BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c45247_g1_i1 len=1123 path=[1:0-1122]

Length=1123
                                                                      Score     E

ref|XP_010644254.1|  PREDICTED: uncharacterized protein LOC100260642    159   1e-39   
ref|XP_010644255.1|  PREDICTED: uncharacterized protein LOC100255568    154   6e-38   
emb|CAN75530.1|  hypothetical protein VITISV_001347                     152   3e-37   Vitis vinifera
ref|XP_010644262.1|  PREDICTED: uncharacterized protein LOC100258913    146   6e-35   
ref|XP_010648157.1|  PREDICTED: uncharacterized protein LOC100255511    142   2e-33   
emb|CBI20385.3|  unnamed protein product                                126   4e-31   
emb|CBI20387.3|  unnamed protein product                                125   5e-31   
ref|XP_006428002.1|  hypothetical protein CICLE_v10025090mg             134   7e-31   
ref|XP_002510230.1|  conserved hypothetical protein                     128   4e-29   Ricinus communis
gb|EYU27017.1|  hypothetical protein MIMGU_mgv1a019065mg                126   2e-28   
emb|CDP08030.1|  unnamed protein product                                126   3e-28   
emb|CDP08013.1|  unnamed protein product                                125   5e-28   
gb|KHG15627.1|  hypothetical protein F383_22236                         124   2e-27   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                         122   3e-27   
ref|XP_007201599.1|  hypothetical protein PRUPE_ppa019270mg             123   3e-27   
ref|XP_010104853.1|  hypothetical protein L484_024054                   123   5e-27   
ref|XP_009377262.1|  PREDICTED: uncharacterized protein LOC103965884    117   2e-26   
ref|XP_007040801.1|  Uncharacterized protein TCM_016663                 120   4e-26   
ref|XP_010675838.1|  PREDICTED: uncharacterized protein LOC104891781    120   4e-26   
ref|XP_010670792.1|  PREDICTED: uncharacterized protein LOC104887761    119   6e-26   
ref|XP_002513096.1|  conserved hypothetical protein                     120   6e-26   Ricinus communis
gb|KCW68873.1|  hypothetical protein EUGRSUZ_F02463                     118   2e-25   
ref|XP_010061843.1|  PREDICTED: uncharacterized protein LOC104449402    118   2e-25   
ref|XP_009372850.1|  PREDICTED: uncharacterized protein LOC103961896    117   3e-25   
ref|XP_009371589.1|  PREDICTED: uncharacterized protein LOC103960820    117   4e-25   
ref|XP_007146447.1|  hypothetical protein PHAVU_006G041300g             117   5e-25   
gb|KCW66957.1|  hypothetical protein EUGRSUZ_F00719                     115   7e-25   
emb|CBI20393.3|  unnamed protein product                                115   1e-24   
ref|XP_008342346.1|  PREDICTED: uncharacterized protein LOC103405164    115   1e-24   
gb|KDP38349.1|  hypothetical protein JCGZ_04274                         116   1e-24   
ref|XP_006464478.1|  PREDICTED: uncharacterized protein LOC102617005    115   2e-24   
ref|XP_010495724.1|  PREDICTED: uncharacterized protein LOC104772863    115   2e-24   
ref|XP_010054394.1|  PREDICTED: uncharacterized protein LOC104442692    115   2e-24   
gb|KFK28578.1|  hypothetical protein AALP_AA7G015200                    115   3e-24   
ref|XP_007214131.1|  hypothetical protein PRUPE_ppa018036mg             114   3e-24   
ref|XP_011018639.1|  PREDICTED: uncharacterized protein LOC105121611    114   3e-24   
ref|XP_010904720.1|  PREDICTED: uncharacterized protein LOC105032071    114   3e-24   
ref|XP_008224917.1|  PREDICTED: uncharacterized protein LOC103324616    114   5e-24   
emb|CDP21917.1|  unnamed protein product                                113   6e-24   
ref|XP_006368456.1|  hypothetical protein POPTR_0001s02970g             113   8e-24   
ref|XP_010494654.1|  PREDICTED: uncharacterized protein LOC104771778    112   1e-23   
ref|XP_002867956.1|  hypothetical protein ARALYDRAFT_914755             113   1e-23   
ref|XP_010055454.1|  PREDICTED: uncharacterized protein LOC104443651    112   2e-23   
emb|CBI34045.3|  unnamed protein product                                110   2e-23   
ref|XP_002863471.1|  hypothetical protein ARALYDRAFT_494430             111   4e-23   
ref|NP_199361.1|  uncharacterized protein                               111   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813358.1|  PREDICTED: uncharacterized protein LOC103724015    110   5e-23   
ref|XP_006437480.1|  hypothetical protein CICLE_v10030709mg             111   5e-23   
gb|KDO53052.1|  hypothetical protein CISIN_1g040228mg                   111   5e-23   
ref|XP_006464315.1|  PREDICTED: uncharacterized protein LOC102620...    107   7e-23   
ref|XP_008371249.1|  PREDICTED: uncharacterized protein LOC103434679    110   8e-23   
ref|XP_009392549.1|  PREDICTED: uncharacterized protein LOC103978475    109   1e-22   
ref|XP_006342534.1|  PREDICTED: uncharacterized protein LOC102605...    109   1e-22   
ref|XP_010441713.1|  PREDICTED: uncharacterized protein LOC104724...    110   1e-22   
ref|XP_010441710.1|  PREDICTED: uncharacterized protein LOC104724...    109   1e-22   
ref|XP_006282044.1|  hypothetical protein CARUB_v10028286mg             109   2e-22   
gb|KCW45907.1|  hypothetical protein EUGRSUZ_L002281                    108   2e-22   
ref|XP_006484676.1|  PREDICTED: uncharacterized protein LOC102625373    109   2e-22   
ref|XP_006426720.1|  hypothetical protein CICLE_v10027206mg             108   2e-22   
ref|XP_010039521.1|  PREDICTED: uncharacterized protein LOC104428225    108   2e-22   
ref|XP_008228369.1|  PREDICTED: uncharacterized protein LOC103327780    108   2e-22   
ref|XP_010650636.1|  PREDICTED: uncharacterized protein LOC104879474    108   2e-22   
ref|XP_002528769.1|  conserved hypothetical protein                     108   3e-22   Ricinus communis
ref|XP_004253121.1|  PREDICTED: uncharacterized protein LOC101249163    108   3e-22   
ref|XP_010494655.1|  PREDICTED: uncharacterized protein LOC104771779    107   3e-22   
ref|XP_007040748.1|  Uncharacterized protein TCM_016622                 108   3e-22   
ref|XP_006428082.1|  hypothetical protein CICLE_v10024981mg             108   3e-22   
ref|XP_010535680.1|  PREDICTED: uncharacterized protein LOC104810911    108   4e-22   
ref|XP_010034341.1|  PREDICTED: uncharacterized protein LOC104423568    108   4e-22   
ref|XP_002863469.1|  hypothetical protein ARALYDRAFT_494429             108   4e-22   
gb|KDO64928.1|  hypothetical protein CISIN_1g005525mg                   107   4e-22   
ref|XP_010045164.1|  PREDICTED: uncharacterized protein LOC104433...    107   4e-22   
ref|XP_006465866.1|  PREDICTED: uncharacterized protein LOC102612510    107   4e-22   
ref|XP_010481571.1|  PREDICTED: uncharacterized protein LOC104760...    108   5e-22   
ref|XP_006279990.1|  hypothetical protein CARUB_v10025861mg             108   5e-22   
ref|XP_010481570.1|  PREDICTED: uncharacterized protein LOC104760...    108   5e-22   
gb|KCW87317.1|  hypothetical protein EUGRSUZ_B03804                     107   5e-22   
ref|XP_003577300.1|  PREDICTED: uncharacterized protein LOC100843708    107   5e-22   
ref|XP_010045162.1|  PREDICTED: uncharacterized protein LOC104433...    107   5e-22   
ref|XP_002863478.1|  hypothetical protein ARALYDRAFT_494437             108   5e-22   
gb|KEH43306.1|  DUF594 family protein                                   107   6e-22   
emb|CDP16262.1|  unnamed protein product                                107   6e-22   
gb|KFK33780.1|  hypothetical protein AALP_AA5G059100                    106   6e-22   
ref|XP_010251959.1|  PREDICTED: uncharacterized protein LOC104593692    107   7e-22   
ref|XP_010529242.1|  PREDICTED: uncharacterized protein LOC104806182    107   8e-22   
ref|XP_004303690.1|  PREDICTED: uncharacterized protein LOC101298623    107   9e-22   
ref|NP_199367.1|  uncharacterized protein                               107   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199366.1|  uncharacterized protein                               107   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199360.1|  uncharacterized protein                               107   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251680.1|  PREDICTED: uncharacterized protein LOC104593502    106   1e-21   
ref|XP_004496124.1|  PREDICTED: uncharacterized protein LOC101496417    106   1e-21   
ref|XP_010441714.1|  PREDICTED: uncharacterized protein LOC104724854    107   1e-21   
gb|KFK25862.1|  hypothetical protein AALP_AA8G171900                    106   1e-21   
ref|XP_006398220.1|  hypothetical protein EUTSA_v10000764mg             107   1e-21   
ref|XP_009128802.1|  PREDICTED: uncharacterized protein LOC103853...    106   1e-21   
ref|XP_006280029.1|  hypothetical protein CARUB_v10025906mg             106   1e-21   
gb|ABA94980.1|  expressed protein                                       106   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002863477.1|  hypothetical protein ARALYDRAFT_494436             106   1e-21   
ref|XP_006280006.1|  hypothetical protein CARUB_v10025879mg             106   1e-21   
ref|XP_010046717.1|  PREDICTED: uncharacterized protein LOC104435714    105   2e-21   
emb|CDY26372.1|  BnaA02g23980D                                          107   2e-21   
gb|KFK31555.1|  hypothetical protein AALP_AA6G127100                    106   2e-21   
ref|XP_010251958.1|  PREDICTED: uncharacterized protein LOC104593691    102   2e-21   
gb|KCW87320.1|  hypothetical protein EUGRSUZ_B03807                     105   2e-21   
emb|CDX87779.1|  BnaC02g31700D                                          105   2e-21   
ref|XP_006398229.1|  hypothetical protein EUTSA_v10000780mg             105   2e-21   
ref|XP_004152420.1|  PREDICTED: uncharacterized protein LOC101209159    105   3e-21   
gb|KDP45940.1|  hypothetical protein JCGZ_11843                         105   3e-21   
ref|XP_010481573.1|  PREDICTED: uncharacterized protein LOC104760360    105   3e-21   
gb|KCW45556.1|  hypothetical protein EUGRSUZ_L00714                     105   3e-21   
emb|CAN61968.1|  hypothetical protein VITISV_003279                     102   3e-21   Vitis vinifera
ref|XP_010040022.1|  PREDICTED: uncharacterized protein LOC104428779    105   4e-21   
ref|XP_006414015.1|  hypothetical protein EUTSA_v10024439mg             105   4e-21   
gb|KCW51701.1|  hypothetical protein EUGRSUZ_J01172                     104   4e-21   
gb|EAY81637.1|  hypothetical protein OsI_36806                          105   4e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010692889.1|  PREDICTED: uncharacterized protein LOC104905931    104   5e-21   
gb|KDP43572.1|  hypothetical protein JCGZ_16859                         104   5e-21   
ref|XP_004983450.1|  PREDICTED: uncharacterized protein LOC101760534    104   6e-21   
emb|CDX87780.1|  BnaC02g31690D                                          104   8e-21   
ref|XP_006398228.1|  hypothetical protein EUTSA_v10001216mg             104   8e-21   
ref|XP_010481562.1|  PREDICTED: uncharacterized protein LOC104760352    104   8e-21   
ref|XP_010441702.1|  PREDICTED: uncharacterized protein LOC104724847    103   9e-21   
gb|KEH43307.1|  DUF594 family protein                                   103   9e-21   
ref|XP_008225847.1|  PREDICTED: uncharacterized protein LOC103325459    103   9e-21   
ref|XP_008228196.1|  PREDICTED: uncharacterized protein LOC103327633    102   1e-20   
emb|CDY38969.1|  BnaC07g18510D                                          103   1e-20   
ref|NP_001068343.1|  Os11g0639300                                       103   1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KDO39751.1|  hypothetical protein CISIN_1g005146mg                   103   1e-20   
ref|XP_006426735.1|  hypothetical protein CICLE_v10025020mg             103   1e-20   
ref|XP_007217306.1|  hypothetical protein PRUPE_ppa015371mg             103   1e-20   
ref|XP_010494665.1|  PREDICTED: uncharacterized protein LOC104771784    103   2e-20   
ref|XP_006465849.1|  PREDICTED: uncharacterized protein LOC102607...    103   2e-20   
emb|CBI36698.3|  unnamed protein product                                102   2e-20   
ref|NP_193643.2|  uncharacterized protein                               100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217388.1|  hypothetical protein PRUPE_ppa025953mg           96.3    2e-20   
ref|XP_007221914.1|  hypothetical protein PRUPE_ppa026837mg             103   2e-20   
gb|KFK31560.1|  hypothetical protein AALP_AA6G127700                    103   2e-20   
gb|ABK28253.1|  unknown                                                 100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863470.1|  predicted protein                                  102   2e-20   
dbj|BAJ89418.1|  predicted protein                                      102   2e-20   
ref|XP_006398219.1|  hypothetical protein EUTSA_v10000775mg             103   2e-20   
gb|KDP43866.1|  hypothetical protein JCGZ_20876                       95.5    2e-20   
ref|XP_010650647.1|  PREDICTED: uncharacterized protein LOC100241320    102   2e-20   
ref|XP_010529253.1|  PREDICTED: uncharacterized protein LOC104806187    102   3e-20   
ref|XP_007200116.1|  hypothetical protein PRUPE_ppa018880mg           95.9    3e-20   
ref|XP_007214073.1|  hypothetical protein PRUPE_ppa017743mg             102   3e-20   
emb|CDX90102.1|  BnaA08g18820D                                          102   3e-20   
ref|XP_007227431.1|  hypothetical protein PRUPE_ppb023961mg           97.1    3e-20   
ref|XP_010112453.1|  hypothetical protein L484_013837                 95.9    3e-20   
ref|XP_010445807.1|  PREDICTED: uncharacterized protein LOC104728544    102   3e-20   
ref|XP_006663073.1|  PREDICTED: uncharacterized protein LOC102709120    102   4e-20   
ref|XP_010671772.1|  PREDICTED: uncharacterized protein LOC104888479    102   4e-20   
ref|XP_010650601.1|  PREDICTED: uncharacterized protein LOC104879459    101   4e-20   
ref|XP_010441715.1|  PREDICTED: uncharacterized protein LOC104724856    102   4e-20   
emb|CAN73463.1|  hypothetical protein VITISV_034873                     102   4e-20   Vitis vinifera
ref|XP_010671800.1|  PREDICTED: uncharacterized protein LOC104888495    101   4e-20   
ref|XP_008437035.1|  PREDICTED: uncharacterized protein LOC103482584    102   4e-20   
ref|XP_010481563.1|  PREDICTED: uncharacterized protein LOC104760353    102   4e-20   
ref|XP_010097448.1|  hypothetical protein L484_004684                   102   4e-20   
ref|XP_006280036.1|  hypothetical protein CARUB_v10025913mg             102   4e-20   
ref|XP_010061838.1|  PREDICTED: uncharacterized protein LOC104449398    101   5e-20   
ref|XP_002269508.1|  PREDICTED: uncharacterized protein LOC100261035    101   5e-20   Vitis vinifera
ref|XP_009128804.1|  PREDICTED: uncharacterized protein LOC103853646    101   5e-20   
gb|EMS47411.1|  hypothetical protein TRIUR3_14463                       101   6e-20   
ref|XP_010644941.1|  PREDICTED: uncharacterized protein LOC104877757    101   6e-20   
