12      60.1    5e-10   
emb|CBI31511.3|  unnamed protein product                              60.1    6e-10   
ref|NP_001050820.1|  Os03g0659700                                     59.3    6e-10   
ref|XP_002979980.1|  hypothetical protein SELMODRAFT_58936            59.3    6e-10   
ref|XP_010521775.1|  PREDICTED: LOB domain-containing protein 1       60.5    6e-10   
ref|XP_002312035.2|  hypothetical protein POPTR_0008s04350g           60.1    6e-10   
ref|XP_007141734.1|  hypothetical protein PHAVU_008G220900g           59.7    6e-10   
gb|ACR35525.1|  unknown                                               61.6    6e-10   
emb|CDX95115.1|  BnaC05g05560D                                        60.1    6e-10   
ref|XP_009593636.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    6e-10   
ref|XP_006417754.1|  hypothetical protein EUTSA_v10008781mg           60.1    6e-10   
ref|XP_010067592.1|  PREDICTED: LOB domain-containing protein 15 ...  60.1    7e-10   
ref|XP_004978387.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    7e-10   
ref|XP_008369390.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    7e-10   
ref|XP_010067591.1|  PREDICTED: LOB domain-containing protein 15 ...  60.1    7e-10   
ref|XP_010108453.1|  hypothetical protein L484_014124                 60.1    7e-10   
ref|XP_010669677.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    7e-10   
ref|XP_009149087.1|  PREDICTED: LOB domain-containing protein 3       59.7    7e-10   
ref|XP_008804108.1|  PREDICTED: LOB domain-containing protein 12      59.7    7e-10   
ref|XP_003599327.1|  LOB domain-containing protein                    59.7    7e-10   
ref|XP_004960340.1|  PREDICTED: LOB domain-containing protein 11-...  59.7    8e-10   
ref|XP_011090094.1|  PREDICTED: LOB domain-containing protein 1       59.7    8e-10   
emb|CDY40054.1|  BnaC05g12610D                                        59.3    8e-10   
gb|KDP21680.1|  hypothetical protein JCGZ_03351                       60.1    8e-10   
ref|XP_004161318.1|  PREDICTED: LOB domain-containing protein 1-like  59.7    8e-10   
ref|XP_003606493.1|  LOB domain protein                               59.7    8e-10   
ref|XP_002278121.2|  PREDICTED: LOB domain-containing protein 12      59.3    8e-10   
gb|KDO40021.1|  hypothetical protein CISIN_1g027307mg                 59.7    8e-10   
ref|XP_009421201.1|  PREDICTED: LOB domain-containing protein 12-...  59.3    8e-10   
ref|XP_006435864.1|  hypothetical protein CICLE_v10032684mg           59.7    8e-10   
ref|XP_004240601.1|  PREDICTED: LOB domain-containing protein 1-like  59.7    8e-10   
emb|CAN75803.1|  hypothetical protein VITISV_030052                   59.3    8e-10   
ref|XP_009421400.1|  PREDICTED: LOB domain-containing protein 12-...  59.3    8e-10   
ref|XP_002275345.1|  PREDICTED: LOB domain-containing protein 1       59.3    8e-10   
ref|XP_010521993.1|  PREDICTED: LOB domain-containing protein 12      59.3    9e-10   
ref|XP_009610820.1|  PREDICTED: LOB domain-containing protein 1-like  59.3    9e-10   
ref|XP_007011230.1|  LOB domain-containing protein 15                 59.7    9e-10   
ref|NP_172268.1|  LOB domain-containing protein 1                     59.3    9e-10   
ref|XP_009380677.1|  PREDICTED: LOB domain-containing protein 1-like  60.1    9e-10   
ref|XP_002279029.1|  PREDICTED: LOB domain-containing protein 15      59.7    1e-09   
ref|XP_010658438.1|  PREDICTED: LOB domain-containing protein 1-like  59.3    1e-09   
ref|XP_010104136.1|  hypothetical protein L484_014422                 59.7    1e-09   
ref|XP_004307415.1|  PREDICTED: LOB domain-containing protein 1-like  59.7    1e-09   
emb|CDY15755.1|  BnaC04g15690D                                        59.7    1e-09   
ref|XP_002889671.1|  LOB domain protein 1                             59.3    1e-09   
ref|XP_010264464.1|  PREDICTED: LOB domain-containing protein 15-...  59.7    1e-09   
gb|EYU39551.1|  hypothetical protein MIMGU_mgv1a019423mg              59.3    1e-09   
ref|XP_010554689.1|  PREDICTED: LOB domain-containing protein 12-...  59.3    1e-09   
ref|XP_007142160.1|  hypothetical protein PHAVU_008G257400g           58.5    1e-09   
emb|CDY06988.1|  BnaA04g23270D                                        59.3    1e-09   
ref|XP_009405236.1|  PREDICTED: LOB domain-containing protein 12-...  58.9    1e-09   
ref|XP_010921102.1|  PREDICTED: LOB domain-containing protein 15      59.3    1e-09   
ref|XP_010067593.1|  PREDICTED: LOB domain-containing protein 15 ...  59.3    1e-09   
ref|XP_007218448.1|  hypothetical protein PRUPE_ppa011757mg           59.3    1e-09   
ref|XP_009103694.1|  PREDICTED: LOB domain-containing protein 11-...  59.7    1e-09   
ref|XP_008369319.1|  PREDICTED: LOB domain-containing protein 15      59.3    1e-09   
ref|XP_008345316.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  59.3    1e-09   
ref|XP_008782625.1|  PREDICTED: LOB domain-containing protein 15-...  59.3    1e-09   
emb|CDP13932.1|  unnamed protein product                              59.7    1e-09   
ref|XP_009794709.1|  PREDICTED: LOB domain-containing protein 1-l...  59.3    1e-09   
ref|XP_010256944.1|  PREDICTED: LOB domain-containing protein 15      59.3    1e-09   
emb|CAN68873.1|  hypothetical protein VITISV_026576                   58.9    1e-09   
ref|XP_004251265.1|  PREDICTED: LOB domain-containing protein 1       59.3    1e-09   
gb|AAT40528.1|  LOB domain protein 1, putative                        59.3    1e-09   
ref|XP_002529696.1|  hypothetical protein RCOM_0713160                58.2    1e-09   
ref|XP_008650200.1|  PREDICTED: LOB domain-containing protein 1-like  59.3    1e-09   
ref|XP_006424648.1|  hypothetical protein CICLE_v10029283mg           59.3    1e-09   
ref|XP_002520837.1|  LOB domain-containing protein, putative          59.3    1e-09   
ref|XP_006488170.1|  PREDICTED: LOB domain-containing protein 11-...  59.3    1e-09   
ref|XP_004240624.1|  PREDICTED: LOB domain-containing protein 15-...  59.7    1e-09   
emb|CDX77182.1|  BnaC04g39770D                                        59.3    1e-09   
gb|KHG18058.1|  LOB domain-containing 15 -like protein                59.3    1e-09   
gb|KDO73135.1|  hypothetical protein CISIN_1g047491mg                 59.3    1e-09   
ref|XP_006343464.1|  PREDICTED: LOB domain-containing protein 11-...  59.3    1e-09   
gb|KHG27704.1|  LOB domain-containing 11 -like protein                59.3    1e-09   
ref|XP_010068859.1|  PREDICTED: LOB domain-containing protein 1-like  59.3    1e-09   
emb|CDY62454.1|  BnaA04g28360D                                        59.3    1e-09   
emb|CDY04570.1|  BnaA07g13960D                                        59.3    1e-09   
ref|XP_010087059.1|  hypothetical protein L484_012304                 58.9    1e-09   
ref|XP_009369256.1|  PREDICTED: LOB domain-containing protein 15-...  59.3    1e-09   
ref|XP_009363833.1|  PREDICTED: LOB domain-containing protein 15-...  59.3    1e-09   
emb|CBI31509.3|  unnamed protein product                              58.9    1e-09   
ref|XP_007205910.1|  hypothetical protein PRUPE_ppa011528mg           58.9    1e-09   
ref|XP_010922620.1|  PREDICTED: LOB domain-containing protein 12-...  58.9    1e-09   
ref|XP_002298499.1|  LOB domain protein 12                            58.9    1e-09   
gb|KHG16785.1|  LOB domain-containing 1 -like protein                 58.9    1e-09   
ref|XP_009780362.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    1e-09   
ref|XP_002440509.1|  hypothetical protein SORBIDRAFT_09g002190        58.9    1e-09   
ref|XP_006340400.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    2e-09   
ref|XP_009140905.1|  PREDICTED: LOB domain-containing protein 11      59.3    2e-09   
ref|XP_008376313.1|  PREDICTED: LOB domain-containing protein 1-like  59.3    2e-09   
ref|XP_010087532.1|  hypothetical protein L484_006937                 58.5    2e-09   
ref|XP_007015486.1|  LOB domain-containing protein 1                  58.9    2e-09   
ref|XP_004490703.1|  PREDICTED: LOB domain-containing protein 13-...  58.9    2e-09   
ref|XP_002880987.1|  hypothetical protein ARALYDRAFT_481760           58.9    2e-09   
ref|XP_008224697.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    2e-09   
gb|KHN04784.1|  LOB domain-containing protein 12                      58.5    2e-09   
ref|XP_010102497.1|  hypothetical protein L484_014552                 58.5    2e-09   
ref|XP_009141907.1|  PREDICTED: LOB domain-containing protein 15      58.9    2e-09   
emb|CDX93178.1|  BnaC04g47180D                                        58.9    2e-09   
ref|XP_009409552.1|  PREDICTED: LOB domain-containing protein 1-like  58.5    2e-09   
ref|XP_009382868.1|  PREDICTED: LOB domain-containing protein 15-...  58.9    2e-09   
ref|XP_004294671.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    2e-09   
ref|XP_010414515.1|  PREDICTED: LOB domain-containing protein 11 ...  58.9    2e-09   
ref|XP_009776231.1|  PREDICTED: LOB domain-containing protein 1-like  58.5    2e-09   
ref|XP_006294934.1|  hypothetical protein CARUB_v10023989mg           58.9    2e-09   
ref|XP_010470075.1|  PREDICTED: LOB domain-containing protein 11-...  58.9    2e-09   
ref|XP_010233540.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  59.3    2e-09   
ref|XP_010414516.1|  PREDICTED: LOB domain-containing protein 11 ...  58.9    2e-09   