ref|XP_010650642.1|  PREDICTED: uncharacterized protein LOC100252444    101   6e-20   
emb|CDY39432.1|  BnaAnng05630D                                          101   6e-20   
ref|XP_010449415.1|  PREDICTED: uncharacterized protein LOC104731663    101   6e-20   
ref|XP_009101588.1|  PREDICTED: uncharacterized protein LOC103827791    101   6e-20   
ref|XP_006282059.1|  hypothetical protein CARUB_v10028304mg             101   7e-20   
ref|XP_010645062.1|  PREDICTED: uncharacterized protein LOC100259488    100   7e-20   
ref|XP_008228365.1|  PREDICTED: uncharacterized protein LOC103327776    101   7e-20   
ref|XP_002458635.1|  hypothetical protein SORBIDRAFT_03g037110          100   8e-20   Sorghum bicolor [broomcorn]
ref|XP_004496298.1|  PREDICTED: uncharacterized protein LOC101495324    100   8e-20   
ref|XP_002459209.1|  hypothetical protein SORBIDRAFT_02g000570          101   8e-20   Sorghum bicolor [broomcorn]
gb|KFK31554.1|  hypothetical protein AALP_AA6G127000                    101   8e-20   
ref|XP_010034687.1|  PREDICTED: uncharacterized protein LOC104423969    100   9e-20   
ref|XP_007015633.1|  Uncharacterized protein TCM_041206                 100   1e-19   
ref|XP_008670985.1|  PREDICTED: uncharacterized protein LOC103648281    100   1e-19   
emb|CDY39431.1|  BnaAnng05620D                                          100   1e-19   
ref|XP_010095740.1|  hypothetical protein L484_003352                   100   1e-19   
ref|XP_008224933.1|  PREDICTED: uncharacterized protein LOC103324630    100   1e-19   
gb|EAZ02516.1|  hypothetical protein OsI_24619                          100   1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002513101.1|  conserved hypothetical protein                     100   1e-19   Ricinus communis
ref|XP_002267918.2|  PREDICTED: uncharacterized protein LOC100242192    100   1e-19   Vitis vinifera
gb|EEC71644.1|  hypothetical protein OsI_04079                          100   2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_001044525.1|  Os01g0798800                                       100   2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003555479.1|  PREDICTED: uncharacterized protein LOC100799916  99.8    2e-19   
emb|CAA16765.1|  hypothetical protein                                 99.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001183408.1|  uncharacterized protein LOC100501828             97.8    2e-19   
ref|XP_007216037.1|  hypothetical protein PRUPE_ppa017443mg           93.6    2e-19   
ref|XP_004496121.1|  PREDICTED: uncharacterized protein LOC101495...  99.8    2e-19   
ref|XP_010650649.1|  PREDICTED: uncharacterized protein LOC100852780  99.4    3e-19   
emb|CDY38971.1|  BnaC07g18490D                                        99.4    3e-19   
ref|XP_010032441.1|  PREDICTED: uncharacterized protein LOC104421...  98.6    3e-19   
tpg|DAA57257.1|  TPA: hypothetical protein ZEAMMB73_901217            98.6    3e-19   
emb|CBI36717.3|  unnamed protein product                              94.4    3e-19   
ref|XP_003561517.1|  PREDICTED: uncharacterized protein LOC100832608  99.0    4e-19   
gb|KDP43872.1|  hypothetical protein JCGZ_20882                       92.0    4e-19   
gb|KHN00959.1|  hypothetical protein glysoja_000627                   98.6    4e-19   
gb|EMS52027.1|  hypothetical protein TRIUR3_01711                     98.6    4e-19   
ref|XP_010032440.1|  PREDICTED: uncharacterized protein LOC104421...  98.6    5e-19   
ref|XP_007214584.1|  hypothetical protein PRUPE_ppa025788mg           98.6    5e-19   
gb|KCW68870.1|  hypothetical protein EUGRSUZ_F02459                   98.6    5e-19   
ref|XP_010034349.1|  PREDICTED: uncharacterized protein LOC104423580  97.4    5e-19   
gb|EMT02725.1|  hypothetical protein F775_13361                       98.2    6e-19   
ref|XP_010529252.1|  PREDICTED: uncharacterized protein LOC104806186  98.6    6e-19   
ref|XP_008384010.1|  PREDICTED: uncharacterized protein LOC103446657  98.2    6e-19   
emb|CDM84572.1|  unnamed protein product                              98.2    6e-19   
ref|XP_002529493.1|  conserved hypothetical protein                   98.2    6e-19   Ricinus communis
ref|XP_007217587.1|  hypothetical protein PRUPE_ppa019290mg           98.2    6e-19   
ref|XP_004985802.1|  PREDICTED: uncharacterized protein LOC101763926  98.2    7e-19   
ref|XP_006586078.1|  PREDICTED: uncharacterized protein LOC100794157  98.2    7e-19   
ref|XP_003564400.2|  PREDICTED: uncharacterized protein LOC100835510  97.8    9e-19   
ref|XP_008362520.1|  PREDICTED: uncharacterized protein LOC103426202  97.4    1e-18   
gb|KHM99576.1|  hypothetical protein glysoja_006419                   97.8    1e-18   
gb|KEH40110.1|  DUF594 family protein                                 97.4    1e-18   
ref|XP_009347581.1|  PREDICTED: uncharacterized protein LOC103939247  97.1    1e-18   
gb|EAZ38443.1|  hypothetical protein OsJ_22821                        97.1    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003627290.1|  hypothetical protein MTR_8g020780                97.1    1e-18   
ref|NP_001058721.1|  Os07g0109100                                     97.1    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097432.1|  hypothetical protein L484_003203                 97.1    2e-18   
gb|EAZ02517.1|  hypothetical protein OsI_24621                        97.1    2e-18   Oryza sativa Indica Group [Indian rice]
gb|KDP43880.1|  hypothetical protein JCGZ_20890                       97.1    2e-18   
emb|CAN83022.1|  hypothetical protein VITISV_036395                   96.7    2e-18   Vitis vinifera
ref|XP_010650602.1|  PREDICTED: uncharacterized protein LOC104879460  96.7    2e-18   
ref|XP_010097434.1|  hypothetical protein L484_003205                 96.7    2e-18   
ref|XP_010086813.1|  hypothetical protein L484_009584                 96.7    2e-18   
ref|XP_010650637.1|  PREDICTED: uncharacterized protein LOC104879475  96.7    2e-18   
gb|EMT21377.1|  hypothetical protein F775_05712                       96.7    3e-18   
gb|KHN00983.1|  hypothetical protein glysoja_000651                   96.3    3e-18   
ref|XP_006606322.1|  PREDICTED: uncharacterized protein LOC102663983  96.3    3e-18   
emb|CAN59756.1|  hypothetical protein VITISV_034568                   96.3    3e-18   Vitis vinifera
gb|EAY77257.1|  hypothetical protein OsI_05231                        92.0    3e-18   Oryza sativa Indica Group [Indian rice]
gb|KFK31559.1|  hypothetical protein AALP_AA6G127600                  96.3    3e-18   
ref|XP_006657393.1|  PREDICTED: uncharacterized protein LOC102714841  96.3    3e-18   
ref|XP_010034372.1|  PREDICTED: uncharacterized protein LOC104423603  95.9    4e-18   
ref|NP_001058700.1|  Os07g0105800                                     95.9    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010650638.1|  PREDICTED: uncharacterized protein LOC104879477  95.5    5e-18   
gb|EEC81382.1|  hypothetical protein OsI_24593                        95.5    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_004980515.1|  PREDICTED: uncharacterized protein LOC101785884  94.4    5e-18   
gb|KCW53050.1|  hypothetical protein EUGRSUZ_J02347                   95.5    5e-18   
gb|EEC66778.1|  hypothetical protein OsI_33168                        95.5    5e-18   Oryza sativa Indica Group [Indian rice]
emb|CAN83020.1|  hypothetical protein VITISV_036393                   95.5    6e-18   Vitis vinifera
gb|KCW53121.1|  hypothetical protein EUGRSUZ_J02413                   95.1    6e-18   
ref|XP_010034674.1|  PREDICTED: uncharacterized protein LOC104423944  95.1    7e-18   
gb|KDP45937.1|  hypothetical protein JCGZ_11840                       92.8    8e-18   
gb|KHN37888.1|  hypothetical protein glysoja_017012                   94.4    1e-17   
gb|KCW53120.1|  hypothetical protein EUGRSUZ_J02412                   94.4    1e-17   
ref|XP_003535480.1|  PREDICTED: uncharacterized protein LOC100819249  94.4    1e-17   
ref|NP_001064403.1|  Os10g0348600                                     94.4    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KCW53127.1|  hypothetical protein EUGRSUZ_J02419                   94.4    1e-17   
ref|XP_002863605.1|  predicted protein                                93.2    2e-17   
ref|XP_008384008.1|  PREDICTED: uncharacterized protein LOC103446655  94.0    2e-17   
gb|KCW80598.1|  hypothetical protein EUGRSUZ_C01961                   87.0    2e-17   
ref|XP_010046501.1|  PREDICTED: uncharacterized protein LOC104435447  93.6    2e-17   
ref|XP_009101590.1|  PREDICTED: uncharacterized protein LOC103827792  93.6    2e-17   
emb|CAN66005.1|  hypothetical protein VITISV_027449                   93.6    2e-17   Vitis vinifera
emb|CDP19717.1|  unnamed protein product                              92.8    3e-17   
emb|CBI36704.3|  unnamed protein product                              91.3    3e-17   
ref|XP_002863480.1|  hypothetical protein ARALYDRAFT_916927           93.2    3e-17   
emb|CAN83215.1|  hypothetical protein VITISV_018465                   92.0    4e-17   Vitis vinifera
gb|KFK23680.1|  hypothetical protein AALP_AAs63807U000100             92.4    5e-17   
ref|XP_002459210.1|  hypothetical protein SORBIDRAFT_02g000580        92.4    6e-17   Sorghum bicolor [broomcorn]
ref|XP_011080567.1|  PREDICTED: uncharacterized protein LOC105163796  92.0    7e-17   
ref|XP_010086810.1|  hypothetical protein L484_009581                 91.7    9e-17   
gb|EMT29495.1|  hypothetical protein F775_03319                       91.7    1e-16   
ref|XP_002310459.2|  hypothetical protein POPTR_0007s02480g           91.3    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010101719.1|  hypothetical protein L484_017349                 90.9    2e-16   
gb|KCW86008.1|  hypothetical protein EUGRSUZ_B02714                   90.9    2e-16   
ref|XP_010654435.1|  PREDICTED: uncharacterized protein LOC100256613  90.5    2e-16   
emb|CBI35870.3|  unnamed protein product                              90.5    2e-16   
ref|XP_004987259.1|  PREDICTED: uncharacterized protein LOC101752865  90.5    3e-16   
ref|NP_001045426.2|  Os01g0953100                                     90.1    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56017.1|  hypothetical protein OsJ_04788                        90.1    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026528.1|  PREDICTED: uncharacterized protein LOC104416890  90.5    3e-16   
ref|XP_011026346.1|  PREDICTED: uncharacterized protein LOC105126985  90.1    3e-16   
ref|XP_009405632.1|  PREDICTED: uncharacterized protein LOC103988731  90.1    3e-16   
ref|XP_010905306.1|  PREDICTED: uncharacterized protein LOC105032542  89.7    3e-16   
gb|EMT09518.1|  hypothetical protein F775_22766                       90.1    3e-16   
ref|XP_010034671.1|  PREDICTED: uncharacterized protein LOC104423940  90.1    3e-16   
emb|CBI35872.3|  unnamed protein product                              90.1    4e-16   
gb|KHN00961.1|  hypothetical protein glysoja_000629                   89.7    4e-16   
ref|XP_006606311.1|  PREDICTED: uncharacterized protein LOC102661...  89.7    4e-16   
gb|KCW53387.1|  hypothetical protein EUGRSUZ_J02618                   89.4    4e-16   
ref|XP_010445279.1|  PREDICTED: uncharacterized protein LOC104727922  85.5    5e-16   
ref|XP_009758086.1|  PREDICTED: uncharacterized protein LOC104210813  89.4    5e-16   
ref|XP_009595825.1|  PREDICTED: uncharacterized protein LOC104092041  89.4    5e-16   
ref|XP_010654879.1|  PREDICTED: uncharacterized protein LOC100246334  89.4    5e-16   
ref|XP_010256381.1|  PREDICTED: uncharacterized protein LOC104596790  89.4    5e-16   
emb|CBI36708.3|  unnamed protein product                              89.4    6e-16   
emb|CBI36721.3|  unnamed protein product                              88.6    8e-16   
ref|NP_193644.1|  uncharacterized protein                             88.6    1e-15   
gb|EMS51957.1|  hypothetical protein TRIUR3_07227                     88.2    1e-15   
ref|XP_002870001.1|  predicted protein                                87.8    2e-15   
ref|XP_010654884.1|  PREDICTED: uncharacterized protein LOC100251572  87.8    2e-15   
gb|EMT31006.1|  hypothetical protein F775_04591                       87.8    2e-15   
gb|EMT22751.1|  hypothetical protein F775_22387                       83.2    2e-15   
gb|KFK31565.1|  hypothetical protein AALP_AA6G128300                  87.4    2e-15   
ref|XP_006282348.1|  hypothetical protein CARUB_v10028645mg           87.4    2e-15   
ref|XP_003560524.1|  PREDICTED: uncharacterized protein LOC100827023  87.0    4e-15   
ref|XP_007023048.1|  Uncharacterized protein TCM_027053               86.3    6e-15   
ref|XP_002459211.1|  hypothetical protein SORBIDRAFT_02g000600        86.3    6e-15   
emb|CAN77527.1|  hypothetical protein VITISV_041423                   85.9    6e-15   
ref|XP_010441723.1|  PREDICTED: uncharacterized protein LOC104724861  82.4    7e-15   
ref|XP_010434459.1|  PREDICTED: uncharacterized protein LOC104718...  85.9    7e-15   
ref|XP_010100619.1|  hypothetical protein L484_011550                 85.5    1e-14   
ref|XP_010481574.1|  PREDICTED: uncharacterized protein LOC104760361  85.5    1e-14   
ref|XP_010494651.1|  PREDICTED: uncharacterized protein LOC104771774  85.1    2e-14   
ref|XP_002865243.1|  hypothetical protein ARALYDRAFT_356466           84.7    2e-14   
ref|XP_008223773.1|  PREDICTED: uncharacterized protein LOC103323548  84.7    2e-14   
ref|XP_006414011.1|  hypothetical protein EUTSA_v10025163mg           84.3    2e-14   
ref|XP_010905787.1|  PREDICTED: uncharacterized protein LOC105032895  84.7    2e-14   
ref|XP_010449404.1|  PREDICTED: uncharacterized protein LOC104731659  84.7    2e-14   
gb|KCW53128.1|  hypothetical protein EUGRSUZ_J02420                   84.3    2e-14   
ref|XP_007208237.1|  hypothetical protein PRUPE_ppa017284mg           84.3    2e-14   
ref|XP_010034366.1|  PREDICTED: uncharacterized protein LOC104423598  84.3    2e-14   
ref|XP_002308790.2|  hypothetical protein POPTR_0006s01390g           84.0    3e-14   
ref|XP_010481582.1|  PREDICTED: uncharacterized protein LOC104760366  84.3    3e-14   
ref|XP_007146453.1|  hypothetical protein PHAVU_006G041900g           83.6    4e-14   
emb|CDX87778.1|  BnaC02g31710D                                        78.6    5e-14   
ref|XP_010034670.1|  PREDICTED: uncharacterized protein LOC104423939  79.3    5e-14   
ref|XP_010494649.1|  PREDICTED: uncharacterized protein LOC104771771  83.2    6e-14   
ref|XP_010063737.1|  PREDICTED: uncharacterized protein LOC104450749  83.2    6e-14   
ref|XP_006428081.1|  hypothetical protein CICLE_v10027077mg           82.8    8e-14   
ref|XP_010034689.1|  PREDICTED: uncharacterized protein LOC104423973  82.4    1e-13   
gb|KCW53129.1|  hypothetical protein EUGRSUZ_J02421                   82.4    1e-13   
ref|XP_007206620.1|  hypothetical protein PRUPE_ppa021729mg           80.1    1e-13   
ref|XP_010040126.1|  PREDICTED: uncharacterized protein LOC104428902  82.0    1e-13   
ref|XP_002322521.2|  hypothetical protein POPTR_0016s01380g           82.0    1e-13   
ref|XP_011014307.1|  PREDICTED: uncharacterized protein LOC105118131  82.0    2e-13   
gb|KCW51833.1|  hypothetical protein EUGRSUZ_J01282                   77.4    2e-13   
ref|XP_011001065.1|  PREDICTED: uncharacterized protein LOC105108443  81.6    2e-13   
ref|XP_011036419.1|  PREDICTED: uncharacterized protein LOC105133946  81.6    2e-13   
ref|XP_010041809.1|  PREDICTED: uncharacterized protein LOC104430776  79.0    2e-13   
ref|XP_006573315.1|  PREDICTED: uncharacterized protein LOC102662...  81.3    2e-13   
ref|XP_002303248.1|  hypothetical protein POPTR_0003s06300g           81.3    2e-13   
ref|XP_006573316.1|  PREDICTED: uncharacterized protein LOC102662...  81.3    3e-13   
gb|KHN43840.1|  hypothetical protein glysoja_039087                   81.3    3e-13   
gb|KCW77260.1|  hypothetical protein EUGRSUZ_D01615                   80.9    4e-13   
ref|XP_010034778.1|  PREDICTED: uncharacterized protein LOC104424095  80.1    4e-13   
ref|XP_010065308.1|  PREDICTED: uncharacterized protein LOC104452548  80.5    4e-13   
ref|XP_010039374.1|  PREDICTED: uncharacterized protein LOC104428074  79.7    4e-13   
ref|XP_010034787.1|  PREDICTED: uncharacterized protein LOC104424106  80.5    4e-13   
ref|XP_006387337.1|  hypothetical protein POPTR_1227s00200g           78.2    4e-13   
ref|XP_010065292.1|  PREDICTED: uncharacterized protein LOC104452532  79.3    5e-13   
ref|XP_011013300.1|  PREDICTED: uncharacterized protein LOC105117357  80.1    6e-13   
gb|KCW53489.1|  hypothetical protein EUGRSUZ_J02754                   80.1    6e-13   
gb|EEE66314.1|  hypothetical protein OsJ_22551                        80.1    6e-13   
ref|NP_001058497.1|  Os06g0703300                                     80.1    6e-13   
gb|EEC81273.1|  hypothetical protein OsI_24374                        79.7    7e-13   
ref|XP_011040249.1|  PREDICTED: uncharacterized protein LOC105136553  79.7    7e-13   
ref|XP_010039361.1|  PREDICTED: uncharacterized protein LOC104428054  78.6    1e-12   
ref|XP_006380760.1|  hypothetical protein POPTR_0007s12830g           79.0    1e-12   
ref|XP_010040125.1|  PREDICTED: uncharacterized protein LOC104428901  78.6    1e-12   
ref|XP_010917867.1|  PREDICTED: uncharacterized protein LOC105042386  79.0    1e-12   
gb|EMT29496.1|  hypothetical protein F775_03320                       78.6    2e-12   
ref|XP_004288842.1|  PREDICTED: uncharacterized protein LOC101309774  78.6    2e-12   
ref|XP_010034797.1|  PREDICTED: uncharacterized protein LOC104424118  74.7    2e-12   
ref|XP_011008994.1|  PREDICTED: uncharacterized protein LOC105114208  78.2    2e-12   
ref|XP_011043925.1|  PREDICTED: uncharacterized protein LOC105139248  78.2    2e-12   
ref|XP_011043926.1|  PREDICTED: uncharacterized protein LOC105139249  78.2    3e-12   
emb|CDY52752.1|  BnaA07g37670D                                        72.0    3e-12   
ref|XP_007024687.1|  Uncharacterized protein isoform 1                77.8    3e-12   
ref|XP_006429890.1|  hypothetical protein CICLE_v10013741mg           77.8    4e-12   
ref|XP_007214884.1|  hypothetical protein PRUPE_ppa022062mg           77.8    4e-12   
ref|XP_010034767.1|  PREDICTED: uncharacterized protein LOC104424081  77.4    4e-12   
ref|XP_002321761.2|  hypothetical protein POPTR_0015s11930g           77.4    4e-12   
ref|XP_006388862.1|  hypothetical protein POPTR_0088s00260g           77.4    4e-12   
ref|XP_007024692.1|  Uncharacterized protein TCM_029186               77.4    4e-12   
ref|XP_006374419.1|  hypothetical protein POPTR_0015s07020g           77.4    4e-12   
ref|XP_006374420.1|  hypothetical protein POPTR_0015s07020g           77.4    4e-12   
ref|XP_006380889.1|  hypothetical protein POPTR_0006s01400g           77.4    5e-12   
ref|XP_006374722.1|  hypothetical protein POPTR_0015s15940g           74.3    5e-12   
ref|XP_010042029.1|  PREDICTED: uncharacterized protein LOC104431034  77.4    5e-12   
ref|XP_010067369.1|  PREDICTED: uncharacterized protein LOC104454266  77.0    5e-12   
gb|KCW53122.1|  hypothetical protein EUGRSUZ_J02414                   77.0    5e-12   
gb|KDO39531.1|  hypothetical protein CISIN_1g039812mg                 75.1    6e-12   
ref|XP_010039377.1|  PREDICTED: uncharacterized protein LOC104428080  76.6    6e-12   
ref|XP_008385094.1|  PREDICTED: uncharacterized protein LOC103447684  77.0    7e-12   
emb|CAN77530.1|  hypothetical protein VITISV_041426                   76.6    7e-12   
ref|XP_011013312.1|  PREDICTED: uncharacterized protein LOC105117361  76.3    1e-11   
ref|XP_011014308.1|  PREDICTED: uncharacterized protein LOC105118132  75.9    1e-11   
ref|XP_010068526.1|  PREDICTED: uncharacterized protein LOC104455429  76.3    1e-11   
gb|KCW53507.1|  hypothetical protein EUGRSUZ_J02781                   75.9    1e-11   
ref|XP_011007780.1|  PREDICTED: uncharacterized protein LOC105113...  73.2    1e-11   
gb|KFK23681.1|  hypothetical protein AALP_AAs63807U000200             75.9    1e-11   
ref|XP_003566088.1|  PREDICTED: uncharacterized protein LOC100822318  75.9    1e-11   
ref|XP_003632780.2|  PREDICTED: uncharacterized protein LOC100854005  75.9    1e-11   
ref|XP_011043924.1|  PREDICTED: uncharacterized protein LOC105139246  74.3    2e-11   
ref|XP_011007782.1|  PREDICTED: uncharacterized protein LOC105113...  72.4    2e-11   
ref|XP_010063694.1|  PREDICTED: uncharacterized protein LOC104450714  75.9    2e-11   
ref|XP_006380892.1|  hypothetical protein POPTR_0006s01440g           75.5    2e-11   
ref|XP_002308793.2|  hypothetical protein POPTR_0006s014702g          75.9    2e-11   
gb|KDP40702.1|  hypothetical protein JCGZ_24701                       75.5    2e-11   
ref|XP_006428076.1|  hypothetical protein CICLE_v10027057mg           75.1    2e-11   
ref|XP_006428080.1|  hypothetical protein CICLE_v10027546mg           75.5    2e-11   
gb|KCW53510.1|  hypothetical protein EUGRSUZ_J02785                   75.5    2e-11   
ref|XP_010068533.1|  PREDICTED: uncharacterized protein LOC104455440  75.5    2e-11   
gb|KDO40246.1|  hypothetical protein CISIN_1g004920mg                 75.5    2e-11   
emb|CDY07584.1|  BnaC06g14800D                                        70.1    2e-11   
ref|XP_002308791.2|  hypothetical protein POPTR_0006s01420g           75.5    2e-11   
ref|XP_010068534.1|  PREDICTED: uncharacterized protein LOC104455442  75.5    2e-11   
ref|XP_009375975.1|  PREDICTED: uncharacterized protein LOC103964736  75.5    2e-11   
ref|XP_010677076.1|  PREDICTED: uncharacterized protein LOC104892776  75.5    2e-11   
ref|XP_006380891.1|  hypothetical protein POPTR_0006s01430g           75.1    2e-11   
emb|CBI36696.3|  unnamed protein product                              75.5    3e-11   
ref|XP_010066106.1|  PREDICTED: uncharacterized protein LOC104453284  69.3    3e-11   
ref|XP_010654883.1|  PREDICTED: uncharacterized protein LOC104880292  75.1    3e-11   
ref|NP_001059341.1|  Os07g0268800                                     74.7    3e-11   
ref|XP_011025974.1|  PREDICTED: uncharacterized protein LOC105126715  74.7    3e-11   
ref|XP_010068523.1|  PREDICTED: uncharacterized protein LOC104455426  75.1    3e-11   
ref|XP_010033736.1|  PREDICTED: uncharacterized protein LOC104422985  74.3    4e-11   
gb|EEC67029.1|  hypothetical protein OsI_33754                        74.3    4e-11   
ref|XP_006464330.1|  PREDICTED: uncharacterized protein LOC102626626  74.3    4e-11   
ref|XP_007041677.1|  Uncharacterized protein TCM_006509               74.3    5e-11   
ref|XP_006380894.1|  hypothetical protein POPTR_0006s01480g           73.9    6e-11   
emb|CDX83933.1|  BnaC08g17120D                                        73.6    6e-11   
gb|KDO39532.1|  hypothetical protein CISIN_1g004958mg                 73.9    6e-11   
ref|XP_010063782.1|  PREDICTED: uncharacterized protein LOC104450784  73.9    7e-11   
ref|XP_006428074.1|  hypothetical protein CICLE_v10027429mg           73.9    7e-11   
ref|XP_006374605.1|  hypothetical protein POPTR_0015s12610g           73.6    7e-11   
gb|KDO59993.1|  hypothetical protein CISIN_1g045810mg                 73.9    7e-11   
ref|XP_006428077.1|  hypothetical protein CICLE_v10027080mg           73.9    7e-11   
ref|XP_010230282.1|  PREDICTED: uncharacterized protein LOC100844438  73.9    7e-11   
emb|CDP21223.1|  unnamed protein product                              73.2    8e-11   
ref|XP_010064817.1|  PREDICTED: uncharacterized protein LOC104451970  73.6    8e-11   
ref|XP_010239449.1|  PREDICTED: uncharacterized protein LOC100837515  73.6    9e-11   
emb|CAC09499.2|  H0711G06.5                                           73.6    9e-11   
gb|EAY94723.1|  hypothetical protein OsI_16500                        73.2    1e-10   
ref|XP_010040122.1|  PREDICTED: uncharacterized protein LOC104428898  73.2    1e-10   
ref|XP_006663296.1|  PREDICTED: uncharacterized protein LOC102714688  73.2    1e-10   
emb|CBI21745.3|  unnamed protein product                              72.8    1e-10   
emb|CDP10893.1|  unnamed protein product                              73.2    1e-10   
ref|XP_009417393.1|  PREDICTED: uncharacterized protein LOC103997789  73.2    1e-10   
gb|EEC67877.1|  hypothetical protein OsI_35512                        69.7    1e-10   
gb|KCW53393.1|  hypothetical protein EUGRSUZ_J02624                   73.2    1e-10   
ref|XP_006388861.1|  hypothetical protein POPTR_0088s00250g           71.6    1e-10   
ref|XP_010067381.1|  PREDICTED: uncharacterized protein LOC104454275  72.8    1e-10   
ref|XP_006374604.1|  hypothetical protein POPTR_0015s12600g           72.8    1e-10   
ref|XP_011040360.1|  PREDICTED: uncharacterized protein LOC105136...  71.6    1e-10   
emb|CDP00343.1|  unnamed protein product                              72.8    1e-10   
ref|XP_007024666.1|  Uncharacterized protein TCM_029167               72.8    1e-10   
ref|XP_011040359.1|  PREDICTED: uncharacterized protein LOC105136...  72.0    1e-10   
ref|XP_010063749.1|  PREDICTED: uncharacterized protein LOC104450757  72.8    1e-10   
gb|KDP40701.1|  hypothetical protein JCGZ_24700                       72.8    1e-10   
ref|XP_010540150.1|  PREDICTED: uncharacterized protein LOC104814000  72.8    1e-10   
gb|EMT05949.1|  hypothetical protein F775_23342                       72.0    2e-10   
gb|KDO36152.1|  hypothetical protein CISIN_1g046752mg                 70.1    2e-10   
ref|XP_002308794.2|  hypothetical protein POPTR_0006s01460g           72.4    2e-10   
ref|XP_010058313.1|  PREDICTED: uncharacterized protein LOC104446102  72.4    2e-10   
ref|XP_010039368.1|  PREDICTED: uncharacterized protein LOC104428062  72.4    2e-10   
ref|XP_010034723.1|  PREDICTED: uncharacterized protein LOC104424021  72.4    2e-10   
gb|KDO40452.1|  hypothetical protein CISIN_1g0460321mg                70.5    2e-10   
ref|XP_011012477.1|  PREDICTED: uncharacterized protein LOC105116722  72.0    3e-10   
emb|CBI21744.3|  unnamed protein product                              71.6    3e-10   
ref|XP_007216290.1|  hypothetical protein PRUPE_ppa020495mg           72.0    3e-10   
ref|XP_007041672.1|  Uncharacterized protein TCM_006503               72.0    3e-10   
ref|XP_008664039.1|  PREDICTED: uncharacterized protein LOC103642565  71.2    4e-10   
ref|XP_006663294.1|  PREDICTED: uncharacterized protein LOC102713584  71.2    4e-10   
ref|XP_002322334.2|  hypothetical protein POPTR_0015s11910g           71.2    5e-10   
gb|AAD27550.1|AF111709_4  unknown                                     71.2    5e-10   
gb|EEC67874.1|  hypothetical protein OsI_35508                        70.5    5e-10   
gb|AFW57389.1|  putative protein of unknown function (DUF594) dom...  71.2    5e-10   
gb|AAU43981.1|  unknown protein                                       71.2    5e-10   
ref|XP_010236467.1|  PREDICTED: uncharacterized protein LOC104584055  70.9    6e-10   
gb|KCW53498.1|  hypothetical protein EUGRSUZ_J02766                   70.9    7e-10   
gb|AAD27549.1|AF111709_3  unknown                                     70.1    8e-10   
ref|XP_006374600.1|  hypothetical protein POPTR_0015s125402g          69.7    8e-10   
gb|EMT07255.1|  hypothetical protein F775_03010                       70.9    8e-10   
ref|XP_002322346.2|  hypothetical protein POPTR_0015s12520g           70.5    8e-10   
ref|XP_010065320.1|  PREDICTED: uncharacterized protein LOC104452555  70.5    9e-10   
ref|XP_004979532.1|  PREDICTED: uncharacterized protein LOC101782095  70.1    1e-09   
ref|XP_006428083.1|  hypothetical protein CICLE_v10027547mg           66.2    1e-09   
ref|XP_002445038.1|  hypothetical protein SORBIDRAFT_07g003190        69.7    1e-09   
gb|EMT10541.1|  hypothetical protein F775_01989                       69.3    2e-09   
gb|KCW53518.1|  hypothetical protein EUGRSUZ_J02797                   69.7    2e-09   
ref|XP_006437161.1|  hypothetical protein CICLE_v10033775mg           68.9    2e-09   
gb|EEE50564.1|  hypothetical protein OsJ_30706                        68.9    3e-09   
ref|XP_004972861.1|  PREDICTED: uncharacterized protein LOC101756667  68.9    3e-09   
ref|XP_006464314.1|  PREDICTED: uncharacterized protein LOC102619729  68.9    3e-09   
ref|XP_006388182.1|  hypothetical protein POPTR_0296s002002g          68.2    3e-09   
ref|XP_006398230.1|  hypothetical protein EUTSA_v10001177mg           65.1    3e-09   
ref|XP_010239284.1|  PREDICTED: uncharacterized protein LOC100822669  68.6    3e-09   
ref|XP_006428085.1|  hypothetical protein CICLE_v10027586mg           68.6    3e-09   
ref|XP_002443849.1|  hypothetical protein SORBIDRAFT_07g003260        68.6    3e-09   
ref|XP_006374598.1|  hypothetical protein POPTR_0015s12510g           68.6    3e-09   
ref|XP_007022010.1|  Uncharacterized protein TCM_032137               68.6    4e-09   
ref|XP_010068269.1|  PREDICTED: uncharacterized protein LOC104455124  68.6    4e-09   
ref|XP_002308789.2|  hypothetical protein POPTR_0006s01380g           68.2    4e-09   
ref|XP_006388856.1|  hypothetical protein POPTR_0088s00200g           68.2    4e-09   
ref|XP_010034688.1|  PREDICTED: uncharacterized protein LOC104423971  67.0    4e-09   
ref|XP_004963493.1|  PREDICTED: uncharacterized protein LOC101776589  68.2    4e-09   
emb|CDM81318.1|  unnamed protein product                              68.2    5e-09   
gb|AAX95894.1|  hypothetical protein                                  67.8    5e-09   
gb|EEE63323.1|  hypothetical protein OsJ_18134                        67.8    5e-09   
gb|KDO60975.1|  hypothetical protein CISIN_1g041586mg                 67.8    6e-09   
gb|EMT22269.1|  hypothetical protein F775_03252                       67.0    6e-09   
gb|EMT19134.1|  hypothetical protein F775_22189                       67.8    6e-09   
ref|XP_002442695.1|  hypothetical protein SORBIDRAFT_08g001295        67.4    6e-09   