ref|XP_010658439.1|  PREDICTED: LOB domain-containing protein 1       58.5    2e-09   
ref|XP_009333736.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    2e-09   
ref|XP_003597159.1|  LOB domain protein                               58.5    2e-09   
ref|XP_002526340.1|  LOB domain-containing protein, putative          58.5    2e-09   
ref|XP_006486488.1|  PREDICTED: LOB domain-containing protein 1-like  58.9    2e-09   
ref|XP_008358286.1|  PREDICTED: LOB domain-containing protein 1-like  58.5    2e-09   
ref|XP_008656534.1|  PREDICTED: LOB domain-containing protein 1       58.5    2e-09   
ref|XP_004237662.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    2e-09   
ref|XP_004505954.1|  PREDICTED: LOB domain-containing protein 11-...  58.5    2e-09   
emb|CBI31505.3|  unnamed protein product                              58.2    2e-09   
gb|AAK31142.1|AF345338_1  unknown                                     58.2    2e-09   
ref|NP_180417.2|  LOB domain-containing protein 11                    58.9    2e-09   
ref|XP_002313968.2|  hypothetical protein POPTR_0009s08060g           58.2    2e-09   
ref|XP_002970464.1|  hypothetical protein SELMODRAFT_68988            57.8    2e-09   
ref|XP_004491050.1|  PREDICTED: LOB domain-containing protein 15-...  58.2    2e-09   
ref|XP_010922692.1|  PREDICTED: LOB domain-containing protein 15 ...  58.9    2e-09   
ref|XP_010510616.1|  PREDICTED: LOB domain-containing protein 11-...  58.9    2e-09   
ref|XP_008776451.1|  PREDICTED: LOB domain-containing protein 15-...  58.5    2e-09   
gb|ACU21351.1|  unknown                                               58.2    2e-09   
ref|XP_003539733.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    2e-09   
ref|XP_002275051.1|  PREDICTED: LOB domain-containing protein 1       58.2    2e-09   
ref|XP_010523147.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  60.1    2e-09   
ref|XP_007137607.1|  hypothetical protein PHAVU_009G140600g           58.5    2e-09   
ref|XP_006409877.1|  hypothetical protein EUTSA_v10017165mg           58.9    3e-09   
gb|KHN05716.1|  LOB domain-containing protein 1                       58.2    3e-09   
ref|XP_006366412.1|  PREDICTED: LOB domain-containing protein 11-...  58.5    3e-09   
gb|AAD21485.1|  hypothetical protein                                  58.5    3e-09   
emb|CDP04064.1|  unnamed protein product                              58.5    3e-09   
ref|XP_004490702.1|  PREDICTED: LOB domain-containing protein 13-...  58.9    3e-09   
ref|XP_006485928.1|  PREDICTED: LOB domain-containing protein 1-like  58.5    3e-09   
ref|XP_001764822.1|  predicted protein                                57.4    3e-09   
ref|XP_010322163.1|  PREDICTED: LOB domain-containing protein 12-...  58.2    3e-09   
ref|XP_006353440.1|  PREDICTED: LOB domain-containing protein 12-...  58.2    3e-09   
ref|XP_010056894.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    3e-09   
ref|XP_008370637.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    3e-09   
ref|XP_011003387.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    3e-09   
ref|XP_010318580.1|  PREDICTED: LOB domain-containing protein 1-like  57.8    3e-09   
ref|XP_003538040.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    3e-09   
ref|XP_008369398.1|  PREDICTED: LOB domain-containing protein 1-like  58.5    3e-09   
ref|XP_001772855.1|  predicted protein                                57.4    3e-09   
ref|XP_006376019.1|  hypothetical protein POPTR_0013s08040g           58.2    3e-09   
ref|XP_010922693.1|  PREDICTED: LOB domain-containing protein 15 ...  58.2    3e-09   
ref|XP_006340510.1|  PREDICTED: LOB domain-containing protein 1-like  57.8    3e-09   
gb|KHN48386.1|  LOB domain-containing protein 15                      58.2    3e-09   
ref|XP_006491748.1|  PREDICTED: LOB domain-containing protein 4-like  56.6    3e-09   
emb|CDY02059.1|  BnaC04g14420D                                        58.5    3e-09   
ref|XP_003526822.1|  PREDICTED: LOB domain-containing protein 15-...  58.2    3e-09   
ref|XP_006436216.1|  hypothetical protein CICLE_v10032772mg           58.2    3e-09   
ref|XP_001773991.1|  predicted protein                                57.4    3e-09   
gb|KDP44115.1|  hypothetical protein JCGZ_05582                       58.2    3e-09   
ref|XP_003522500.1|  PREDICTED: LOB domain-containing protein 15-...  58.2    3e-09   
ref|XP_009411193.1|  PREDICTED: LOB domain-containing protein 15-...  58.2    3e-09   
ref|XP_009133875.1|  PREDICTED: LOB domain-containing protein 11-...  58.2    3e-09   
ref|XP_007009738.1|  LOB domain-containing protein 1                  58.2    3e-09   
ref|XP_007150227.1|  hypothetical protein PHAVU_005G137300g           57.8    3e-09   
gb|KHG17774.1|  LOB domain-containing 15 -like protein                58.2    3e-09   
ref|XP_006597316.1|  PREDICTED: LOB domain-containing protein 11-...  57.8    3e-09   
ref|XP_006295750.1|  hypothetical protein CARUB_v10024870mg           58.9    4e-09   
ref|XP_009378148.1|  PREDICTED: LOB domain-containing protein 1-like  58.2    4e-09   
emb|CDY31207.1|  BnaC03g46840D                                        58.2    4e-09   
ref|XP_011010866.1|  PREDICTED: LOB domain-containing protein 15-...  58.2    4e-09   
ref|XP_006436214.1|  hypothetical protein CICLE_v10033956mg           57.8    4e-09   
ref|XP_001774029.1|  predicted protein                                57.0    4e-09   
emb|CDP13990.1|  unnamed protein product                              57.8    4e-09   
gb|KFK36928.1|  hypothetical protein AALP_AA4G190900                  58.2    4e-09   
ref|NP_850141.1|  LOB domain-containing protein 13                    58.5    4e-09   
ref|XP_009630248.1|  PREDICTED: LOB domain-containing protein 21-...  57.8    4e-09   
ref|XP_009604707.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    4e-09   
gb|KFK32292.1|  hypothetical protein AALP_AA6G223700                  58.2    4e-09   
ref|XP_011076610.1|  PREDICTED: LOB domain-containing protein 15      57.8    4e-09   
ref|XP_009630762.1|  PREDICTED: LOB domain-containing protein 21-...  57.4    4e-09   
ref|XP_009604706.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    4e-09   
ref|XP_010043701.1|  PREDICTED: LOB domain-containing protein 1       57.8    4e-09   
ref|XP_001753400.1|  predicted protein                                57.0    4e-09   
gb|KHN33447.1|  LOB domain-containing protein 11                      57.4    4e-09   
ref|XP_008374922.1|  PREDICTED: LOB domain-containing protein 21-...  57.4    4e-09   
gb|KHG05451.1|  LOB domain-containing 15 -like protein                57.8    4e-09   
ref|XP_009117760.1|  PREDICTED: LOB domain-containing protein 3-like  57.4    5e-09   
ref|XP_003542002.1|  PREDICTED: LOB domain-containing protein 11-...  57.4    5e-09   
ref|XP_004487250.1|  PREDICTED: LOB domain-containing protein 11-...  57.4    5e-09   
ref|XP_006486862.1|  PREDICTED: LOB domain-containing protein 1-like  57.0    5e-09   
gb|KFK24518.1|  hypothetical protein AALP_AAs65934U001000             58.5    5e-09   
gb|KHN21539.1|  LOB domain-containing protein 11                      57.4    5e-09   
ref|XP_010031173.1|  PREDICTED: LOB domain-containing protein 12-...  57.4    5e-09   
ref|XP_004240882.1|  PREDICTED: LOB domain-containing protein 15      57.8    5e-09   
ref|XP_009133437.1|  PREDICTED: LOB domain-containing protein 15 ...  57.4    5e-09   
ref|XP_008783779.1|  PREDICTED: LOB domain-containing protein 1-like  57.4    5e-09   
emb|CBI31506.3|  unnamed protein product                              57.4    5e-09   
ref|XP_009144310.1|  PREDICTED: LOB domain-containing protein 13      58.5    5e-09   
ref|XP_001754227.1|  predicted protein                                56.6    5e-09   
ref|XP_011085123.1|  PREDICTED: LOB domain-containing protein 12-...  57.4    5e-09   
ref|XP_004235237.1|  PREDICTED: LOB domain-containing protein 21      57.4    5e-09   
emb|CAN69741.1|  hypothetical protein VITISV_017585                   57.4    5e-09   
ref|XP_009623318.1|  PREDICTED: LOB domain-containing protein 21-...  57.4    5e-09   
ref|XP_006356469.1|  PREDICTED: LOB domain-containing protein 21-...  57.4    5e-09   
ref|XP_008463578.1|  PREDICTED: LOB domain-containing protein 1-like  57.4    5e-09   
ref|XP_008233787.1|  PREDICTED: LOB domain-containing protein 21      57.4    5e-09   
ref|XP_009382867.1|  PREDICTED: LOB domain-containing protein 13-...  57.8    5e-09   
ref|XP_008799794.1|  PREDICTED: LOB domain-containing protein 12-...  57.0    6e-09   
ref|XP_006361319.1|  PREDICTED: LOB domain-containing protein 15-...  57.4    6e-09   
ref|XP_003551217.1|  PREDICTED: LOB domain-containing protein 12-...  57.0    6e-09   
ref|XP_010497695.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  56.6    6e-09   
ref|XP_002881102.1|  hypothetical protein ARALYDRAFT_481945           58.2    6e-09   
gb|KDP45727.1|  hypothetical protein JCGZ_17334                       57.4    6e-09   
ref|XP_002986975.1|  hypothetical protein SELMODRAFT_48892            56.6    6e-09   
ref|XP_004501886.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  57.4    6e-09   
ref|XP_002282070.1|  PREDICTED: LOB domain-containing protein 1       57.4    6e-09   
ref|XP_010037527.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES      57.0    6e-09   