>ref|XP_010644254.1| PREDICTED: uncharacterized protein LOC100260642 [Vitis vinifera]
Length=721

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 121/328 (37%), Positives = 166/328 (51%), Gaps = 79/328 (24%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF E+KE A  ++ + +A EI   RG   L +  C  S++ +V ++  + + +L+WHIAT
Sbjct  445   IFEELKEKAKSSEQSRIAKEICSGRGDWILSQNAC-HSLLWSVEKE--YDECLLMWHIAT  501

Query  949   EICYFNFGG-------------YRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNF  809
             ++CY+                  R  D D D ++C  +SEY+LYLLVM     SA+AG  
Sbjct  502   DLCYYKDKQEEKEKPDDVKEEELRRLDHDRDRQLCICLSEYMLYLLVMRPTMMSAVAG--  559

Query  808   ETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMW  629
                     I +  F+DT  EA  FF    +Q P  FK++                     
Sbjct  560   --------IGQIRFRDTCAEAKKFF-RRGQQEPNCFKKFC--------------------  590

Query  628   FSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQE  449
                    + I KL+      S   +           +  Y      CE L+   T+ +  
Sbjct  591   -------KQIKKLLHIGQSKSMEDQ-----------ISEY------CEQLLSVDTVVK--  624

Query  448   PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
             P EVKG RSKS+L DAC+LAKDL+     ++ + W +M  VWVELL Y A HCR + HAQ
Sbjct  625   PIEVKGDRSKSVLFDACMLAKDLRKL---NKTKRWMIMSKVWVELLSYAASHCRANTHAQ  681

Query  271   QLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+TFVWLLMAHFGLGEQFR Q
Sbjct  682   QLSKGGELITFVWLLMAHFGLGEQFRIQ  709



>ref|XP_010644255.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644256.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644258.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
Length=733

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 159/318 (50%), Gaps = 72/318 (23%)
 Frame = -1

Query  1114  EVKEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF  935
             E K    + + +A EI   RG   L +  C  S++ +V ++  + + +L+WHIAT++C++
Sbjct  467   EEKARRAEQSRIAKEICSGRGDWILSQNAC-HSLLWSVEKE--YDECLLMWHIATDLCHY  523

Query  934   NFGGYRyyddddDPE--------ICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIV  779
                  +   DD   E        +C  +SEY+LYLLVM     SA+AG          I 
Sbjct  524   KEQEEKEKPDDVQEEELRRLDRQLCICLSEYMLYLLVMRPTMMSAVAG----------IG  573

Query  778   ETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYI  599
             +  F+DT  EA  FF    +Q P  FK++   L+                          
Sbjct  574   QIRFRDTCAEAKKFF-RRGQQEPNCFKKFCKQLK--------------------------  606

Query  598   AKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSK  422
              KL+      S   +           +  Y      CE L+   T+    P EVKG RSK
Sbjct  607   -KLLRIGQSKSMEDQ-----------ISEY------CEQLLSVDTV--VNPIEVKGDRSK  646

Query  421   SMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLT  242
             S+L DAC+LAKDL+     ++ + WK+M  VWVELL Y A HCR + HAQQL+KGGEL+T
Sbjct  647   SVLFDACMLAKDLRKL---NKTKRWKIMSKVWVELLSYAASHCRANTHAQQLSKGGELIT  703

Query  241   FVWLLMAHFGLGEQFRFQ  188
             FVWLLMAHFGLGEQFR Q
Sbjct  704   FVWLLMAHFGLGEQFRIQ  721



>emb|CAN75530.1| hypothetical protein VITISV_001347 [Vitis vinifera]
Length=730

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 158/321 (49%), Gaps = 77/321 (24%)
 Frame = -1

Query  1114  EVKEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF  935
             E K    + + +A EI   RG   L +  C  S++ +V ++  + + +L+WHIAT++CY+
Sbjct  467   EEKARRAEKSRIAKEICSGRGDWILSQNAC-HSLLWSVEKE--YDECLLMWHIATDLCYY  523

Query  934   NFGG-------------YRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDT  794
                               R  D D   ++C  +SEY+LYLLVM     SA+AG       
Sbjct  524   KDKQEEKEKPDDVKEEELRRLDHDRXRQLCICLSEYMLYLLVMRPTMMSAVAG-------  576

Query  793   CEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRY  614
                I +  F+DT  EA  FF    +Q P  FK++                          
Sbjct  577   ---IGQIRFRDTCAEAKKFF-RRGQQEPNCFKKFC-------------------------  607

Query  613   AIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVK  434
               + I KL+      S   +           +  Y      CE L+   T+ +  P EVK
Sbjct  608   --KQIKKLLPIGQSKSMEDQ-----------ISEY------CEQLLSVDTVVK--PIEVK  646

Query  433   G-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKG  257
             G RSKS+L DAC+LAKDL+     ++ + W +M  VWVELL Y A HCR + HAQQL+KG
Sbjct  647   GDRSKSVLFDACMLAKDLRKL---NKTKRWMIMSKVWVELLSYAASHCRANTHAQQLSKG  703

Query  256   GELLTFVWLLMAHFGLGEQFR  194
             GEL+TFVWLLMAHFGLGEQFR
Sbjct  704   GELITFVWLLMAHFGLGEQFR  724



>ref|XP_010644262.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
 ref|XP_010644264.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
Length=735

 Score =   146 bits (368),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 106/320 (33%), Positives = 153/320 (48%), Gaps = 79/320 (25%)
 Frame = -1

Query  1096  TQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGG--  923
              + +  A EI   RG   L +  C   I +  G+   + + +LLWHIAT++C++      
Sbjct  468   AEDSKTAREICSGRGDWVLSQSACQSLIWSVDGE---YDEILLLWHIATDLCFYEMPSST  524

Query  922   YRyyddddDP----------EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
             +   +    P          E  +++S+Y+LYLLVM     SA+AG          I + 
Sbjct  525   HTDPEVGHQPSKEGSFDNRREFSKFLSDYMLYLLVMRPTMMSAVAG----------IGQI  574

Query  772   TFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAK  593
              F+DT EEA  FF      +   FK                                 + 
Sbjct  575   RFRDTCEEAKKFFRRKDIISGGKFKE--------------------------------SS  602

Query  592   LICFFNKDSTTHRE---MTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RS  425
             L+ +F K S+  ++      +WE             AC +L+   T+ +  P EVKG RS
Sbjct  603   LLSWFKKFSSERKKELMQEKIWE-------------ACAALLLIETVVK--PIEVKGDRS  647

Query  424   KSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELL  245
             KS+L DACILAK+L+     ++++ WK+M  VWVELL Y A HCR + HAQQ +KGGEL+
Sbjct  648   KSVLFDACILAKELKKL---NERKRWKVMSEVWVELLSYAASHCRANTHAQQFSKGGELV  704

Query  244   TFVWLLMAHFGLGEQFRFQT  185
             TFVWLLM   GLG+QFR + 
Sbjct  705   TFVWLLMTQLGLGDQFRVEA  724



>ref|XP_010648157.1| PREDICTED: uncharacterized protein LOC100255511 [Vitis vinifera]
Length=759

 Score =   142 bits (357),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/319 (34%), Positives = 153/319 (48%), Gaps = 70/319 (22%)
 Frame = -1

Query  1072  EIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDP  893
             EI   RG   L +  C   I +  G+   + +S+LLWHIAT++C++            DP
Sbjct  477   EICSGRGDWVLSQSACQSLIWSVDGE---YDKSLLLWHIATDLCFYEM----LSSTHTDP  529

Query  892   EI----------------CRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKD  761
             E+                 +++S+Y+LYLLVM     SA+AG          I +  F+D
Sbjct  530   EVGHQLSKEGSFDNRRKFSKFLSDYILYLLVMRPTMMSAVAG----------IGQIRFRD  579

Query  760   THEEAWNFF-----IANTK-QNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYI  599
             T EEA  FF     I   K +   L   +  F  S+    +    +   W          
Sbjct  580   TCEEAKKFFRRKDIIPGGKFKESSLLSWFKKFFPSSTGQSEPKCSMPWSWLEK-------  632

Query  598   AKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSK  422
                   F+ ++        + EE            AC++L+   T+ +  P EVKG RSK
Sbjct  633   ------FSSETKNELMREKIVEE------------ACKALLLIETVVK--PIEVKGDRSK  672

Query  421   SMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLT  242
             S+L DACILAK+L+     D+++ WK+M  VWVELL Y A  C  + H QQL+KGGEL+T
Sbjct  673   SVLFDACILAKELKKM---DERKRWKVMSEVWVELLSYAASRCGANTHVQQLSKGGELVT  729

Query  241   FVWLLMAHFGLGEQFRFQT  185
             FVWLLM   GLG+QFR +T
Sbjct  730   FVWLLMTQLGLGDQFRVET  748



>emb|CBI20385.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = -1

Query  490  CESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELL  314
            CE L+   T+    P EVKG RSKS+L DAC+LAKDL+     ++ + WK+M  VWVELL
Sbjct  49   CEQLLSVDTV--VNPIEVKGDRSKSVLFDACMLAKDLRKL---NKTKRWKIMSKVWVELL  103

Query  313  LYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             Y A HCR + HAQQL+KGGEL+TFVWLLMAHFGLGEQFR Q
Sbjct  104  SYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGEQFRIQ  145



>emb|CBI20387.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 6/102 (6%)
 Frame = -1

Query  490  CESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELL  314
            CE L+   T+ +  P EVKG RSKS+L DAC+LAKDL+     ++ + W +M  VWVELL
Sbjct  23   CEQLLSVDTVVK--PIEVKGDRSKSVLFDACMLAKDLRKL---NKTKRWMIMSKVWVELL  77

Query  313  LYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             Y A HCR + HAQQL+KGGEL+TFVWLLMAHFGLGEQFR Q
Sbjct  78   SYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGEQFRIQ  119



>ref|XP_006428002.1| hypothetical protein CICLE_v10025090mg [Citrus clementina]
 gb|ESR41242.1| hypothetical protein CICLE_v10025090mg [Citrus clementina]
 gb|KDO59887.1| hypothetical protein CISIN_1g048240mg [Citrus sinensis]
Length=664

 Score =   134 bits (336),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 149/323 (46%), Gaps = 101/323 (31%)
 Frame = -1

Query  1123  IFNEVKE--IATQTTAVANEIILSRGKRTL---LECNCGESIMTTVGQDV-------GFI  980
             IF+E+K+  +    T  A  I L+RG        E  C E+   +V  D+        F 
Sbjct  416   IFDELKKKSVYEIDTVTARRISLTRGDWIFEADSENVCNEN-FKSVRNDLKPYIAENAFD  474

Query  979   QSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             +S+LLWHIATE+ Y           D+D E  R +S+Y+LYLL+ +    SA+AG     
Sbjct  475   KSLLLWHIATELLY-----NTDEAVDNDKEFSRLLSDYMLYLLITQSGLMSAVAG-----  524

Query  799   DTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFST  620
                  I +  F+DT  EA               KR   F +S NV  D  I         
Sbjct  525   -----IGKIRFRDTCAEA---------------KR---FFKSKNVTSDKNI---------  552

Query  619   RYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSE  440
                                                     K AC+ ++   T    EP+E
Sbjct  553   ----------------------------------------KDACDEILSVNTF--AEPAE  570

Query  439   VKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLA  263
             VKG RSKS+L +A +LAK L+     DQK  WK++  +WVEL  Y A HC   +HAQQL+
Sbjct  571   VKGDRSKSLLFEATMLAKQLKKL---DQKSKWKLISKMWVELSSYAASHCDARSHAQQLS  627

Query  262   KGGELLTFVWLLMAHFGLGEQFR  194
             KGGEL+TFVWLLM+HFGLG+QF+
Sbjct  628   KGGELITFVWLLMSHFGLGKQFQ  650



>ref|XP_002510230.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52417.1| conserved hypothetical protein [Ricinus communis]
Length=647

 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 105/323 (33%), Positives = 148/323 (46%), Gaps = 85/323 (26%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVANE--------IILSRGKRTLLECNCGESIMTTVGQDVGFIQSVL  968
             IFN +K+      A +++        + + RG R L      E +  +V  +V F Q +L
Sbjct  384   IFNHLKKKFQDLKAQSDDGYAKKLKDLCMCRGARALKGFTFDEELRWSV--EVEFDQGIL  441

Query  967   LWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             +WHIAT++CY +        +D + +I   +S+Y+LYLLVM         G         
Sbjct  442   IWHIATDLCYHS---DHEAQNDTNRKISNSLSKYMLYLLVMRSTMLPMGIGKIR------  492

Query  787   KIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFL----RSNNVVLDIYICLRSMWFST  620
                   ++DT  EA  FF           +++ S L    RS N+   ++   R      
Sbjct  493   ------YQDTCAEATRFF-----------EKHESILGTIRRSQNLCNWVFNLFR------  529

Query  619   RYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSE  440
                                            K     +E + ACE L+   T+    P++
Sbjct  530   -------------------------------KGNPELKENQEACEVLLKVNTV--VPPAK  556

Query  439   VKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLA  263
             VKG RSKS+L DAC LA  LQ+         W++M +VWVE+L Y A HCRG  HAQQL 
Sbjct  557   VKGDRSKSVLFDACRLASQLQNI-----PNKWEVMGNVWVEMLAYAASHCRGTYHAQQLG  611