>gb|EYU18018.1| hypothetical protein MIMGU_mgv1a0240531mg, partial [Erythranthe 
guttata]
Length=108

 Score = 70.5 bits (171),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  2    LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  36



>ref|XP_008467061.1| PREDICTED: LOB domain-containing protein 4-like, partial [Cucumis 
melo]
Length=113

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPEQ R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  3    LPEQQRSDAVSSMVYEANARVRDPVYGCVGAISSL  37



>ref|XP_011090495.1| PREDICTED: LOB domain-containing protein 4-like [Sesamum indicum]
Length=164

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009603165.1| PREDICTED: LOB domain-containing protein 4-like [Nicotiana tomentosiformis]
Length=172

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009766014.1| PREDICTED: LOB domain-containing protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009766015.1| PREDICTED: LOB domain-containing protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=172

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_006364248.1| PREDICTED: LOB domain-containing protein 4-like [Solanum tuberosum]
Length=171

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_004250781.1| PREDICTED: LOB domain-containing protein 4-like [Solanum lycopersicum]
Length=171

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_006382971.1| hypothetical protein POPTR_0005s10050g, partial [Populus trichocarpa]
 gb|ERP60768.1| hypothetical protein POPTR_0005s10050g, partial [Populus trichocarpa]
Length=68

 Score = 67.4 bits (163),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  2    LPEHQRRDAVSSMVYEANARVRDPVYGCVGAISSL  36



>ref|XP_009609750.1| PREDICTED: LOB domain-containing protein 4-like [Nicotiana tomentosiformis]
Length=111

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  4    LPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSL  38



>gb|EYU46299.1| hypothetical protein MIMGU_mgv1a020761mg [Erythranthe guttata]
Length=165

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_011080319.1| PREDICTED: LOB domain-containing protein 4-like [Sesamum indicum]
Length=166

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHHRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009371914.1| PREDICTED: LOB domain-containing protein 4-like [Pyrus x bretschneideri]
Length=175

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_009353911.1| PREDICTED: LOB domain-containing protein 4 [Pyrus x bretschneideri]
Length=175

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_004150042.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004161659.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 gb|KGN46813.1| hypothetical protein Csa_6G139130 [Cucumis sativus]
Length=173

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPEQ R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEQQRSDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_008383342.1| PREDICTED: LOB domain-containing protein 4 [Malus domestica]
Length=175

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_007212152.1| hypothetical protein PRUPE_ppa012322mg [Prunus persica]
 gb|EMJ13351.1| hypothetical protein PRUPE_ppa012322mg [Prunus persica]
Length=174

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_004293726.1| PREDICTED: LOB domain-containing protein 4-like [Fragaria vesca 
subsp. vesca]
Length=176

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_003607861.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES90058.1| LOB domain protein [Medicago truncatula]
Length=174

 Score = 68.9 bits (167),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>gb|KHN20496.1| LOB domain-containing protein 4 [Glycine soja]
Length=159

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|NP_001236751.1| uncharacterized protein LOC100306560 [Glycine max]
 gb|ACU14786.1| unknown [Glycine max]
Length=159

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>emb|CDP17397.1| unnamed protein product [Coffea canephora]
Length=176

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_004233892.1| PREDICTED: LOB domain-containing protein 4 [Solanum lycopersicum]
Length=161

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  59   LPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSL  93



>ref|XP_006353054.1| PREDICTED: LOB domain-containing protein 4-like [Solanum tuberosum]
Length=161

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  59   LPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSL  93



>ref|XP_004294159.1| PREDICTED: LOB domain-containing protein 4-like [Fragaria vesca 
subsp. vesca]
Length=177

 Score = 68.6 bits (166),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPEQ R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEQQRSDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_004505337.1| PREDICTED: LOB domain-containing protein 4-like [Cicer arietinum]
Length=172

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  65   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  99



>ref|XP_009783465.1| PREDICTED: LOB domain-containing protein 4-like [Nicotiana sylvestris]
Length=166

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  59   LPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSL  93



>ref|XP_006853389.1| hypothetical protein AMTR_s00032p00142260 [Amborella trichopoda]
 gb|ERN14856.1| hypothetical protein AMTR_s00032p00142260 [Amborella trichopoda]
Length=127

 Score = 67.8 bits (164),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  23   LPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  57



>ref|XP_010667079.1| PREDICTED: LOB domain-containing protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=172

 Score = 68.2 bits (165),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPMQQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_002264049.2| PREDICTED: LOB domain-containing protein 4 [Vitis vinifera]
 emb|CAN83356.1| hypothetical protein VITISV_026098 [Vitis vinifera]
 emb|CBI21734.3| unnamed protein product [Vitis vinifera]
Length=170

 Score = 67.8 bits (164),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_006422218.1| hypothetical protein CICLE_v100061131mg, partial [Citrus clementina]
 gb|ESR35458.1| hypothetical protein CICLE_v100061131mg, partial [Citrus clementina]
Length=96

 Score = 66.6 bits (161),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  2    LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  36



>gb|AES66393.2| LOB domain protein [Medicago truncatula]
Length=159

 Score = 67.4 bits (163),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_007022340.1| LOB domain-containing protein 4 [Theobroma cacao]
 gb|EOY13865.1| LOB domain-containing protein 4 [Theobroma cacao]
Length=171

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_007149195.1| hypothetical protein PHAVU_005G049700g [Phaseolus vulgaris]
 gb|ESW21189.1| hypothetical protein PHAVU_005G049700g [Phaseolus vulgaris]
Length=181

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_003596142.1| LOB domain-containing protein [Medicago truncatula]
 gb|ACJ84823.1| unknown [Medicago truncatula]
 gb|AFK44400.1| unknown [Medicago truncatula]
Length=159

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_008226099.1| PREDICTED: LOB domain-containing protein 4 [Prunus mume]
Length=178

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_007212145.1| hypothetical protein PRUPE_ppa012253mg [Prunus persica]
 gb|EMJ13344.1| hypothetical protein PRUPE_ppa012253mg [Prunus persica]
Length=178

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_008359794.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 
4-like [Malus domestica]
Length=175

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVG ISSL
Sbjct  63   LPEHQRGDAVSSMVYEANARVRDPVYGCVGXISSL  97



>ref|XP_002310683.1| hypothetical protein POPTR_0007s08290g [Populus trichocarpa]
 gb|EEE91133.1| hypothetical protein POPTR_0007s08290g [Populus trichocarpa]
Length=146

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_004488806.1| PREDICTED: LOB domain-containing protein 4-like [Cicer arietinum]
Length=143

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_003531496.1| PREDICTED: LOB domain-containing protein 4-like [Glycine max]
Length=177

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_002513395.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF48798.1| LOB domain-containing protein, putative [Ricinus communis]
Length=147

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011030434.1| PREDICTED: LOB domain-containing protein 4-like [Populus euphratica]
Length=146

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009767942.1| PREDICTED: protein NLP6-like isoform X5 [Nicotiana sylvestris]
Length=563

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAI+SL
Sbjct  490  LPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASL  524



>gb|KDP25103.1| hypothetical protein JCGZ_22638 [Jatropha curcas]
Length=146

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010093051.1| hypothetical protein L484_016263 [Morus notabilis]
 gb|EXB53379.1| hypothetical protein L484_016263 [Morus notabilis]
Length=171

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_009767935.1| PREDICTED: protein NLP7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009767936.1| PREDICTED: protein NLP7-like isoform X2 [Nicotiana sylvestris]
Length=719

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAI+SL
Sbjct  646  LPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASL  680



>ref|XP_009767937.1| PREDICTED: protein NLP7-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009767938.1| PREDICTED: protein NLP7-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009767939.1| PREDICTED: protein NLP7-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009767940.1| PREDICTED: protein NLP7-like isoform X3 [Nicotiana sylvestris]
Length=717

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANARVRDPVYGCVGAI+SL
Sbjct  644  LPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASL  678



>ref|XP_007024851.1| LOB domain-containing protein 4 isoform 2 [Theobroma cacao]
 gb|EOY27473.1| LOB domain-containing protein 4 isoform 2 [Theobroma cacao]
Length=120

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_008383080.1| PREDICTED: LOB domain-containing protein 4-like isoform X2 [Malus 
domestica]
Length=176

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>gb|KDO61639.1| hypothetical protein CISIN_1g044340mg [Citrus sinensis]
Length=155

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_008383078.1| PREDICTED: LOB domain-containing protein 4-like isoform X1 [Malus 
domestica]
Length=182

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  67   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  101



>ref|XP_006475320.1| PREDICTED: LOB domain-containing protein 4-like [Citrus sinensis]
Length=157

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_002270650.1| PREDICTED: LOB domain-containing protein 4 [Vitis vinifera]
 emb|CBI20550.3| unnamed protein product [Vitis vinifera]
Length=175

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP + RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVEQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011022119.1| PREDICTED: LOB domain-containing protein 4-like [Populus euphratica]
Length=146

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRRDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010274089.1| PREDICTED: LOB domain-containing protein 4 [Nelumbo nucifera]
Length=169

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_003547318.1| PREDICTED: LOB domain-containing protein 4-like [Glycine max]
 gb|KHN14353.1| LOB domain-containing protein 4 [Glycine soja]
Length=170

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPMHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_007024850.1| LOB domain-containing protein 4 isoform 1 [Theobroma cacao]
 gb|EOY27472.1| LOB domain-containing protein 4 isoform 1 [Theobroma cacao]
Length=171

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_002985907.1| hypothetical protein SELMODRAFT_49085, partial [Selaginella moellendorffii]
 gb|EFJ13084.1| hypothetical protein SELMODRAFT_49085, partial [Selaginella moellendorffii]
Length=110

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAIS+L
Sbjct  50   LPLHQRGDAVSSMVYEANARVRDPVYGCVGAISAL  84



>gb|KHG15354.1| LOB domain-containing 4 -like protein [Gossypium arboreum]
Length=171

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>gb|KHG10095.1| LOB domain-containing 4 -like protein [Gossypium arboreum]
Length=171

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_006448764.1| hypothetical protein CICLE_v10016993mg [Citrus clementina]
 ref|XP_006468423.1| PREDICTED: LOB domain-containing protein 4-like [Citrus sinensis]
 gb|ESR62004.1| hypothetical protein CICLE_v10016993mg [Citrus clementina]
 gb|KDO77480.1| hypothetical protein CISIN_1g031034mg [Citrus sinensis]
Length=167

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_003535054.1| PREDICTED: LOB domain-containing protein 4-like [Glycine max]
 gb|KHN22979.1| LOB domain-containing protein 4 [Glycine soja]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPMHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_002297935.1| LOB domain protein 3 [Populus trichocarpa]
 gb|EEE82740.1| LOB domain protein 3 [Populus trichocarpa]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011022387.1| PREDICTED: LOB domain-containing protein 4-like [Populus euphratica]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>gb|KDP36462.1| hypothetical protein JCGZ_08592 [Jatropha curcas]
Length=167

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011011627.1| PREDICTED: LOB domain-containing protein 4-like [Populus euphratica]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011026753.1| PREDICTED: LOB domain-containing protein 4-like [Populus euphratica]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_002304584.1| LOB domain protein 3 [Populus trichocarpa]
 gb|EEE79563.1| LOB domain protein 3 [Populus trichocarpa]
Length=170

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010098482.1| hypothetical protein L484_025918 [Morus notabilis]
 gb|EXB75142.1| hypothetical protein L484_025918 [Morus notabilis]
Length=183

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  66   LPLHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  100



>gb|EMS49433.1| hypothetical protein TRIUR3_27421 [Triticum urartu]
 gb|EMT25455.1| hypothetical protein F775_24149 [Aegilops tauschii]
Length=111

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_008372032.1| PREDICTED: LOB domain-containing protein 4-like [Malus domestica]
Length=181

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  96



>gb|AFW68077.1| putative LOB domain-containing family protein [Zea mays]
Length=199

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  76   IPAQHRGDAVSSLVYEANARVRDPVYGCVGAISSL  110



>ref|XP_009361815.1| PREDICTED: LOB domain-containing protein 4 [Pyrus x bretschneideri]
Length=181

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_006305715.1| hypothetical protein CARUB_v10010462mg [Capsella rubella]
 gb|EOA38613.1| hypothetical protein CARUB_v10010462mg [Capsella rubella]
Length=173

 Score = 65.5 bits (158),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|NP_001170378.1| uncharacterized protein LOC100384360 [Zea mays]
 gb|ACN36808.1| unknown [Zea mays]
 gb|AIB05141.1| LOB transcription factor, partial [Zea mays]
Length=199

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  76   IPAQHRGDAVSSLVYEANARVRDPVYGCVGAISSL  110



>ref|XP_010540687.1| PREDICTED: LOB domain-containing protein 4 [Tarenaya hassleriana]
Length=164

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_006415344.1| hypothetical protein EUTSA_v10008917mg [Eutrema salsugineum]
 gb|ESQ33697.1| hypothetical protein EUTSA_v10008917mg [Eutrema salsugineum]
Length=172

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|NP_001241363.1| uncharacterized protein LOC100790989 [Glycine max]
 gb|ACU23106.1| unknown [Glycine max]
 gb|KHN48908.1| LOB domain-containing protein 4 [Glycine soja]
Length=178

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEA ARVRDPVYGCVGAISSL
Sbjct  61   LPEHQRSDAVSSMVYEAKARVRDPVYGCVGAISSL  95



>ref|XP_009102666.1| PREDICTED: LOB domain-containing protein 4 [Brassica rapa]
 emb|CDX77553.1| BnaA07g06910D [Brassica napus]
Length=172

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_006583939.1| PREDICTED: LOB domain-containing protein 4-like [Glycine max]
 gb|KHN42967.1| LOB domain-containing protein 4 [Glycine soja]
Length=159

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LAEHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010478882.1| PREDICTED: LOB domain-containing protein 4 [Camelina sativa]
Length=172

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010460960.1| PREDICTED: LOB domain-containing protein 4-like [Camelina sativa]
Length=172

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010476763.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
 ref|XP_010476764.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
 ref|XP_010476765.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
Length=164

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  RGDAVNSMVYEANARV+DPVYGCVG ISSL
Sbjct  62   LSENQRGDAVNSMVYEANARVQDPVYGCVGTISSL  96



>ref|XP_002984853.1| hypothetical protein SELMODRAFT_49084, partial [Selaginella moellendorffii]
 gb|EFJ14103.1| hypothetical protein SELMODRAFT_49084, partial [Selaginella moellendorffii]
Length=110

 Score = 64.3 bits (155),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV SMVYEANARVRDPVYGCVGAIS+L
Sbjct  50   LPLHQRGDAVGSMVYEANARVRDPVYGCVGAISAL  84



>ref|XP_002893847.1| LOB domain protein 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70106.1| LOB domain protein 4 [Arabidopsis lyrata subsp. lyrata]
Length=172

 Score = 65.5 bits (158),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|NP_174417.1| LOB domain-containing protein 4 [Arabidopsis thaliana]
 sp|Q9SHE9.1|LBD4_ARATH RecName: Full=LOB domain-containing protein 4; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 6; Short=AS2-like protein 6 
[Arabidopsis thaliana]
 gb|AAF24588.1|AC007654_4 T19E23.11 [Arabidopsis thaliana]
 gb|AAT71939.1| At1g31320 [Arabidopsis thaliana]
 gb|AAU15164.1| At1g31320 [Arabidopsis thaliana]
 dbj|BAH10550.1| ASYMMETRIC LEAVES2-like 6 protein [Arabidopsis thaliana]
 gb|AEE31341.1| LOB domain-containing protein 4 [Arabidopsis thaliana]
Length=172

 Score = 65.5 bits (158),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010056710.1| PREDICTED: LOB domain-containing protein 4-like [Eucalyptus grandis]
 gb|KCW73508.1| hypothetical protein EUGRSUZ_E02016 [Eucalyptus grandis]
Length=171

 Score = 65.1 bits (157),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  63   LPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  97



>ref|XP_010518982.1| PREDICTED: LOB domain-containing protein 4-like [Tarenaya hassleriana]
Length=151

 Score = 64.7 bits (156),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  62   LPIDKRGDAVSSMVYEANARVRDPVYGCVGAISSL  96



>ref|XP_002466719.1| hypothetical protein SORBIDRAFT_01g012810 [Sorghum bicolor]
 gb|EER93717.1| hypothetical protein SORBIDRAFT_01g012810 [Sorghum bicolor]
Length=207

 Score = 65.1 bits (157),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  84   IPVQHRGDAVSSLVYEANARVRDPVYGCVGAISSL  118



>ref|XP_001764110.1| predicted protein [Physcomitrella patens]
 gb|EDQ70951.1| predicted protein [Physcomitrella patens]
Length=110

 Score = 63.9 bits (154),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP + RGDAV+SMVYEA+ARVRDPVYGCVGAISSL
Sbjct  50   LPVEARGDAVSSMVYEADARVRDPVYGCVGAISSL  84



>ref|XP_001778407.1| predicted protein [Physcomitrella patens]
 gb|EDQ56765.1| predicted protein [Physcomitrella patens]
Length=110

 Score = 63.9 bits (154),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP + RGDAV+SMVYEA+ARVRDPVYGCVGAISSL
Sbjct  50   LPVEARGDAVSSMVYEADARVRDPVYGCVGAISSL  84



>emb|CBI31503.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  22   LPESKRADAVSSMVYEANARIRDPVYGCAGAISHL  56



>emb|CDY50718.1| BnaCnng19520D [Brassica napus]
Length=172

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRDPVYGCVG+ISSL
Sbjct  61   LPLHQRGDAVSSMVYEANARVRDPVYGCVGSISSL  95



>ref|XP_004982247.1| PREDICTED: LOB domain-containing protein 4-like [Setaria italica]
Length=200

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  79   IPVQHRGDAVSSLVYEANARVRDPVYGCVGAISSL  113



>ref|XP_004139827.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis sativus]
 ref|XP_004169335.1| PREDICTED: LOB domain-containing protein 12-like isoform 1 [Cucumis 
sativus]
 ref|XP_004169336.1| PREDICTED: LOB domain-containing protein 12-like isoform 2 [Cucumis 
sativus]
 gb|KGN44269.1| hypothetical protein Csa_7G237840 [Cucumis sativus]
Length=162