Query  262   KGGELLTFVWLLMAHFGLGEQFR  194
             +GGELLT VWLLMAHFGL EQF+
Sbjct  612   RGGELLTHVWLLMAHFGLTEQFQ  634



>gb|EYU27017.1| hypothetical protein MIMGU_mgv1a019065mg [Erythranthe guttata]
Length=696

 Score =   126 bits (317),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 82/117 (70%), Gaps = 7/117 (6%)
 Frame = -1

Query  529  WKMMKNYRERK-SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK  356
            W    N  +RK SACE L+   T+ +  P EVKG RSKS+L DAC+LA +L+ FG   + 
Sbjct  568  WSTPTNIGDRKVSACEKLMSVKTVVK--PREVKGDRSKSLLFDACMLAHELEKFG---EV  622

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            + W+MM  VWVELL Y A HCR + HA+QL++GGEL+ FVWL MAHFGLGEQFR + 
Sbjct  623  RKWEMMSKVWVELLAYAASHCRANEHARQLSEGGELIVFVWLQMAHFGLGEQFRIEA  679


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 75/121 (62%), Gaps = 10/121 (8%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLEC--NCGESIMTTVGQDVG--FIQSVLLW  962
             IFNE++  A   QT  +A EI  +RG+  LL+   +    ++++   D+   + +S+L+W
Sbjct  434   IFNELRTKAQKAQTNKMAKEIYSARGECVLLDYPRHYSYPLISSSVSDLESEYDESLLMW  493

Query  961   HIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR--DTCE  788
             HIATE+CYF        +++ + EIC+ +S+Y+LYLLVM  K  SA+AG  + R  DTCE
Sbjct  494   HIATELCYFT--STDQSNNNPNREICKVLSDYMLYLLVMRPKLMSAVAGIGQIRFTDTCE  551

Query  787   K  785
             +
Sbjct  552   E  552



>emb|CDP08030.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 6/107 (6%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            ++ ACE L+   T    EP  VKG RSKS+L DAC LAKDL++   DDQ+  W++M  VW
Sbjct  525  QRVACEKLLNVNT--DVEPIYVKGDRSKSVLFDACRLAKDLRNLE-DDQR--WEIMSKVW  579

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            VELL Y A HCR +AHAQ+L+KGGEL+TFVW+LMAHFGLGEQFR + 
Sbjct  580  VELLSYAASHCRPNAHAQELSKGGELITFVWILMAHFGLGEQFRIEA  626


 Score = 77.0 bits (188),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 18/134 (13%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNC--GESIMTTVGQDVGFIQSVLLWHI  956
             IF E+K  A   +T  VA EI  +RGKR L +  C    ++ ++V ++V + +S+LLWHI
Sbjct  396   IFQELKGKARKAETNKVAKEIYSARGKRALPDYICYRSSTMSSSVSEEVDYDESLLLWHI  455

Query  955   ATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ATE+CY    G +  +     E C+ IS+Y+LYLLVM     SA+AG          I +
Sbjct  456   ATELCYSTSPGDKNSNR----EFCKLISDYMLYLLVMRPTMMSAVAG----------IGQ  501

Query  775   TTFKDTHEEAWNFF  734
               F+DT EEA  FF
Sbjct  502   IRFQDTCEEAKKFF  515



>emb|CDP08013.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            +++AC++L+    L R    EVKG RSKS+L DAC LA DL+   ++D K MW++M  VW
Sbjct  518  KRNACKNLLNVNALVR--AIEVKGDRSKSILFDACRLANDLKK--LNDNK-MWEIMSKVW  572

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            VELL Y A HCR +AHAQQL+KGGEL+TFVW+LMAHFGLGEQFR + 
Sbjct  573  VELLSYAASHCRANAHAQQLSKGGELITFVWILMAHFGLGEQFRIEA  619


 Score = 79.7 bits (195),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 81/147 (55%), Gaps = 24/147 (16%)
 Frame = -1

Query  1123  IFNEVKEIATQ--TTAVANEIILSRGKRTLLECNCG---ESIMTTVGQDVGFIQSVLLWH  959
             IFNE+K  AT+  TT VA EI  +RG   LL+        +I ++VG +V + +S+LLWH
Sbjct  388   IFNELKVKATKAKTTNVAKEIYSARGDWALLDYTSHYPYPTISSSVGDEVEYDESLLLWH  447

Query  958   IATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIV  779
             IATE+CY         D + +   C+ IS+Y+LYLLVM     SA+AG          I 
Sbjct  448   IATELCY----CMSPDDGNSNRNYCKLISDYMLYLLVMRPNLMSAVAG----------IG  493

Query  778   ETTFKDTHEEAWNFF-----IANTKQN  713
             +  F+DT EEA  FF      AN K+N
Sbjct  494   QIRFRDTCEEAKKFFSRESSSANRKRN  520



>gb|KHG15627.1| hypothetical protein F383_22236 [Gossypium arboreum]
Length=728

 Score =   124 bits (311),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 128/268 (48%), Gaps = 52/268 (19%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAG  815
            DV F QS+L+WHIAT+ICY N             E    IS YL+YLL+           
Sbjct  499  DVDFDQSILIWHIATDICY-NSDLQSDTKIGQCREASLLISNYLIYLLL-----------  546

Query  814  NFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRS  635
             F  R     I    F+DT  EA  FF    +Q     K+     +    +L  +   + 
Sbjct  547  -FYPRMLPSGIGLIRFRDTDAEARRFF--KERQASSGAKQVNKITKYCRKLLRAWRFFKG  603

Query  634  MWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRR  455
              FS R                  TH ++T++             ++AC  L+   T   
Sbjct  604  RLFSYR------------------TH-QLTSV-------------ENACSMLVKVKT--D  629

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
              PS+VKG +SKS+L DAC LA  L+  GI D+K  W+M+R +W+E+L Y A  C G  H
Sbjct  630  VYPSKVKGDQSKSVLFDACKLASTLK--GISDEKVKWEMIREIWLEMLTYAASQCGGTQH  687

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            A QL +GGELLT VWLLMAHFG+ EQ +
Sbjct  688  ADQLIRGGELLTHVWLLMAHFGITEQLQ  715



>gb|KDP38344.1| hypothetical protein JCGZ_04269 [Jatropha curcas]
Length=564

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 127/269 (47%), Gaps = 68/269 (25%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAG  815
            DV F +S+++WHIA  +       Y     + + EI R +S+Y+LYLLVM         G
Sbjct  351  DVEFDRSIIIWHIARIL------NYHADRQEKNEEISRKLSQYMLYLLVMRSSMLPLAMG  404

Query  814  NFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRS  635
                      I +  ++DT  EA  FF     Q PE     AS ++         I L  
Sbjct  405  ----------IGKIRYQDTCAEATTFF-----QEPE---SVASGIKKYKDTSSWAISL--  444

Query  634  MWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRR  455
                     +Y       FN           L+E           K AC+ L+    +  
Sbjct  445  --------FKYTD-----FN-----------LYE-----------KKACKVLLNNDNIG-  468

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
              P +VKG R+ S+L DAC LA DLQ+       +MW+++  VW+E+L Y A HCRG  H
Sbjct  469  DPPVKVKGERTMSVLFDACRLASDLQNI-----PKMWEVVTDVWMEMLAYAASHCRGTNH  523

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            AQQL +GGELLT VWLLMAHFGL EQF+ 
Sbjct  524  AQQLGRGGELLTHVWLLMAHFGLTEQFQI  552



>ref|XP_007201599.1| hypothetical protein PRUPE_ppa019270mg [Prunus persica]
 gb|EMJ02798.1| hypothetical protein PRUPE_ppa019270mg [Prunus persica]
Length=723

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 130/277 (47%), Gaps = 67/277 (24%)
 Frame = -1

Query  985  FIQSVLLWHIATEICYF---------NFGGYRyyddddDPEICRYISEYLLYLLVMEQKF  833
            F QS+LLWHIAT++CY+         +             +  +++SEYLLYLLVM    
Sbjct  488  FDQSILLWHIATDLCYYSDLEDNPNSDLAKKPNSLSSRSWKASKFLSEYLLYLLVMRPFM  547

Query  832  TSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDI  653
                 G            +  F+DT  EA  FF                  +      D 
Sbjct  548  LPNGIG------------QIRFQDTCAEADEFF------------------KQRKCKGDR  577

Query  652  YICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIG  473
              C  S   ST                +S+  R+           K  R++K AC +L+G
Sbjct  578  KACKASPEVSTGVPA-----------AESSEQRKP----------KEDRQKK-ACTALLG  615

Query  472  KATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQMWKMMRSVWVELLLYG  305
             +T     P+EVKG RSKS+L DAC L KDLQ    +   + ++ W+++  VWVE+L Y 
Sbjct  616  VST--EVNPAEVKGDRSKSVLFDACRLTKDLQSLETEKHWENQKKWELISHVWVEMLSYA  673

Query  304  ACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            AC C+ + HA+QL +GGELLT VWLLMAH G+ EQF+
Sbjct  674  ACQCQWNHHARQLRRGGELLTHVWLLMAHLGITEQFQ  710



>ref|XP_010104853.1| hypothetical protein L484_024054 [Morus notabilis]
 gb|EXC02089.1| hypothetical protein L484_024054 [Morus notabilis]
Length=801

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 79/102 (77%), Gaps = 7/102 (7%)
 Frame = -1

Query  496  SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            SAC+S++   T    +P  VKG RSKS+L DACILAK+LQ FG    ++ W+++  VWVE
Sbjct  692  SACKSILRVNT--EVKPVTVKGDRSKSVLFDACILAKELQQFG----EEKWEILIKVWVE  745

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +L Y A HCR +AHAQQL+KGGEL+TF+WLLMAHFGLG+QF+
Sbjct  746  MLSYAASHCRPEAHAQQLSKGGELITFIWLLMAHFGLGDQFQ  787


 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/181 (26%), Positives = 77/181 (43%), Gaps = 32/181 (18%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLEC---NCGESIMTTVGQDVGFIQSVLLWH  959
             IFNE++  A   +   +A  I  ++G   L E    N   + +    +D+ + +S++LWH
Sbjct  539   IFNELQRKANDAEDAEIAKHIFEAKGCYVLQEGKWKNSDINKLIPYIEDLAYDESLVLWH  598

Query  958   IATEICYFN-----------------FGGYRyyddddDPEICRYISEYLLYLLVMEQKFT  830
             IATE+C+ +                           +  E  + +S+Y+LYLLV++    
Sbjct  599   IATELCFQDEQPEDKKDENNTKTNNVTTQNDKEQHKNYREFSKILSDYMLYLLVLQPTMM  658

Query  829   SALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIY  650
             SA+AG          I +  F+DT  EA  FFI       +      S LR N  V  + 
Sbjct  659   SAVAG----------IGQIRFRDTSAEAKKFFIRKGVGQNKNVSACKSILRVNTEVKPVT  708

Query  649   I  647
             +
Sbjct  709   V  709



>ref|XP_009377262.1| PREDICTED: uncharacterized protein LOC103965884 [Pyrus x bretschneideri]
Length=294

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRS  332
            R+ K ACE L+   T    EP  VKG RSKS+L DACILAK+L+   + D+K  W++M  
Sbjct  181  RQVKEACEKLLEVNT--DVEPVAVKGDRSKSVLFDACILAKELRK--LKDKK--WELMSE  234

Query  331  VWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            VWVE++ Y A HCR + HAQ L+KGGEL+TFVWLLMAHFG+GEQF+  
Sbjct  235  VWVEIMSYTASHCRANGHAQLLSKGGELVTFVWLLMAHFGIGEQFQIN  282


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 61/136 (45%), Gaps = 21/136 (15%)
 Frame = -1

Query  1108  KEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQ---DVGFIQSVLLWHIATEICY  938
             K +       A +I  +RG   L   +    ++T +     DV + +S+LLWHIATE+C+
Sbjct  48    KSMLADDPETARKIGAARGDWVLEGNDWDSKVITKLLSYVVDVEYDKSILLWHIATELCF  107

Query  937   FN--------FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKI  782
              +         G     +     E  + ISEY+LYLLVM+    S++ G          I
Sbjct  108   NDDKSKAEDEAGPEVSDETKKSKEHSKTISEYMLYLLVMQPSMMSSITG----------I  157

Query  781   VETTFKDTHEEAWNFF  734
              +  F+D   EA  FF
Sbjct  158   GQIRFRDACTEAKKFF  173



>ref|XP_007040801.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
 gb|EOY25302.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
Length=778

 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 138/269 (51%), Gaps = 42/269 (16%)
 Frame = -1

Query  895  PEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFI-----  731
            P + R IS+  ++L    +     + G+    D  ++I+  + +   +E W F       
Sbjct  507  PSLLRIISKISVFLSYAHK----IIMGSMGLNDLIDQILYVSREPFTKELWRFIFNELKT  562

Query  730  -ANTKQNPELFKRYAS-----FLRSNNVVLDIYICLR---SMWFSTRYAIRYIAKLICF-  581
             A+   +PE  KR ++      L  ++  +D    ++    + +     + +IA  IC+ 
Sbjct  563  KADYADDPEAAKRISAARGEWVLTDSDTKVDRSTLMQYVTDVQYDESLLLWHIATDICYN  622

Query  580  ------FNKDSTTHREMTT--LWEEWKMMKNYRERKS-------ACESLIGKATLRRQEP  446
                   +K+S  +RE      +E   ++   +  K        ACE++I   T    +P
Sbjct  623  TPDEKLVDKESYDYREFKAERFFERRGLLSKRKGNKKKENRVAEACEAIISVNT--DVKP  680

Query  445  SEVKG-RSKSMLIDACILAKDLQDFGIDDQK--QMWKMMRSVWVELLLYGACHCRGDAHA  275
              VKG RSKS+L DA +LAK+L    + ++K  Q WK++  VWVEL+ Y A HCR + HA
Sbjct  681  VTVKGDRSKSVLFDASMLAKELN---VLEKKGLQKWKLLSRVWVELISYAASHCRANTHA  737

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            QQL+KGGELLTF+WLLMAHFGLGEQF+  
Sbjct  738  QQLSKGGELLTFIWLLMAHFGLGEQFQIN  766



>ref|XP_010675838.1| PREDICTED: uncharacterized protein LOC104891781 [Beta vulgaris 
subsp. vulgaris]
Length=754

 Score =   120 bits (300),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 106/323 (33%), Positives = 153/323 (47%), Gaps = 48/323 (15%)
 Frame = -1

Query  1114  EVKEIATQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHIATEIC  941
             ++K  A +TT  A +   +RG          +  +I+     D+ + +S+L+WHIAT +C
Sbjct  454   KIKATAAETTEDAKKACEARGDLVFSPDEFADYSNILRPWTLDIDYDESLLIWHIATNLC  513

Query  940   YFNFGGYRyyddddDPEIC-------RYISEYLLYLLVMEQKFTSALAGNFETRDTCEKI  782
               N    +   +    E+C       R +  Y++YLL+M+   TS++AG          I
Sbjct  514   ILN-NPRKDDCERKQSELCCKFQKYSRMLGNYMMYLLIMKPSMTSSVAG----------I  562

Query  781   VETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYI-CLRSMWFSTRYAIR  605
              +   +DT EEA  F   + K   E   ++A   R        +I CL   W    Y   
Sbjct  563   AQVRLQDTCEEAKKFI--HRKLPQEEIGKWAKVER-------FFIKCL--FW---PYG--  606

Query  604   YIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQE--PSEVKG  431
                 +I     +  + RE T    E K  K+ +   S    L  K      E  P EVKG
Sbjct  607   ----MIKDLMNNCNSCRERTP---EAKKKKDSKLVDSRLPQLCRKILDVNTEWKPVEVKG  659