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAIS  8
            LPEQ R DAV+SMVYEANAR+RDPVYGCVGAIS
Sbjct  71   LPEQQRSDAVSSMVYEANARIRDPVYGCVGAIS  103



>gb|KHG01642.1| LOB domain-containing 4 -like protein [Gossypium arboreum]
Length=159

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  61   LPVHQRGDAVSSIVYEANARVRDPVYGCVGAISSL  95



>ref|XP_004145462.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004164216.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 gb|KGN66910.1| hypothetical protein Csa_1G713680 [Cucumis sativus]
Length=170

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  63   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISSL  97



>gb|AAT42184.1| putative lateral organ boundaries (LOB) domain family [Zea mays]
 tpg|DAA50600.1| TPA: putative LOB domain-containing family protein [Zea mays]
 gb|AIB04800.1| LOB transcription factor, partial [Zea mays]
Length=211

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+SMVYEANARVRDPVYGC GA+SSL
Sbjct  79   IPAQHRGDAVSSMVYEANARVRDPVYGCAGAVSSL  113



>ref|NP_001055264.1| Os05g0346800 [Oryza sativa Japonica Group]
 gb|AAV43814.1| putative LOB family protein [Oryza sativa Japonica Group]
 dbj|BAF17178.1| Os05g0346800 [Oryza sativa Japonica Group]
 gb|EAY97638.1| hypothetical protein OsI_19560 [Oryza sativa Indica Group]
 gb|EAY97639.1| hypothetical protein OsI_19561 [Oryza sativa Indica Group]
 gb|EEE63343.1| hypothetical protein OsJ_18154 [Oryza sativa Japonica Group]
Length=200

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPAQQRGDAVSSLVYEANARMRDPVYGCVGAISFL  88



>ref|XP_008459081.1| PREDICTED: LOB domain-containing protein 4 [Cucumis melo]
Length=170

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  63   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISSL  97



>ref|XP_009629688.1| PREDICTED: LOB domain-containing protein 12-like [Nicotiana tomentosiformis]
Length=176

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPVQQRGDAVSSLVYEANARVRDPVYGCVGAISLL  89



>ref|XP_001775491.1| predicted protein [Physcomitrella patens]
 gb|EDQ59688.1| predicted protein [Physcomitrella patens]
Length=163

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEA+ARVRDPVYGCVGAISSL
Sbjct  51   LPVHQRGDAVSSMVYEADARVRDPVYGCVGAISSL  85



>ref|XP_006650374.1| PREDICTED: LOB domain-containing protein 4-like, partial [Oryza 
brachyantha]
Length=160

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDP+YGCVGAISSL
Sbjct  34   IPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSL  68



>ref|XP_010099465.1| hypothetical protein L484_011165 [Morus notabilis]
 gb|EXB78540.1| hypothetical protein L484_011165 [Morus notabilis]
Length=177

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPAHQRGDAVSSLVYEANARVRDPVYGCVGAISYL  88



>gb|EYU31583.1| hypothetical protein MIMGU_mgv1a018865mg [Erythranthe guttata]
Length=206

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  55   LPVQQRGDAVSSLVYEANARMRDPVYGCVGAISYL  89



>gb|AAS07117.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98005.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY91260.1| hypothetical protein OsI_12875 [Oryza sativa Indica Group]
 gb|EAZ28010.1| hypothetical protein OsJ_11977 [Oryza sativa Japonica Group]
Length=214

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P Q RGDAV+S+VYEANARVRDP+YGCVGAISSL
Sbjct  89   IPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSL  123



>ref|XP_008447124.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis melo]
Length=160

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAIS  8
            LPEQ R DAV+SMVYEANAR+RDPVYGCVG IS
Sbjct  69   LPEQQRSDAVSSMVYEANARIRDPVYGCVGTIS  101



>ref|XP_004491008.1| PREDICTED: LOB domain-containing protein 12-like [Cicer arietinum]
Length=168

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVQQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>gb|EMS54969.1| hypothetical protein TRIUR3_11841 [Triticum urartu]
Length=185

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P + RGDAV+S+VYEANARVRDP+YGCVGAI+SL
Sbjct  73   IPAEHRGDAVSSLVYEANARVRDPIYGCVGAITSL  107



>ref|XP_004296053.1| PREDICTED: LOB domain-containing protein 12-like [Fragaria vesca 
subsp. vesca]
Length=175

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPLHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_007218515.1| hypothetical protein PRUPE_ppa012504mg [Prunus persica]
 gb|EMJ19714.1| hypothetical protein PRUPE_ppa012504mg [Prunus persica]
Length=167

 Score = 63.2 bits (152),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPEHQRADAVSSLVYEANARMRDPVYGCVGAISYL  88



>gb|KFK43864.1| hypothetical protein AALP_AA1G184000 [Arabis alpina]
Length=162

 Score = 63.2 bits (152),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEA ARV+DPVYGCVG ISSL
Sbjct  65   LPENHRSDAVNSMVYEAIARVQDPVYGCVGTISSL  99



>ref|XP_010497950.1| PREDICTED: LOB domain-containing protein 3-like isoform X2 [Camelina 
sativa]
Length=166

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  +GDAVNSMVYEANARV+DPVYGCVG ISSL
Sbjct  62   LSENQQGDAVNSMVYEANARVQDPVYGCVGTISSL  96



>ref|XP_010064044.1| PREDICTED: LOB domain-containing protein 4-like isoform X3 [Eucalyptus 
grandis]
Length=112

 Score = 62.4 bits (150),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAV+SMVYEANAR+RDPVYGCVGAISSL
Sbjct  11   LLEHQRSDAVSSMVYEANARMRDPVYGCVGAISSL  45



>ref|XP_010692935.1| PREDICTED: LOB domain-containing protein 12-like [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  56   LPLHQRGDAVSSLVYEANARMRDPVYGCVGAISYL  90



>ref|XP_008233606.1| PREDICTED: LOB domain-containing protein 12 isoform X1 [Prunus 
mume]
Length=193

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  69   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  103



>ref|XP_002892914.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69173.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAVNSMVYEANARV+DPVYGCVG ISSL
Sbjct  62   LSENHRSDAVNSMVYEANARVQDPVYGCVGTISSL  96



>ref|XP_008649558.1| PREDICTED: LOB domain-containing protein 12 [Zea mays]
 gb|AFW77768.1| putative LOB domain-containing family protein [Zea mays]
 gb|AIB04647.1| LOB transcription factor, partial [Zea mays]
Length=195

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVSSLVYEANARMRDPVYGCVGAISFL  88



>ref|XP_004240278.1| PREDICTED: LOB domain-containing protein 1-like [Solanum lycopersicum]
Length=215

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAVNSMVYEANAR+RDPVYGC GAI  L
Sbjct  102  LPEEQRVDAVNSMVYEANARIRDPVYGCAGAICQL  136



>ref|XP_010923742.1| PREDICTED: LOB domain-containing protein 4 [Elaeis guineensis]
Length=183

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  61   LPAHHRSDAVSSLVYEANARVRDPVYGCVGAISSL  95



>ref|XP_011080777.1| PREDICTED: LOB domain-containing protein 12 [Sesamum indicum]
Length=170

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAVNS+VYEANAR+RDPVYGCVGAIS L
Sbjct  55   LPVHQRGDAVNSLVYEANARMRDPVYGCVGAISYL  89



>ref|XP_010539579.1| PREDICTED: LOB domain-containing protein 3-like [Tarenaya hassleriana]
Length=154

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV++M YEANARVRDPVYGCVGAISSL
Sbjct  56   LPESQRTDAVSAMAYEANARVRDPVYGCVGAISSL  90



>ref|XP_009784491.1| PREDICTED: LOB domain-containing protein 12 [Nicotiana sylvestris]
Length=155

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAVNS+VYEANAR+RDPVYGCVGAIS L
Sbjct  55   LPVQQRADAVNSLVYEANARMRDPVYGCVGAISYL  89



>ref|XP_006360671.1| PREDICTED: LOB domain-containing protein 11-like [Solanum tuberosum]
Length=214

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAVNSMVYEANAR+RDPVYGC GAI  L
Sbjct  101  LPEEQRVDAVNSMVYEANARIRDPVYGCAGAICQL  135



>ref|XP_006410082.1| hypothetical protein EUTSA_v100172670mg, partial [Eutrema salsugineum]
 gb|ESQ51535.1| hypothetical protein EUTSA_v100172670mg, partial [Eutrema salsugineum]
Length=191

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  51   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  85



>ref|XP_009397348.1| PREDICTED: LOB domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=182

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  QWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
           Q RGDAV+S+VYEANARVRDPVYGCVGAI+SL
Sbjct  64  QHRGDAVSSLVYEANARVRDPVYGCVGAITSL  95



>ref|XP_010497944.1| PREDICTED: LOB domain-containing protein 3-like isoform X1 [Camelina 
sativa]
Length=190

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  +GDAVNSMVYEANARV+DPVYGCVG ISSL
Sbjct  86   LSENQQGDAVNSMVYEANARVQDPVYGCVGTISSL  120



>ref|XP_006416807.1| hypothetical protein EUTSA_v10009386mg [Eutrema salsugineum]
 gb|ESQ35160.1| hypothetical protein EUTSA_v10009386mg [Eutrema salsugineum]
Length=166

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAVNSMVYEANARV+DPVYGCVG ISSL
Sbjct  62   LSENHRSDAVNSMVYEANARVQDPVYGCVGTISSL  96



>ref|XP_002315279.1| LOB domain protein 11 [Populus trichocarpa]
 gb|EEF01450.1| LOB domain protein 11 [Populus trichocarpa]
Length=213

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  108  LPESQRADAVSSMVYEANARIRDPVYGCAGAISQL  142



>ref|XP_003616690.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES99648.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=167

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVNSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_009597089.1| PREDICTED: LOB domain-containing protein 12-like [Nicotiana tomentosiformis]
Length=154

 Score = 62.4 bits (150),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAVNS+VYEANAR+RDPVYGCVGAIS L
Sbjct  55   LPIQQRADAVNSLVYEANARMRDPVYGCVGAISYL  89



>gb|ADU54137.1| lateral organ boundaries domain 1 [Populus tremula x Populus 
alba]
Length=219

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  114  LPESQRADAVSSMVYEANARIRDPVYGCAGAISQL  148



>ref|XP_002440913.1| hypothetical protein SORBIDRAFT_09g016240 [Sorghum bicolor]
 gb|EES19343.1| hypothetical protein SORBIDRAFT_09g016240 [Sorghum bicolor]
Length=217

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVSSLVYEANARMRDPVYGCVGAISFL  88



>ref|XP_010942471.1| PREDICTED: LOB domain-containing protein 4-like [Elaeis guineensis]
Length=188

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  61   LPAHHRSDAVSSLVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009611728.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=206

 Score = 62.8 bits (151),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAVNSMVYEANAR+RDPVYGC G I  L
Sbjct  104  LPEEQRADAVNSMVYEANARIRDPVYGCAGVICQL  138



>ref|XP_008233670.1| PREDICTED: LOB domain-containing protein 12 isoform X2 [Prunus 
mume]
Length=178

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_004963862.1| PREDICTED: LOB domain-containing protein 12-like [Setaria italica]
Length=202

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVSSLVYEANARMRDPVYGCVGAISFL  88



>ref|XP_011096755.1| PREDICTED: LOB domain-containing protein 4-like [Sesamum indicum]
Length=162

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV SMVYEANAR+RDPVYGCVG IS L
Sbjct  61   LPEYQRGDAVRSMVYEANARMRDPVYGCVGTISYL  95



>ref|XP_008787332.1| PREDICTED: LOB domain-containing protein 4 [Phoenix dactylifera]
Length=188

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAISSL
Sbjct  61   LPAHHRSDAVSSLVYEANARVRDPVYGCVGAISSL  95



>ref|XP_007131990.1| hypothetical protein PHAVU_011G0575000g, partial [Phaseolus vulgaris]
 gb|ESW03984.1| hypothetical protein PHAVU_011G0575000g, partial [Phaseolus vulgaris]
Length=110

 Score = 61.6 bits (148),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEANARVRD VYGCVGAISSL
Sbjct  2    LPMHQRGDAVSSMVYEANARVRDLVYGCVGAISSL  36



>ref|XP_007008874.1| Lateral organ boundaries domain family protein [Theobroma cacao]
 gb|EOY17684.1| Lateral organ boundaries domain family protein [Theobroma cacao]
Length=169

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVQQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_011077047.1| PREDICTED: LOB domain-containing protein 1-like [Sesamum indicum]
Length=192

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEANAR+RDPVYGC GAI  L
Sbjct  86   LPEAQRADAVNSMVYEANARLRDPVYGCAGAICQL  120



>ref|XP_007205998.1| hypothetical protein PRUPE_ppa012275mg [Prunus persica]
 gb|EMJ07197.1| hypothetical protein PRUPE_ppa012275mg [Prunus persica]
Length=176

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_010499684.1| PREDICTED: LOB domain-containing protein 4-like [Camelina sativa]
Length=172

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L    RGDAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LSIHQRGDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_009132714.1| PREDICTED: LOB domain-containing protein 12-like [Brassica rapa]
Length=249

 Score = 62.8 bits (151),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  117  LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  151



>ref|XP_003600972.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES71223.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=159

 Score = 62.4 bits (150),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARV+DPVYGCVGAIS L
Sbjct  56   LPIQQRADAVSSLVYEANARVKDPVYGCVGAISYL  90



>ref|XP_007133379.1| hypothetical protein PHAVU_011G174300g [Phaseolus vulgaris]
 gb|ESW05373.1| hypothetical protein PHAVU_011G174300g [Phaseolus vulgaris]
Length=175

 Score = 62.4 bits (150),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAV+SMVYEANARVRDPVYGCVGAISSL
Sbjct  61   LAEYQRSDAVSSMVYEANARVRDPVYGCVGAISSL  95



>ref|XP_010229521.1| PREDICTED: LOB domain-containing protein 4-like [Brachypodium 
distachyon]
Length=187

 Score = 62.4 bits (150),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +P + RGDAV+S+VYEANAR+RDP+YGCVGAISSL
Sbjct  69   VPAEHRGDAVSSLVYEANARMRDPIYGCVGAISSL  103



>emb|CDY72536.1| BnaA03g56340D [Brassica napus]
Length=138

 Score = 62.0 bits (149),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>emb|CDY24027.1| BnaC03g16640D [Brassica napus]
Length=188

 Score = 62.4 bits (150),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_006344071.1| PREDICTED: LOB domain-containing protein 12-like, partial [Solanum 
tuberosum]
Length=115

 Score = 61.6 bits (148),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAVNS+VYEANAR++DPVYGCVGAIS L
Sbjct  55   LPIQQRADAVNSLVYEANARMKDPVYGCVGAISFL  89



>ref|XP_003552226.1| PREDICTED: LOB domain-containing protein 12-like [Glycine max]
 gb|KHN31303.1| LOB domain-containing protein 12 [Glycine soja]
Length=165

 Score = 62.0 bits (149),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEA+ARVRDPVYGCVGAIS L
Sbjct  54   LPAHQRGDAVSSLVYEAHARVRDPVYGCVGAISHL  88



>ref|XP_009369560.1| PREDICTED: LOB domain-containing protein 12-like [Pyrus x bretschneideri]
Length=176

 Score = 62.0 bits (149),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  89



>ref|XP_008384740.1| PREDICTED: LOB domain-containing protein 12-like [Malus domestica]
Length=176

 Score = 62.0 bits (149),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  89



>ref|XP_010064043.1| PREDICTED: LOB domain-containing protein 4-like isoform X2 [Eucalyptus 
grandis]
Length=135

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAV+SMVYEANAR+RDPVYGCVGAISSL
Sbjct  34   LLEHQRSDAVSSMVYEANARMRDPVYGCVGAISSL  68



>ref|XP_008354824.1| PREDICTED: LOB domain-containing protein 12 [Malus domestica]
Length=174

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFL  89



>ref|XP_009784336.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=202

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAVNSMVYEANAR+RDPVYGC G I  L
Sbjct  97   LPEEQRADAVNSMVYEANARIRDPVYGCAGVICQL  131



>ref|XP_004252871.1| PREDICTED: LOB domain-containing protein 4-like [Solanum lycopersicum]
Length=168

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  RGDAV+SMVYEANAR++DP+YGCVG ISSL
Sbjct  62   LQEYQRGDAVSSMVYEANARIKDPIYGCVGTISSL  96



>ref|XP_010064042.1| PREDICTED: LOB domain-containing protein 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW71340.1| hypothetical protein EUGRSUZ_F04424 [Eucalyptus grandis]
Length=162

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAV+SMVYEANAR+RDPVYGCVGAISSL
Sbjct  61   LLEHQRSDAVSSMVYEANARMRDPVYGCVGAISSL  95



>ref|XP_002311246.2| hypothetical protein POPTR_0008s07280g [Populus trichocarpa]
 gb|EEE88613.2| hypothetical protein POPTR_0008s07280g [Populus trichocarpa]
Length=234

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  124  LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  158



>ref|XP_009588230.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEANAR+RDPVYGC GAI  L
Sbjct  81   LPEDQRTDAVNSMVYEANARIRDPVYGCAGAICQL  115



>ref|XP_009760471.1| PREDICTED: LOB domain-containing protein 12-like [Nicotiana sylvestris]
Length=176

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPVQQRADAVSSLVYEANARVRDPVYGCVGAISLL  89



>ref|XP_006350925.1| PREDICTED: LOB domain-containing protein 12-like [Solanum tuberosum]
Length=173

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPIQQRADAVSSLVYEANARVRDPVYGCVGAISFL  89



>ref|XP_004242550.1| PREDICTED: LOB domain-containing protein 12 [Solanum lycopersicum]
Length=174

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  55   LPIQQRADAVSSLVYEANARVRDPVYGCVGAISFL  89



>ref|XP_009144327.1| PREDICTED: LOB domain-containing protein 12 [Brassica rapa]
 emb|CDY10714.1| BnaA05g12220D [Brassica napus]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>gb|EYU39788.1| hypothetical protein MIMGU_mgv1a019167mg [Erythranthe guttata]
Length=187

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEANARVRDP+YGC G I  L
Sbjct  76   LPEDQRADAVNSMVYEANARVRDPIYGCTGTICHL  110



>ref|XP_010542672.1| PREDICTED: LOB domain-containing protein 12-like [Tarenaya hassleriana]
Length=190

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  57   LPIHQRADAVNSLVFEANARVRDPVYGCVGAISYL  91



>ref|XP_006843741.1| hypothetical protein AMTR_s00007p00227160 [Amborella trichopoda]
 gb|ERN05416.1| hypothetical protein AMTR_s00007p00227160 [Amborella trichopoda]
Length=193

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +PEQ R DA NS+VYEAN R+RDPVYGC+GAIS+L
Sbjct  66   VPEQQRADAANSLVYEANVRLRDPVYGCMGAISAL  100



>ref|XP_010510404.1| PREDICTED: LOB domain-containing protein 12 [Camelina sativa]
Length=197

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>emb|CBI31504.3| unnamed protein product [Vitis vinifera]
Length=298

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  187  LPESKRADAVSSMVYEANARIRDPVYGCAGAISHL  221