Query  430   -RSKSMLIDACILAKDLQDFGID-DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKG  257
              RSKS+L DAC LAK+L + G    +++ W++   VWVELL Y A   +  AH  QL +G
Sbjct  660   DRSKSVLFDACRLAKELIEIGKKRGEEKQWEVTFKVWVELLCYAASRSKPTAHLAQLREG  719

Query  256   GELLTFVWLLMAHFGLGEQFRFQ  188
             GE++T VWLLMAH GLGEQFR  
Sbjct  720   GEVITLVWLLMAHLGLGEQFRIN  742



>ref|XP_010670792.1| PREDICTED: uncharacterized protein LOC104887761 [Beta vulgaris 
subsp. vulgaris]
Length=744

 Score =   119 bits (299),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 147/309 (48%), Gaps = 62/309 (20%)
 Frame = -1

Query  1105  EIATQTTAVANEIILSRGKRTL-----LECNCGESIMTTVGQDVGFIQSVLLWHIATEIC  941
             E+AT    VA E+  SRG   L     L  +C    ++    DV + +S+L+WH+AT+IC
Sbjct  477   ELATDIE-VAKEVCSSRGSLVLEDDYFLASDC----ISPWTVDVDYDESLLIWHLATDIC  531

Query  940   YFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKD  761
             Y+           +   I + +S+Y+ YLL+ +Q   S++ G  +TR          F+D
Sbjct  532   YWT---STEDTTSEHRNISKALSDYMSYLLLRQQTLVSSVVGMADTR----------FED  578

Query  760   THEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICF  581
             T  +A  F                     NN  + I   L   W++ +   R++ K +C 
Sbjct  579   TRADAKKFM--------------------NNKSIKIS-WLADPWWTVK---RFLCKKLCC  614

Query  580   FNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDA  404
                  T       +  E K   N+ ++    ++ +        +P   KG +SKS+L DA
Sbjct  615   RTMSETDDSPSVRV--ENKFFMNFSKKLLEVKADV--------QPIVAKGDKSKSVLFDA  664

Query  403   CILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLM  224
             C LAK L+ FG    ++ W++   VWVELL Y A  C   +H  QL+KGGEL+T VWL M
Sbjct  665   CRLAKQLEMFG----EKKWEICSKVWVELLCYAAVRCSPRSHIAQLSKGGELITLVWLFM  720

Query  223   AHFGLGEQF  197
             AH GLGE+F
Sbjct  721   AHLGLGERF  729



>ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49599.1| conserved hypothetical protein [Ricinus communis]
Length=813

 Score =   120 bits (300),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 127/269 (47%), Gaps = 62/269 (23%)
 Frame = -1

Query  991  VGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGN  812
            V F Q +L+WHIAT ICY               +  + +S+Y+LYLLVM         GN
Sbjct  511  VEFDQGILIWHIATYICYHADSEENSDSISVCTKFSKQLSKYMLYLLVMHPSMMPMGIGN  570

Query  811  FETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSM  632
                          ++DT  EA  FF           +   SFL  +             
Sbjct  571  IR------------YRDTCAEATKFF-----------EERKSFLDDSQ---------PKS  598

Query  631  WFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESL--IGKATLR  458
            + S ++     A  +C   K+                 K   E++ AC+ L  +  A L 
Sbjct  599  YLSEKFG----ACWMCCCRKE-----------------KVIFEKRQACKMLLKVNTAVL-  636

Query  457  RQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDA  281
               P++VKG RSKS+L DAC LA +LQ   I ++++ W+M+  VWVE+L Y A  CRG  
Sbjct  637  ---PAKVKGDRSKSVLFDACKLASELQQ--ILNKEKKWEMVCHVWVEMLAYAASQCRGVY  691

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            HAQQL +GGELLT VWLLM+H GL EQF+
Sbjct  692  HAQQLRRGGELLTHVWLLMSHLGLTEQFQ  720



>gb|KCW68873.1| hypothetical protein EUGRSUZ_F02463 [Eucalyptus grandis]
 gb|KCW68874.1| hypothetical protein EUGRSUZ_F02463 [Eucalyptus grandis]
Length=683

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 122/270 (45%), Gaps = 81/270 (30%)
 Frame = -1

Query  985  FIQSVLLWHIATEICYFN-----FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSAL  821
            F Q +L WHIATE+CY++     F  YR         + + +S Y+ YLLV   ++ S L
Sbjct  476  FDQIILTWHIATELCYYSDNVREFTEYR---------LSKLLSRYMFYLLV---RYPSTL  523

Query  820  AGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICL  641
                        I +   +DT  EA  FF      NP   KR  S   S+N V       
Sbjct  524  PNG---------IGQIRIRDTFAEAIKFFEEQAHSNP---KRGESHGASSNEV-------  564

Query  640  RSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATL  461
                                                   + ++ R  KSAC+ L+   T 
Sbjct  565  ---------------------------------------VRRSRRALKSACDMLLKVNT-  584

Query  460  RRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGD  284
                P++VKG RSKS+L D C LA  L      ++ + WKM+  +WVE+LL+ A   RGD
Sbjct  585  -EVPPTKVKGGRSKSVLFDGCQLATALNKV---ERTKKWKMIGHLWVEVLLFAASQSRGD  640

Query  283  AHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             HA QL +GGELLT VWLL+AHFGL + F+
Sbjct  641  CHADQLRRGGELLTHVWLLLAHFGLTDHFK  670



>ref|XP_010061843.1| PREDICTED: uncharacterized protein LOC104449402 [Eucalyptus grandis]
Length=724

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 122/270 (45%), Gaps = 81/270 (30%)
 Frame = -1

Query  985  FIQSVLLWHIATEICYFN-----FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSAL  821
            F Q +L WHIATE+CY++     F  YR         + + +S Y+ YLLV   ++ S L
Sbjct  517  FDQIILTWHIATELCYYSDNVREFTEYR---------LSKLLSRYMFYLLV---RYPSTL  564

Query  820  AGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICL  641
                        I +   +DT  EA  FF      NP   KR  S   S+N V       
Sbjct  565  PNG---------IGQIRIRDTFAEAIKFFEEQAHSNP---KRGESHGASSNEV-------  605

Query  640  RSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATL  461
                                                   + ++ R  KSAC+ L+   T 
Sbjct  606  ---------------------------------------VRRSRRALKSACDMLLKVNT-  625

Query  460  RRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGD  284
                P++VKG RSKS+L D C LA  L      ++ + WKM+  +WVE+LL+ A   RGD
Sbjct  626  -EVPPTKVKGGRSKSVLFDGCQLATALNKV---ERTKKWKMIGHLWVEVLLFAASQSRGD  681

Query  283  AHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             HA QL +GGELLT VWLL+AHFGL + F+
Sbjct  682  CHADQLRRGGELLTHVWLLLAHFGLTDHFK  711



>ref|XP_009372850.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
 ref|XP_009372923.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
Length=756

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 76/101 (75%), Gaps = 7/101 (7%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+S++   T    +P++VKG RSKS+L DACILAK L    ++D+K  W +M  VWVEL
Sbjct  648  ACKSMLEVNT--DVKPADVKGDRSKSVLFDACILAKGL--IKMEDKK--WDLMSRVWVEL  701

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y ACHCR   HAQ L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  702  LSYAACHCRAKDHAQLLSKGGELVTFVWLLMAHFGIGEQFQ  742



>ref|XP_009371589.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
 ref|XP_009371593.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
Length=739

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K ACE L+   T    EP  VKG RSKS+L DACILAK+L+   ++D+K  W++M  VWV
Sbjct  629  KEACEKLLEVNT--DVEPVAVKGDRSKSVLFDACILAKELRK--LEDRK--WELMSEVWV  682

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            E+L Y A HCR + HAQ L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  683  EILSYTATHCRANDHAQLLSKGGELVTFVWLLMAHFGIGEQFQ  725


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 64/138 (46%), Gaps = 25/138 (18%)
 Frame = -1

Query  1108  KEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQ---DVGFIQSVLLWHIATEICY  938
             K +       A +I  +RG   L   +    ++T +     DV + +S+LLWHIATE+C+
Sbjct  493   KSMLADDPETARKIGAARGDWVLEGSDWDSKVITKLLSYVVDVEYDKSILLWHIATELCF  552

Query  937   FNFGGYRyyddddDPEI----------CRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
              +       + +  PE+           R IS+Y+LYLLVM+    S++ G         
Sbjct  553   ND--DKSKTEGEAAPEVSDETKKSKEHSRTISDYMLYLLVMQPSMMSSITG---------  601

Query  787   KIVETTFKDTHEEAWNFF  734
              I +  F+DT  EA  FF
Sbjct  602   -IGQIRFRDTCAEAKKFF  618



>ref|XP_007146447.1| hypothetical protein PHAVU_006G041300g [Phaseolus vulgaris]
 gb|ESW18441.1| hypothetical protein PHAVU_006G041300g [Phaseolus vulgaris]
Length=923

 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 125/246 (51%), Gaps = 43/246 (17%)
 Frame = -1

Query  886  CRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFF-----IANT  722
             + +S+Y+LYLL+M+    SA++G          I +  F+DT +EA NFF     IA  
Sbjct  686  SKLLSDYMLYLLIMQPTMMSAVSG----------IGQKRFQDTCKEATNFFSKRKSIAAG  735

Query  721  KQ--NPELFKRYASFLRSNNVVLDIYICL-----RSMWFSTRYAIRYIAKLICFFNKDST  563
            ++  N +L KR      +    L+ +I L     + +W   +  +R       FF +   
Sbjct  736  EKIMNEQLNKRK----NNGRPTLNSFISLVGEKTKDLWEKLKKVLRGTRCFGIFFKEKEE  791

Query  562  THREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKD  386
                    + E K+ +  R+ +  C            EPS VKG RSKS+L DAC LA  
Sbjct  792  GD------YSESKLKEACRQLRDVCVDY---------EPSAVKGDRSKSLLFDACKLAAV  836

Query  385  LQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLG  206
            +   G+++ K+ WK++  VWVELL Y A +C    H QQL+KGGE L+ VWLLM H GL 
Sbjct  837  INGLGLNETKK-WKLIAQVWVELLSYAAANCIPITHVQQLSKGGEFLSLVWLLMTHLGLA  895

Query  205  EQFRFQ  188
            +QF+ +
Sbjct  896  KQFQIK  901



>gb|KCW66957.1| hypothetical protein EUGRSUZ_F00719 [Eucalyptus grandis]
Length=577

 Score =   115 bits (288),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 8/123 (7%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            EM   ++E    KN +  K+AC+ L+   T    +P+ VKG +SKS+L DACILAK+L+ 
Sbjct  453  EMDRFFDEKFFDKN-KTNKNACQCLLSVPT--EVKPANVKGDKSKSVLFDACILAKELEK  509

Query  376  FGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            FG    K  W ++  VWVELL Y A HCR   HAQQL+KGGEL+T VWLLM H GL EQF
Sbjct  510  FG----KTKWVILSEVWVELLGYAAIHCRPYNHAQQLSKGGELVTLVWLLMVHLGLSEQF  565

Query  196  RFQ  188
              +
Sbjct  566  HIE  568


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (52%), Gaps = 13/127 (10%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVAN--EIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IFNE+K  A+    + +  E+  +RGK  L     GE   I+    +DV + +S+LLWHI
Sbjct  328   IFNELKRKASIPLNLQSITEVCAARGKWALEHTKTGEVCEILLPAVRDVDYSESLLLWHI  387

Query  955   ATEICY-------FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR-  800
             ATE+CY        +       +     EI +  S+Y+LYL++ + +  S +AG  + R 
Sbjct  388   ATELCYNIDTDTDTDTDTDNDGNISYHKEISKVFSDYMLYLMIKQPQMMSVVAGIGQIRF  447

Query  799   -DTCEKI  782
              DTC ++
Sbjct  448   QDTCAEM  454



>emb|CBI20393.3| unnamed protein product [Vitis vinifera]
Length=643

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 81/120 (68%), Gaps = 8/120 (7%)
 Frame = -1

Query  535  EEWKMMKNYRERK--SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID  365
            EE K  K   + K   AC +L+   T+ +  P EVKG RSKS+L DACILAK+L+     
Sbjct  518  EEAKKKKELMQEKIWEACAALLLIETVVK--PIEVKGDRSKSVLFDACILAKELKKL---  572

Query  364  DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            ++++ WK+M  VWVELL Y A HCR + HAQQ +KGGEL+TFVWLLM   GLG+QFR + 
Sbjct  573  NERKRWKVMSEVWVELLSYAASHCRANTHAQQFSKGGELVTFVWLLMTQLGLGDQFRVEA  632


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 57/118 (48%), Gaps = 17/118 (14%)
 Frame = -1

Query  1096  TQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGG--  923
              + +  A EI   RG   L +  C   I +  G+   + + +LLWHIAT++C++      
Sbjct  405   AEDSKTAREICSGRGDWVLSQSACQSLIWSVDGE---YDEILLLWHIATDLCFYEMPSST  461

Query  922   YRyyddddDP----------EICRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEK  785
             +   +    P          E  +++S+Y+LYLLVM     SA+A  G    RDTCE+
Sbjct  462   HTDPEVGHQPSKEGSFDNRREFSKFLSDYMLYLLVMRPTMMSAVAGIGQIRFRDTCEE  519



>ref|XP_008342346.1| PREDICTED: uncharacterized protein LOC103405164 [Malus domestica]
Length=739

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K ACE L+   T    EP  VKG RSKS+L DACILAK+L+   + D+K  W++M  VWV
Sbjct  629  KEACEKLLEVNT--DVEPVAVKGDRSKSVLFDACILAKELRK--LKDKK--WELMSEVWV  682

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            E++ Y A HCR + HAQ L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  683  EIMSYTASHCRANDHAQLLSKGGELVTFVWLLMAHFGIGEQFQ  725


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (46%), Gaps = 21/136 (15%)
 Frame = -1

Query  1108  KEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQ---DVGFIQSVLLWHIATEICY  938
             K +       A +I  +RG   L   +    ++T +     DV + +S+LLWHIATE+C+
Sbjct  493   KSMLADDPETARKIGAARGDWVLEGSDWDSKVITKLLSYVVDVEYDKSILLWHIATELCF  552

Query  937   FN--------FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKI  782
              +         G     +     E  + IS+Y+LYLLVM+    S++ G          I
Sbjct  553   NDDKSEAEGEAGPEVSDETKKSKEHSKTISDYMLYLLVMQPSMMSSITG----------I  602

Query  781   VETTFKDTHEEAWNFF  734
              +  F+DT  EA  FF
Sbjct  603   GQIRFRDTCAEAKKFF  618



>gb|KDP38349.1| hypothetical protein JCGZ_04274 [Jatropha curcas]
Length=973

 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 111/235 (47%), Gaps = 63/235 (27%)
 Frame = -1

Query  892  EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQN  713
            +I + +S+Y+LYLLVM         G    +DTC             EA  FF       
Sbjct  789  KISKSLSQYMLYLLVMRPSMLPMGIGKIRYQDTCT------------EATKFF-------  829

Query  712  PELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWE  533
             +  K  AS ++  N +        S W             I  F K +    E+     
Sbjct  830  -QEHKSTASGIQKYNNI--------SSW------------AINLFKKGTFDPYEI-----  863

Query  532  EWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK  356
                         AC +L+   T+    P +VKG RSKS+L DAC LA DLQ+    ++ 
Sbjct  864  ------------KACSALLNVNTVV--PPVKVKGDRSKSVLFDACRLASDLQNIPKPNR-  908

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
              W+++ +VWVE+L Y A HCRG  HAQQL +GGELLT VWLLMAHFGL EQF+ 
Sbjct  909  --WEVLSNVWVEMLAYAASHCRGTNHAQQLGRGGELLTHVWLLMAHFGLTEQFQI  961