 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DA  SMVYEAN R+RDPVYGC GAIS L
Sbjct  33   LPESKRADAARSMVYEANMRIRDPVYGCAGAISHL  67



>ref|NP_565695.1| LOB domain-containing protein 12 [Arabidopsis thaliana]
 sp|Q8LBW3.2|LBD12_ARATH RecName: Full=LOB domain-containing protein 12; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 5; Short=AS2-like protein 
5 [Arabidopsis thaliana]
 gb|AAC16959.1| expressed protein [Arabidopsis thaliana]
 dbj|BAD12425.1| ASYMMETRIC LEAVES2-like gene 5 protein [Arabidopsis thaliana]
 dbj|BAH10549.1| ASYMMETRIC LEAVES2-like 5 protein [Arabidopsis thaliana]
 gb|AEC08349.1| LOB domain-containing protein 12 [Arabidopsis thaliana]
Length=193

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>emb|CDX81767.1| BnaC08g38340D [Brassica napus]
Length=164

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAVNS+VYEANARV+DPVYGCVG ISSL
Sbjct  62   LSENHRSDAVNSLVYEANARVQDPVYGCVGTISSL  96



>ref|XP_006654943.1| PREDICTED: LOB domain-containing protein 11-like [Oryza brachyantha]
Length=153

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  82   LPEEQRADAVSSMVYEANARIRDPVYGCAGAICQL  116



>ref|XP_010244970.1| PREDICTED: LOB domain-containing protein 1-like [Nelumbo nucifera]
Length=206

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  89   LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  123



>ref|XP_011076652.1| PREDICTED: LOB domain-containing protein 12-like [Sesamum indicum]
Length=180

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEANAR RDPVYGCVGAIS L
Sbjct  54   LPVQQRADAVSSLVYEANARARDPVYGCVGAISYL  88



>ref|XP_010045372.1| PREDICTED: LOB domain-containing protein 12-like [Eucalyptus 
grandis]
 gb|KCW87544.1| hypothetical protein EUGRSUZ_B03991 [Eucalyptus grandis]
Length=159

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANARVRDPVYGCVG IS L
Sbjct  57   LPVNQRGDAVSSLVYEANARVRDPVYGCVGTISYL  91



>ref|XP_002441669.1| hypothetical protein SORBIDRAFT_08g000575 [Sorghum bicolor]
 gb|EES15507.1| hypothetical protein SORBIDRAFT_08g000575 [Sorghum bicolor]
Length=182

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAIS  8
            LP Q R DAV+S+VYEANAR+RDPVYGCVGAIS
Sbjct  39   LPAQQRADAVSSLVYEANARMRDPVYGCVGAIS  71



>gb|AAV33307.1| putatvie LOB domain protein [Oryza sativa Japonica Group]
Length=234

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  104  LPEEQRADAVSSMVYEANARIRDPVYGCAGAICQL  138



>gb|AAM64523.1| unknown [Arabidopsis thaliana]
Length=193

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_010414305.1| PREDICTED: LOB domain-containing protein 12-like [Camelina sativa]
Length=196

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_006296371.1| hypothetical protein CARUB_v10025543mg [Capsella rubella]
 gb|EOA29269.1| hypothetical protein CARUB_v10025543mg [Capsella rubella]
Length=196

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_006655214.1| PREDICTED: uncharacterized protein LOC102704525 [Oryza brachyantha]
Length=681

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPAQQRGDAVSSLVYEANARMRDPVYGCVGAISFL  88



>ref|XP_006365826.1| PREDICTED: LOB domain-containing protein 4-like [Solanum tuberosum]
Length=169

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  RGDAV+SMVYEANAR++DP+YGCVG ISSL
Sbjct  62   LQEYQRGDAVSSMVYEANARMKDPIYGCVGTISSL  96



>ref|XP_010469890.1| PREDICTED: LOB domain-containing protein 12-like [Camelina sativa]
Length=204

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_003591977.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES62228.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=229

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  120  LPEPQRADAVSSMVYEANARIRDPVYGCAGAICQL  154



>emb|CAN82602.1| hypothetical protein VITISV_019140 [Vitis vinifera]
Length=171

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|NP_173102.1| ASYMMETRIC LEAVES 2-like 9 [Arabidopsis thaliana]
 sp|Q9SA51.1|LBD3_ARATH RecName: Full=LOB domain-containing protein 3; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 9; Short=AS2-like protein 9 
[Arabidopsis thaliana]
 gb|AAD34704.1|AC006341_32 >F3O9.33 [Arabidopsis thaliana]
 dbj|BAH10553.1| ASYMMETRIC LEAVES2-like 9 protein [Arabidopsis thaliana]
 gb|AEE29466.1| ASYMMETRIC LEAVES 2-like 9 [Arabidopsis thaliana]
Length=165

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  R DAV+SMVYEANAR++DPVYGCVG ISSL
Sbjct  63   LSENHRSDAVDSMVYEANARIQDPVYGCVGTISSL  97



>ref|XP_010658649.1| PREDICTED: LOB domain-containing protein 1-like [Vitis vinifera]
Length=173

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  81   LPESKRADAVSSMVYEANARIRDPVYGCAGAISHL  115



>gb|AAS72371.1| putatvie LOB domain protein [Oryza sativa Japonica Group]
 gb|EAY96361.1| hypothetical protein OsI_18260 [Oryza sativa Indica Group]
Length=145

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE+ R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  15   LPEEQRADAVSSMVYEANARIRDPVYGCAGAICQL  49



>ref|XP_007146826.1| hypothetical protein PHAVU_006G073100g [Phaseolus vulgaris]
 gb|ESW18820.1| hypothetical protein PHAVU_006G073100g [Phaseolus vulgaris]
Length=171

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_010909448.1| PREDICTED: LOB domain-containing protein 1-like [Elaeis guineensis]
Length=207

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  90   LPESQRADAVSSMVYEANARMRDPVYGCAGAICQL  124



>ref|XP_003537315.1| PREDICTED: LOB domain-containing protein 12-like [Glycine max]
Length=172

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPIHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_010920920.1| PREDICTED: LOB domain-containing protein 1 [Elaeis guineensis]
Length=199

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  89   LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  123



>ref|XP_011027000.1| PREDICTED: LOB domain-containing protein 1-like [Populus euphratica]
Length=216

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  111  LPESQRADAVSSMVYEANARIRDPVYGCAGAISQL  145



>ref|XP_010658225.1| PREDICTED: LOB domain-containing protein 12-like [Vitis vinifera]
Length=171

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_006435806.1| hypothetical protein CICLE_v10032929mg [Citrus clementina]
 ref|XP_006486261.1| PREDICTED: LOB domain-containing protein 12-like [Citrus sinensis]
 gb|ESR49046.1| hypothetical protein CICLE_v10032929mg [Citrus clementina]
 gb|KDO68859.1| hypothetical protein CISIN_1g036782mg [Citrus sinensis]
Length=166

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_010685903.1| PREDICTED: LOB domain-containing protein 12 [Beta vulgaris subsp. 
vulgaris]
Length=123

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  8    LPVHQRADAVSSLVYEANARIRDPVYGCVGAISYL  42



>ref|XP_009388947.1| PREDICTED: LOB domain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=174

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  QWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
           Q RGDAV+S+VYEANARVRDPVYGCV AISSL
Sbjct  64  QHRGDAVSSLVYEANARVRDPVYGCVAAISSL  95



>emb|CBI25425.3| unnamed protein product [Vitis vinifera]
Length=126

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>emb|CDP13973.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>emb|CDP04291.1| unnamed protein product [Coffea canephora]
Length=206

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEAN+R+RDPVYGC GAI  L
Sbjct  99   LPEDQRADAVNSMVYEANSRIRDPVYGCAGAICQL  133



>ref|XP_003545220.1| PREDICTED: LOB domain-containing protein 12-like [Glycine max]
 gb|KHN48589.1| LOB domain-containing protein 12 [Glycine soja]
Length=153

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_003556215.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
 gb|KHN00821.1| LOB domain-containing protein 1 [Glycine soja]
Length=222

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  117  LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  151



>ref|XP_002520780.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF41489.1| LOB domain-containing protein, putative [Ricinus communis]
Length=173

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPIHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_006344072.1| PREDICTED: LOB domain-containing protein 12-like, partial [Solanum 
tuberosum]
Length=115

 Score = 60.5 bits (145),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAVNS+VYEANAR+RDPVYGCV AIS L
Sbjct  55   LPIQQRADAVNSLVYEANARMRDPVYGCVSAISFL  89



>gb|EYU20059.1| hypothetical protein MIMGU_mgv1a020601mg, partial [Erythranthe 
guttata]
Length=172

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGD V+S+VYEANAR RDPVYGCVGAIS L
Sbjct  55   LPVHQRGDTVSSLVYEANARARDPVYGCVGAISYL  89



>ref|XP_003616758.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES99716.1| LOB domain protein [Medicago truncatula]
Length=196

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +PE  R DA NS+VYEAN R+RDPVYGC+GAISSL
Sbjct  87   VPENQRADAANSLVYEANVRLRDPVYGCMGAISSL  121



>ref|XP_002274989.2| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=270

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAIS L
Sbjct  81   LPESKRADAVSSMVYEANARIRDPVYGCAGAISHL  115



>ref|XP_009354277.1| PREDICTED: LOB domain-containing protein 12 [Pyrus x bretschneideri]
Length=176

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  55   LPIHQRGDAVSSLVYEANARMRDPVYGCVGAISFL  89



>ref|XP_008789049.1| PREDICTED: LOB domain-containing protein 1-like [Phoenix dactylifera]
Length=202

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  89   LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  123



>gb|KDO67017.1| hypothetical protein CISIN_1g0385651mg, partial [Citrus sinensis]
Length=117

 Score = 60.5 bits (145),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  2    LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  36



>ref|XP_008795252.1| PREDICTED: LOB domain-containing protein 1 [Phoenix dactylifera]
Length=194

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  83   LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  117



>gb|KDP46170.1| hypothetical protein JCGZ_06681 [Jatropha curcas]
Length=640

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAV+SMVYEANAR+RDPVYGCVG IS L
Sbjct  132  LPECQRGDAVSSMVYEANARIRDPVYGCVGQISLL  166



>ref|XP_008454827.1| PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 
12-like [Cucumis melo]
Length=167

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV S+VYEA+ARVRDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVMSLVYEASARVRDPVYGCVGAISYL  88



>ref|XP_004148190.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis sativus]
 ref|XP_004163527.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis sativus]
 gb|KGN50694.1| hypothetical protein Csa_5G215140 [Cucumis sativus]
Length=167

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q RGDAV S+VYEA+ARVRDPVYGCVGAIS L
Sbjct  54   LPVQQRGDAVMSLVYEASARVRDPVYGCVGAISYL  88



>ref|XP_002448864.1| hypothetical protein SORBIDRAFT_05g000550 [Sorghum bicolor]
 gb|EES07852.1| hypothetical protein SORBIDRAFT_05g000550 [Sorghum bicolor]
Length=151

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAIS  8
            LP Q R DAV+S+VYEANAR+RDPVYGCVGAIS
Sbjct  5    LPAQQRADAVSSLVYEANARMRDPVYGCVGAIS  37



>ref|NP_001182919.1| uncharacterized protein LOC100501207 [Zea mays]
 gb|ACR35128.1| unknown [Zea mays]
Length=226

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEAN R RDPVYGCVGAIS L
Sbjct  123  LPAHQRGDAVSSMVYEANVRTRDPVYGCVGAISVL  157



>ref|XP_007143674.1| hypothetical protein PHAVU_007G092000g [Phaseolus vulgaris]
 gb|ESW15668.1| hypothetical protein PHAVU_007G092000g [Phaseolus vulgaris]
Length=218

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  113  LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  147



>ref|XP_004496332.1| PREDICTED: LOB domain-containing protein 11-like [Cicer arietinum]
Length=231

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  122  LPEPQRADAVSSMVYEANARIRDPVYGCAGAICQL  156



>ref|XP_008233367.1| PREDICTED: LOB domain-containing protein 1-like [Prunus mume]
Length=230

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  122  LPESHRADAVSSMVYEANARIRDPVYGCAGAICQL  156



>ref|XP_002879253.1| hypothetical protein ARALYDRAFT_481923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55512.1| hypothetical protein ARALYDRAFT_481923 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score = 60.8 bits (146),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>emb|CDY51008.1| BnaC04g54590D [Brassica napus]
Length=139

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  56   LPVHQRADAVNSLVFEANARVRDPVYGCVGAISYL  90



>ref|XP_009399059.1| PREDICTED: LOB domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  QWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
           Q RGDAV+S+VYEANARVRDPVYGCVG ISSL
Sbjct  64  QHRGDAVSSLVYEANARVRDPVYGCVGVISSL  95



>ref|XP_008792173.1| PREDICTED: LOB domain-containing protein 12-like [Phoenix dactylifera]
Length=162

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISFL  88



>ref|XP_010906837.1| PREDICTED: LOB domain-containing protein 12-like [Elaeis guineensis]
Length=162

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARMRDPVYGCVGAISFL  88



>gb|AFK47293.1| unknown [Lotus japonicus]
Length=223

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  114  LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  148



>ref|XP_009408790.1| PREDICTED: LOB domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=186

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  97  QWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
           Q RGDAV+S+VYEANARVRDPVYGCV AIS+L
Sbjct  64  QHRGDAVSSLVYEANARVRDPVYGCVAAISTL  95



>ref|XP_009369215.1| PREDICTED: LOB domain-containing protein 12-like [Pyrus x bretschneideri]
Length=169

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPAHQRADAVSSLVYEANARMRDPVYGCVGAISYL  88



>ref|XP_007219697.1| hypothetical protein PRUPE_ppa023989mg [Prunus persica]
 gb|EMJ20896.1| hypothetical protein PRUPE_ppa023989mg [Prunus persica]
Length=231

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  124  LPESHRADAVSSMVYEANARIRDPVYGCAGAICQL  158



>ref|XP_004978582.1| PREDICTED: LOB domain-containing protein 12-like [Setaria italica]
Length=205

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAIS  8
            LP Q R DAV+S+VYEANAR+RDPVYGCVGAIS
Sbjct  64   LPAQQRADAVSSLVYEANARMRDPVYGCVGAIS  96



>ref|XP_004147298.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
 gb|KGN64754.1| hypothetical protein Csa_1G088440 [Cucumis sativus]
Length=183

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  RGDAVNSMVYEA+AR+RDP+YGC G+I  L
Sbjct  69   LPESQRGDAVNSMVYEASARIRDPIYGCAGSIFHL  103



>ref|XP_010459193.1| PREDICTED: LOB domain-containing protein 3-like [Camelina sativa]
Length=164

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            L E  RGDAVNSMVYEANARV+DPVYG VG ISSL
Sbjct  62   LSENQRGDAVNSMVYEANARVQDPVYGRVGTISSL  96



>emb|CDP09242.1| unnamed protein product [Coffea canephora]
Length=165

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPVQQRADAVGSLVYEANARMRDPVYGCVGAISYL  88



>ref|XP_011002671.1| PREDICTED: LOB domain-containing protein 12-like [Populus euphratica]
Length=164

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_011102212.1| PREDICTED: LOB domain-containing protein 1-like, partial [Sesamum 
indicum]
Length=124

 Score = 60.1 bits (144),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEANAR+RDP+YGC G I  L
Sbjct  20   LPEAQRADAVNSMVYEANARLRDPIYGCTGMICHL  54



>ref|XP_010658441.1| PREDICTED: LOB domain-containing protein 1-like [Vitis vinifera]
 emb|CBI31512.3| unnamed protein product [Vitis vinifera]
Length=197

 Score = 60.5 bits (145),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  90   LPESQRADAVSSMVYEANARIRDPVYGCAGAICHL  124



>gb|AFW55923.1| putative protein kinase superfamily protein [Zea mays]
Length=332

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   RGDAV+SMVYEAN R RDPVYGCVGAIS L
Sbjct  229  LPAHQRGDAVSSMVYEANVRTRDPVYGCVGAISVL  263



>ref|XP_010253538.1| PREDICTED: LOB domain-containing protein 1-like [Nelumbo nucifera]
Length=207

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  89   LPEYQRADAVSSMVYEANARIRDPVYGCAGAICQL  123



>ref|XP_010921015.1| PREDICTED: LOB domain-containing protein 12 [Elaeis guineensis]
Length=163

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>emb|CAN78080.1| hypothetical protein VITISV_021299 [Vitis vinifera]
Length=197

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  90   LPESQRADAVSSMVYEANARIRDPVYGCAGAICHL  124



>ref|XP_010910576.1| PREDICTED: LOB domain-containing protein 1-like [Elaeis guineensis]
Length=206

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  91   LPESQRADAVSSMVYEANARIRDPVYGCAGAICQL  125



>ref|XP_010558874.1| PREDICTED: LOB domain-containing protein 13-like [Tarenaya hassleriana]
Length=199

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            +PE  RGDA NS+VYEAN R+RDPVYGC+GAIS+L
Sbjct  85   VPESQRGDAANSLVYEANLRLRDPVYGCMGAISAL  119



>ref|XP_009141041.1| PREDICTED: LOB domain-containing protein 12-like [Brassica rapa]
Length=190

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAVNS+V+EANARVRDPVYGCVGAIS L
Sbjct  57   LPVNQRADAVNSLVFEANARVRDPVYGCVGAISYL  91



>ref|XP_003519421.1| PREDICTED: LOB domain-containing protein 12-like [Glycine max]
 gb|KHN38542.1| LOB domain-containing protein 12 [Glycine soja]
Length=154

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_002316191.1| hypothetical protein POPTR_0010s19180g [Populus trichocarpa]
 gb|EEF02362.1| hypothetical protein POPTR_0010s19180g [Populus trichocarpa]
Length=164

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_003536369.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
Length=222

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAV+SMVYEANAR+RDPVYGC GAI  L
Sbjct  117  LPESQREDAVSSMVYEANARIRDPVYGCAGAICQL  151



>ref|XP_008363768.1| PREDICTED: LOB domain-containing protein 12-like [Malus domestica]
Length=169

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANAR+RDPVYGCVGAIS L
Sbjct  54   LPAHQRADAVSSLVYEANARMRDPVYGCVGAISYL  88



>gb|KDP44709.1| hypothetical protein JCGZ_01209 [Jatropha curcas]
Length=164

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP   R DAV+S+VYEANARVRDPVYGCVGAIS L
Sbjct  54   LPVHQRADAVSSLVYEANARVRDPVYGCVGAISYL  88



>ref|XP_007163576.1| hypothetical protein PHAVU_001G245800g [Phaseolus vulgaris]
 gb|ESW35570.1| hypothetical protein PHAVU_001G245800g [Phaseolus vulgaris]
Length=181

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LP Q R DAV+S+VYEA+ARVRDPVYGCVGAIS L
Sbjct  70   LPIQQRADAVSSLVYEAHARVRDPVYGCVGAISYL  104



>emb|CDX93609.1| BnaA06g04390D [Brassica napus]
Length=225

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  LPEQWRGDAVNSMVYEANARVRDPVYGCVGAISSL  2
            LPE  R DAVNSMVYEA AR+RDP+YGC GAI +L
Sbjct  115  LPESQRTDAVNSMVYEAGARIRDPIYGCAGAIYNL  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525703048884