>ref|XP_006464478.1| PREDICTED: uncharacterized protein LOC102617005 [Citrus sinensis]
Length=803

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 6/103 (6%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K AC+ ++   T    EP+EVKG RSKS+L +A +LAK L+     DQK  WK++  +WV
Sbjct  692  KDACDEILSVNTF--AEPAEVKGDRSKSLLFEATMLAKQLKKL---DQKSKWKLISKMWV  746

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            EL  Y A HC   +HAQQL+KGGEL+TFVWLLM+HFGLG+QF+
Sbjct  747  ELSSYAASHCDARSHAQQLSKGGELITFVWLLMSHFGLGKQFQ  789



>ref|XP_010495724.1| PREDICTED: uncharacterized protein LOC104772863 [Camelina sativa]
Length=842

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 150/319 (47%), Gaps = 43/319 (13%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF E+K+ +   +   VA ++  +RG+  L +    E   +M  + ++V + QS+L+WHI
Sbjct  544   IFYELKDKSDFAEKPEVAKKVSWARGEWALRDTKVAEIDRLMLYI-ENVDYDQSLLIWHI  602

Query  955   ATEICYFNFGGYRyyddddDP-----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTC  791
             ATE+C+    G    ++         E  + IS+Y++YLL+M+ K  S +AG        
Sbjct  603   ATELCFQKQEGDEEIENLSGESYDDREFSKIISDYMMYLLIMQPKLMSEVAG--------  654

Query  790   EKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYA  611
               I    F+DT  EA  FF +   ++    KR +  + S N  ++  +       S  + 
Sbjct  655   --IGTIRFRDTKAEAERFFKSRHIKDLRDMKRASETVLSVNNKIEPMLVKGDRSKSVLFE  712

Query  610   IRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG  431
                +AK +    + S    +   + + W  +  Y    S C++    A L R        
Sbjct  713   ASMLAKELGNLKETSNGDGKWRVMSKVWVELLCYAA--SHCKATEHVAQLSR--------  762

Query  430   RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGE  251
                           +L +F  +   + W++M  VWVELL Y A HC+   H  QL++GGE
Sbjct  763   ------------GGELLNFVCNGDGK-WRVMSKVWVELLCYAASHCKATEHVAQLSRGGE  809

Query  250   LLTFVWLLMAHFGLGEQFR  194
             LL FVWLLMAHFGL +QF+
Sbjct  810   LLNFVWLLMAHFGLADQFQ  828



>ref|XP_010054394.1| PREDICTED: uncharacterized protein LOC104442692 [Eucalyptus grandis]
Length=750

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K AC  ++   T    +P +VKG RSKS+L D CILAK+L+   +D+ K  WK+M  VWV
Sbjct  640  KDACLKILEVDT--SVKPMDVKGDRSKSVLFDGCILAKELKK--LDEHK--WKIMSKVWV  693

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            ELL Y A HCR + HAQ L+KGGEL+TFVWLLMAHFG+GEQF+  
Sbjct  694  ELLSYAASHCRAETHAQLLSKGGELVTFVWLLMAHFGIGEQFQIN  738


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 21/137 (15%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLEC--NCGESIMTTVGQDVGFIQSVLLWHI  956
             IF E+K  A+       A +I  +RG+  L +       S +    ++V + +S+LLWHI
Sbjct  498   IFEELKNKASVADDAETARKICEARGEWVLQDSMWEKDYSHLMQYVEEVEYDRSLLLWHI  557

Query  955   ATEICYFNFGGYRyyddddDPE---ICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEK  785
             ATEICY N           DP      + +S+Y+LYLLV + K  SA+AG          
Sbjct  558   ATEICYNN----DENPSTHDPHDRIFSKILSDYMLYLLVKQPKMMSAVAG----------  603

Query  784   IVETTFKDTHEEAWNFF  734
             I +  ++DT  EA  FF
Sbjct  604   IGQIRYRDTCAEAMKFF  620



>gb|KFK28578.1| hypothetical protein AALP_AA7G015200 [Arabis alpina]
Length=1019

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/317 (30%), Positives = 144/317 (45%), Gaps = 69/317 (22%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNC---GESIMTTVGQDVGFIQSVLLWH  959
             I+ EVK  +     +  A+ I  +RG+  L +       E ++  V  +V + QS+L+WH
Sbjct  744   IYEEVKRRSAFVVGMEGASHIYSARGEWILRDMKVEITNEKLLAHV-TEVDYDQSLLVWH  802

Query  958   IATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIV  779
             IATE+ +               E  + +SEY++YLL+++    S +AG          I 
Sbjct  803   IATELLH-QTEEDTAERHVRYKEFSKTLSEYMMYLLIVQPSLMSTVAG----------ID  851

Query  778   ETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYI  599
             +  F++   EA               KR    ++ + V                      
Sbjct  852   KIKFREAIAEA---------------KRLQKAVKQSQV----------------------  874

Query  598   AKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSK  422
                         THR +     + K +++ R+ K AC+ ++       Q     KG +SK
Sbjct  875   ---------SHVTHRYLY----QRKYVEDSRDAKMACQKILDSYKEVEQRNKNAKGYKSK  921

Query  421   SMLIDACILAKDLQDF-GIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELL  245
             S+L  A +LAK+LQ     +D   MW+++  VWVE+L Y A HC    HA QL +GGEL+
Sbjct  922   SILFQANMLAKELQRIQNREDGVGMWEVVSKVWVEMLCYAATHCDSKQHAAQLNRGGELI  981

Query  244   TFVWLLMAHFGLGEQFR  194
              FVWLLMAHFGLGEQFR
Sbjct  982   NFVWLLMAHFGLGEQFR  998



>ref|XP_007214131.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
 gb|EMJ15330.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
Length=675

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            +++ AC+ ++   T    EP  VKG RSKS+L DACILAK L D     +++ W++M  V
Sbjct  563  QQQEACQRILEVNT--EVEPVAVKGDRSKSVLFDACILAKKLMDL----KEKKWELMSKV  616

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A HCR + H Q L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  617  WVELLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGEQFQ  661


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 16/123 (13%)
 Frame = -1

Query  1093  QTTAVANEIILSRGKRTLLECNCGESIMTTVGQ---DVGFIQSVLLWHIATEICYFNFGG  923
              +T +   I  +RG   L + +   +  +T  +   +V + QS+LLWHIATE CY     
Sbjct  439   HSTPLTRRICSARGDWVLQDSDWNSTEHSTFLRYIVEVDYDQSILLWHIATEFCY---NM  495

Query  922   YRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAW  743
                  D D  +I + +S+Y+LYLLVM+   TS++AG          I +  F+DT  EA 
Sbjct  496   EWSDGDGDGCKISKALSDYMLYLLVMQPTLTSSVAG----------IGQIRFRDTCAEAK  545

Query  742   NFF  734
              FF
Sbjct  546   KFF  548



>ref|XP_011018639.1| PREDICTED: uncharacterized protein LOC105121611 [Populus euphratica]
Length=727

 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+S++G  T    +P +VKG RSKS+L DAC LAK LQ      +++ W+++  VWVEL
Sbjct  620  ACDSILGVNT--EVKPVDVKGDRSKSVLFDACRLAKLLQR-----EEKRWELLSKVWVEL  672

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A HCR  AHAQQ++KGGEL+TFVWLLMAHFGL +QF+
Sbjct  673  LSYAAGHCRATAHAQQVSKGGELITFVWLLMAHFGLADQFQ  713



>ref|XP_010904720.1| PREDICTED: uncharacterized protein LOC105032071 [Elaeis guineensis]
Length=676

 Score =   114 bits (285),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 6/107 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            + K AC  L+   T  +  P +VKG RSKS+L DAC+LAK L +  I+ +   WK+M +V
Sbjct  563  DEKQACHMLLSVET--KVPPVQVKGDRSKSILFDACMLAKALLELKIEKR---WKIMSAV  617

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            WVE+L Y A HCRG  HA+QL+ GGELLT VW LMAH G+GEQ+R +
Sbjct  618  WVEMLCYAASHCRGYYHAKQLSAGGELLTLVWFLMAHLGIGEQYRIE  664


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAG  815
            +V F +S+LLWHIAT++CY++ G     +   D  I + IS+Y+LYLLV+     +A  G
Sbjct  481  EVEFDESILLWHIATDLCYYSDGTNHSENIRSDQNISKAISDYMLYLLVVRPFMLTAGIG  540

Query  814  NFETRDTC  791
                 DTC
Sbjct  541  QIRYGDTC  548



>ref|XP_008224917.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
 ref|XP_008224918.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
Length=715

 Score =   114 bits (284),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            E+  AC+ ++   T    EP  VKG RSKS+L DACILAK L +     ++Q W++M  V
Sbjct  604  EQLEACQRILEVNT--EVEPVAVKGDRSKSVLFDACILAKKLME-----KEQKWELMSKV  656

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A HCR + H Q L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  657  WVELLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGEQFQ  701


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 20/135 (15%)
 Frame = -1

Query  1123  IFNEV--KEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQ---DVGFIQSVLLWH  959
             IF E+  K         A  I  +RG   L + +   +  +T+ +   +V + QS+LLWH
Sbjct  471   IFKELQSKSRLADDPETAKRIYSARGDWVLQDSDWNNTEHSTLLRYIVEVDYDQSILLWH  530

Query  958   IATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIV  779
             IATE CY          D D  +I + +S+Y+LYLLVM+   TS++AG          I 
Sbjct  531   IATEFCY-----NMELSDVDGRKISKALSDYMLYLLVMQPTLTSSVAG----------IG  575

Query  778   ETTFKDTHEEAWNFF  734
             +  F+DT  EA  FF
Sbjct  576   QIRFRDTCAEAKKFF  590



>emb|CDP21917.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   113 bits (282),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 6/107 (6%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            +++ACE L+    L +    EVKG RSKS+L DAC LAKDL+      +   W++M  VW
Sbjct  514  KRNACEKLLNVNALVKA--IEVKGDRSKSILFDACRLAKDLKKLNDKKR---WEIMSKVW  568

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            VELL Y A HCR +AHAQQL+KGGEL+TFVW+LMAHFGLGEQFR + 
Sbjct  569  VELLSYAASHCRANAHAQQLSKGGELITFVWILMAHFGLGEQFRIEA  615


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 70/139 (50%), Gaps = 20/139 (14%)
 Frame = -1

Query  1114  EVKEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF  935
             +VK    +TT VA EI  +RG   LL+          +   V + +S+LLWHIATE+CY 
Sbjct  393   KVKATKAKTTNVAKEIYSARGDLALLDYT-NHYPYPIISSKVEYDESLLLWHIATELCYC  451

Query  934   NFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTH  755
                     D + +   C+ IS+Y+LYLLVM     SA++G          I +  F+DT 
Sbjct  452   TIPD----DGNSNRNYCKLISDYMLYLLVMRPNLMSAVSG----------IGQIRFRDTC  497

Query  754   EEAWNFF-----IANTKQN  713
             EEA  FF      AN K+N
Sbjct  498   EEAKKFFSRDSSSANRKRN  516



>ref|XP_006368456.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
 gb|ERP65025.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
Length=729

 Score =   113 bits (282),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 8/101 (8%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+S++G  T    +P +VKG RSKS+L DAC LAK L+      +++ W+++  VWVEL
Sbjct  622  ACDSILGVNT--EVKPVDVKGDRSKSVLFDACRLAKLLER-----EEKRWELLSKVWVEL  674

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A HCR  AHAQQ++KGGEL+TFVWLLMAHFGL +QF+
Sbjct  675  LSYAAGHCRATAHAQQVSKGGELITFVWLLMAHFGLADQFQ  715



>ref|XP_010494654.1| PREDICTED: uncharacterized protein LOC104771778 [Camelina sativa]
Length=866

 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID--DQKQMWKMMRSV  329
            K A ++++  A   + EP +VKG RSKS+L D  +LAK+L+    +  D  +MWK+M  V
Sbjct  748  KVASDAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLAKELKGLSKNKEDDTEMWKIMSQV  807

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A  C    HA QL+KGGEL+TFVWLLMAHFGLG+QF+
Sbjct  808  WVELLCYAATKCGAIEHAAQLSKGGELITFVWLLMAHFGLGDQFQ  852



>ref|XP_002867956.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44215.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 101/317 (32%), Positives = 143/317 (45%), Gaps = 87/317 (27%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVANE--IILSRGKRTLLECNCG---ESIMTTVGQDVGFIQSVLLWH  959
             IF EVK  +       ++  I  +RG   L +   G   E ++  V  +V + QS+L+WH
Sbjct  548   IFEEVKRRSLLVVGSESDSYIYSARGDWILRDMRVGDIHEKLLQYV-TEVDYDQSILVWH  606

Query  958   IATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIV  779
             +ATE+ +          +    E  + +S+Y++YLL+++    S +AG          I 
Sbjct  607   VATELLH-QTQVDNAARNVRCNEFSKTLSDYMMYLLIVQPSMMSTVAG----------IN  655

Query  778   ETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYI  599
             +  F++   EA NF  A T     LF+R                                
Sbjct  656   KLRFREAIAEAKNFQEAKT-----LFQR--------------------------------  678

Query  598   AKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIG--KATLRRQEPSEVKG-R  428
                         TH E            + R+ K AC+ ++   K   RR E    KG +
Sbjct  679   ------------THVE------------DSRDAKKACKEIMDSYKKVERRYE--NTKGYQ  712

Query  427   SKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGEL  248
             SKS+L+ A ILAK+LQ    D    MW+++  VWVE+L Y A HC    HA QL KGGEL
Sbjct  713   SKSVLVQANILAKELQRIDGD----MWEVVSKVWVEMLCYAASHCDSKQHAAQLNKGGEL  768

Query  247   LTFVWLLMAHFGLGEQF  197
             + FVWLLMAHFGLGEQF
Sbjct  769   INFVWLLMAHFGLGEQF  785



>ref|XP_010055454.1| PREDICTED: uncharacterized protein LOC104443651 [Eucalyptus grandis]
Length=711

 Score =   112 bits (279),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 7/112 (6%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            K +   +E + A + ++G  T  R  P +VKG RSKS+L DA  LA+ L  F    +++ 
Sbjct  592  KELSTGKEHEEASKCILGVKTSVR--PVDVKGDRSKSVLFDASRLAQALMMF----KEEK  645

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WK++  VWVELL Y A HCR  AHA QL+KGGEL+TFVWLLMAHFGLGEQF+
Sbjct  646  WKIISKVWVELLSYAASHCRATAHAHQLSKGGELVTFVWLLMAHFGLGEQFQ  697



>emb|CBI34045.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            +P EVKG RSKS+L DACILAK+L+     D+++ WK+M  VWVELL Y A  C  + H 
Sbjct  349  KPIEVKGDRSKSVLFDACILAKELKKM---DERKRWKVMSEVWVELLSYAASRCGANTHV  405

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QQL+KGGEL+TFVWLLM   GLG+QFR +T
Sbjct  406  QQLSKGGELVTFVWLLMTQLGLGDQFRVET  435


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 55/114 (48%), Gaps = 25/114 (22%)
 Frame = -1

Query  1072  EIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDP  893
             EI   RG   L +  C   I +  G+   + +S+LLWHIAT++C++            DP
Sbjct  208   EICSGRGDWVLSQSACQSLIWSVDGE---YDKSLLLWHIATDLCFYEM----LSSTHTDP  260

Query  892   EI----------------CRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEK  785
             E+                 +++S+Y+LYLLVM     SA+A  G    RDTCE+
Sbjct  261   EVGHQLSKEGSFDNRRKFSKFLSDYILYLLVMRPTMMSAVAGIGQIRFRDTCEE  314



>ref|XP_002863471.1| hypothetical protein ARALYDRAFT_494430 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39730.1| hypothetical protein ARALYDRAFT_494430 [Arabidopsis lyrata subsp. 
lyrata]
Length=798

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF-GIDDQKQ  353
            + +K+ R+ K A E+++  +T    EP  VKG RSKS+L DA +LAK LQ+     ++  
Sbjct  674  RQIKDLRDMKRASETVLSVST--DIEPILVKGDRSKSVLFDASMLAKKLQNLKDSSNEDG  731

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             WK++  VWVELL Y A HC+   H  QL++GGELL FVWLLMAHFGLG+QF+
Sbjct  732  KWKVLSKVWVELLCYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLGDQFQ  784


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (53%), Gaps = 19/138 (14%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IFNE+K+ ++  +T  VA ++  +RG+  L +    E  ++M  + + V + QS+LLWHI
Sbjct  545   IFNELKDKSSFAETPEVAKKVSWARGEWALRDSKLAEVDTLMRYI-EKVDYDQSLLLWHI  603

Query  955   ATEICYF--NFGGYRyyddddDP--EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+C+   + G       +     E  + IS+Y++YLL+M  K  S +AG         
Sbjct  604   ATELCFQKEDVGKMENLSKESYDDREFSKIISDYMMYLLIMRPKLMSEVAG---------  654

Query  787   KIVETTFKDTHEEAWNFF  734
              I    F+DT  EA  FF
Sbjct  655   -IGTIRFRDTKAEAERFF  671



>ref|NP_199361.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09176.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95257.1| uncharacterized protein AT5G45480 [Arabidopsis thaliana]
Length=877

 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF--GIDDQKQMW  347
            K   + K A  +++  A   + EP +VKG RSKS+L D  +LAK+L+      +D  +MW
Sbjct  753  KKAPDAKEASVAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLAKELKGLRKNKEDDSEMW  812

Query  346  KMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            K+M  VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  813  KIMSQVWVELLSYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  863



>ref|XP_008813358.1| PREDICTED: uncharacterized protein LOC103724015 [Phoenix dactylifera]
Length=676

 Score =   110 bits (276),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 6/103 (6%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            ACE L+   T  +  P +VKG RSKS+L DAC+LAK L +  ++ +   WK+M  VWVE+
Sbjct  567  ACEMLLSVET--KVPPIQVKGDRSKSILFDACMLAKHLLELKVEKR---WKIMSVVWVEM  621

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            L Y A HCRG  HA+QL+ GGELLT VW LMAH G+G+Q+R +
Sbjct  622  LCYAASHCRGYYHAKQLSTGGELLTLVWFLMAHLGIGDQYRIE  664


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 13/114 (11%)
 Frame = -1

Query  1108  KEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQ--------DVGFIQSVLLWHIA  953
             KEI  +T++  +    S+G +    C  GE  +   G         +V F +S+LLWHIA
Sbjct  440   KEIKNKTSSAED----SQGYKRFSTCR-GEWALQRKGYRKELGWSVEVEFDESILLWHIA  494

Query  952   TEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTC  791
             T++CY+  G         D +I + IS+Y+LYLLV+     SA  G     DTC
Sbjct  495   TDLCYYFDGINHPKGILSDQKISKAISDYMLYLLVVRPFMLSAGIGQIRYGDTC  548



>ref|XP_006437480.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
 gb|ESR50720.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
Length=831

 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            + K ACE ++   T  +  PS VKG RSKS+L D  ILAK+L+     +++  W++M  V
Sbjct  718  DEKEACEKILNVKTYVK--PSAVKGDRSKSVLFDGSILAKELKKL---EKRDRWELMSKV  772

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+ELL Y A HC   AHAQ ++ GGEL+TFVWLLMAHFGLGEQF+
Sbjct  773  WLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGEQFK  817



>gb|KDO53052.1| hypothetical protein CISIN_1g040228mg [Citrus sinensis]
Length=831

 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (70%), Gaps = 6/105 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            + K ACE ++   T  +  PS VKG RSKS+L D  ILAK+L+     +++  W++M  V
Sbjct  718  DEKEACEKILNVQTYVK--PSAVKGDRSKSVLFDGSILAKELKKL---EKRDRWELMSKV  772

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+ELL Y A HC   AHAQ ++ GGEL+TFVWLLMAHFGLGEQF+
Sbjct  773  WLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGEQFK  817



>ref|XP_006464315.1| PREDICTED: uncharacterized protein LOC102620009 isoform X1 [Citrus 
sinensis]
Length=356

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 6/111 (5%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            E K ACES++   T     P +VKG ++KS+L DA +LAK+LQ+  +  +   WK++  V
Sbjct  237  EVKKACESILKVDT--SFPPRDVKGDKTKSVLFDASVLAKELQELEVGKK---WKLVSQV  291

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGT  176
            WVELL Y A HC    HAQQ+++GGEL+TFVWLLMAHFGL EQF    + T
Sbjct  292  WVELLSYAAFHCGPRTHAQQVSEGGELITFVWLLMAHFGLVEQFEDNKLDT  342


 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = -1

Query  1123  IFNEVK--EIATQTTAVANEIILSRGKRTLLECNCGESIMTTVG-QDVGFIQSVLLWHIA  953
             I+NEVK   ++  +      I  ++G   L E N GE ++ + G  DV + +S+LLWH A
Sbjct  107   IYNEVKRKSLSAGSPEALRRICSAKGDWILQEWN-GEVVLESYGIADVAYDESILLWHTA  165

Query  952   TEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEKIV  779
             TE+ Y+           +  E  + +S+Y+LYLLV +     A+A       +DTC   V
Sbjct  166   TELLYYTTEEGADEITYNAREFSKLLSDYILYLLVSKPAIMDAVAVIAKIRLQDTCADAV  225



>ref|XP_008371249.1| PREDICTED: uncharacterized protein LOC103434679 [Malus domestica]
Length=760

 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 71/102 (70%), Gaps = 7/102 (7%)
 Frame = -1

Query  496  SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            + C+S++   T  +  P++VKG RSKS+L DACILAK L +         W +M  VWVE
Sbjct  651  TVCKSILDVNTAVK--PADVKGDRSKSVLFDACILAKKLXEM----XXXKWDLMSQVWVE  704

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            LL Y A HCR + H Q L+KGGEL+TFVWLLMAHFG+GEQF+
Sbjct  705  LLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGEQFQ  746



>ref|XP_009392549.1| PREDICTED: uncharacterized protein LOC103978475 [Musa acuminata 
subsp. malaccensis]
Length=679

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 78/105 (74%), Gaps = 6/105 (6%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            + ACE L+   T  +  P +VKG RSKS+L DAC+LAKDL +  +++Q++ WK++ +VWV
Sbjct  568  EQACEMLLCVET--KVPPVQVKGDRSKSVLFDACMLAKDLLE--VEEQRR-WKLVSAVWV  622

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            E+L Y A +CRG  HA+QL+ GGELLT VW LMAH G+GEQ+R +
Sbjct  623  EMLCYAASNCRGYFHAKQLSAGGELLTMVWFLMAHLGIGEQYRIE  667



>ref|XP_006342534.1| PREDICTED: uncharacterized protein LOC102605257 isoform X1 [Solanum 
tuberosum]
 ref|XP_006342535.1| PREDICTED: uncharacterized protein LOC102605257 isoform X2 [Solanum 
tuberosum]
Length=696

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 4/86 (5%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P++VKG RSKS+L DACILAK L++ G    ++ W+++  VWVE+L Y A HCRG+ HAQ
Sbjct  601  PAKVKGDRSKSVLFDACILAKSLKEKG---TQRKWEIISEVWVEMLAYAATHCRGNHHAQ  657

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            QL KGGELLT VWLLMAH G+ EQF+
Sbjct  658  QLRKGGELLTHVWLLMAHLGITEQFQ  683


 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 15/171 (9%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVANEIIL--SRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IFN  ++ A ++    +  +L  SRG + L + +C   + +T   +V F QS L+WHIAT
Sbjct  461   IFNHFQKFAGESDNEPDHPVLCTSRGTKALTKNDCSSLVWST---EVEFDQSFLIWHIAT  517

Query  949   EICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE--  776
             ++CY+   G          +I + +S+Y+LYLLV+         G    RDTC +  E  
Sbjct  518   DLCYYTDDG-STPRSIKSKQISKQLSDYMLYLLVVCPFMLPIGLGMIRFRDTCAEAKEFF  576

Query  775   ---TTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSM  632
                   KD    +      NT+  P   K      RS +V+ D  I  +S+
Sbjct  577   TERKVGKDLAIASRKLLTVNTEVRPAKVKGD----RSKSVLFDACILAKSL  623



>ref|XP_010441713.1| PREDICTED: uncharacterized protein LOC104724853 isoform X4 [Camelina 
sativa]
Length=882

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 7/107 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGI----DDQKQMWKMMR  335
            K A  +++  A   + EP +VKG RSKS+L D  +LA++L+  GI    +D  +MWK+M 
Sbjct  764  KEASNAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLAEELK--GISKNKEDDTEMWKIMS  821

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  822  QVWVELLCYAATKCGAVEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  868



>ref|XP_010441710.1| PREDICTED: uncharacterized protein LOC104724853 isoform X1 [Camelina 
sativa]
 ref|XP_010441711.1| PREDICTED: uncharacterized protein LOC104724853 isoform X2 [Camelina 
sativa]
 ref|XP_010441712.1| PREDICTED: uncharacterized protein LOC104724853 isoform X3 [Camelina 
sativa]
Length=876

 Score =   109 bits (273),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 7/107 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGI----DDQKQMWKMMR  335
            K A  +++  A   + EP +VKG RSKS+L D  +LA++L+  GI    +D  +MWK+M 
Sbjct  758  KEASNAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLAEELK--GISKNKEDDTEMWKIMS  815

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  816  QVWVELLCYAATKCGAVEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  862



>ref|XP_006282044.1| hypothetical protein CARUB_v10028286mg [Capsella rubella]
 gb|EOA14942.1| hypothetical protein CARUB_v10028286mg [Capsella rubella]
Length=834

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L DA  LAKDL +     +K  W+++  VWVELL Y ACHC   AH 
Sbjct  734  EPMDVKGDRSKSVLFDASRLAKDLTEMEKTHEKDKWEILSKVWVELLCYAACHCDATAHV  793

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  794  EQLSRGGELINFVWLLMAHFGLTDQFQ  820



>gb|KCW45907.1| hypothetical protein EUGRSUZ_L002281, partial [Eucalyptus grandis]
Length=524

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/295 (30%), Positives = 131/295 (44%), Gaps = 81/295 (27%)
 Frame = -1

Query  1060  SRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICR  881
             SRG   L   NC   +  ++  D  F +S+++WHIATEICY      +  D     ++ +
Sbjct  304   SRGIHALKRNNCSVGLEWSIELD--FDESIVVWHIATEICYHLSADSKSDDGI---KVSK  358

Query  880   YISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELF  701
              +S+Y++YLLVM  K           R+T        F+DT+  A  FF    +Q PE  
Sbjct  359   CLSQYMVYLLVMNPKLLP--------RET----TRVRFQDTYAAAMRFF----EQLPENQ  402

Query  700   KRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKM  521
             KR           LD+    + +             L+   NKD+ T             
Sbjct  403   KRPR---------LDMTNACKKL-------------LLLVTNKDNLT-------------  427

Query  520   MKNYRERKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
             + N R                       + +SK +L + C LA  L+   IDD+K+ W++
Sbjct  428   VPNVR-----------------------RSKSKFLLYNGCRLASKLR--HIDDEKERWRV  462

Query  340   MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGT  176
             +  VW+E+L Y A  C    HA+QL +GGELLT VW LM HFGL + F+ ++V  
Sbjct  463   VSEVWIEMLAYAASKCDTKCHARQLRRGGELLTHVWFLMTHFGLTDNFKIKSVPA  517



>ref|XP_006484676.1| PREDICTED: uncharacterized protein LOC102625373 [Citrus sinensis]
Length=831

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            + K ACE ++   T  +  PS VKG RSKS+L D  IL K+L+     +++  W++M  V
Sbjct  718  DEKEACEKILNVQTYVK--PSAVKGDRSKSVLFDGSILTKELKKL---EKRDRWELMSKV  772

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+ELL Y A HC   AHAQ ++ GGEL+TFVWLLMAHFGLGEQF+
Sbjct  773  WLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGEQFK  817



>ref|XP_006426720.1| hypothetical protein CICLE_v10027206mg [Citrus clementina]
 gb|ESR39960.1| hypothetical protein CICLE_v10027206mg [Citrus clementina]
Length=674

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 81/127 (64%), Gaps = 8/127 (6%)
 Frame = -1

Query  562  THREMTTLWEEWKMMKNYRERKS---ACESLIGKATLRRQEPSEVKG-RSKSMLIDACIL  395
            T +E    +EE    +NY++R     AC+ L+   T  R  P +VKG RSKS+L DAC L
Sbjct  539  TCQEARRFFEERMSGENYQKRARRIRACKMLLKVKTDVR--PIKVKGDRSKSVLFDACSL  596

Query  394  AKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHF  215
            A  L +  I D K+ WKM+R VW+E+L Y A   RG  HAQQL +GGELLT VWLLMAHF
Sbjct  597  ASALNE--ISDTKKRWKMVRDVWLEMLTYAASQGRGSQHAQQLKRGGELLTHVWLLMAHF  654

Query  214  GLGEQFR  194
            GL  QF+
Sbjct  655  GLTGQFQ  661



>ref|XP_010039521.1| PREDICTED: uncharacterized protein LOC104428225 [Eucalyptus grandis]
Length=531

 Score =   108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/295 (30%), Positives = 131/295 (44%), Gaps = 81/295 (27%)
 Frame = -1

Query  1060  SRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICR  881
             SRG   L   NC   +  ++  D  F +S+++WHIATEICY      +  D     ++ +
Sbjct  311   SRGIHALKRNNCSVGLEWSIELD--FDESIVVWHIATEICYHLSADSKSDDGI---KVSK  365

Query  880   YISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELF  701
              +S+Y++YLLVM  K           R+T        F+DT+  A  FF    +Q PE  
Sbjct  366   CLSQYMVYLLVMNPKLLP--------RET----TRVRFQDTYAAAMRFF----EQLPENQ  409

Query  700   KRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKM  521
             KR           LD+    + +             L+   NKD+ T             
Sbjct  410   KRPR---------LDMTNACKKL-------------LLLVTNKDNLT-------------  434

Query  520   MKNYRERKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
             + N R                       + +SK +L + C LA  L+   IDD+K+ W++
Sbjct  435   VPNVR-----------------------RSKSKFLLYNGCRLASKLR--HIDDEKERWRV  469

Query  340   MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGT  176
             +  VW+E+L Y A  C    HA+QL +GGELLT VW LM HFGL + F+ ++V  
Sbjct  470   VSEVWIEMLAYAASKCDTKCHARQLRRGGELLTHVWFLMTHFGLTDNFKIKSVPA  524



>ref|XP_008228369.1| PREDICTED: uncharacterized protein LOC103327780 [Prunus mume]
Length=681

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ-KQMWK  344
            K+    K+AC+ L+  +T  +  PSEVKG RSKS+L DAC LAK LQ  G ++  ++ W+
Sbjct  561  KSIANEKNACKMLLKVST--KILPSEVKGDRSKSVLFDACRLAKALQALGDEENGEKKWE  618

Query  343  MMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +M  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAHFGL E+ +
Sbjct  619  LMSDVWVEMLCYAANQCRWSDHAQQLRRGGELLTHVWLLMAHFGLTEKLQ  668


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 6/116 (5%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEI  944
             I+ ++++ A+       ++   R      + NC E +  T+ +   F QS++LWHIAT+I
Sbjct  446   IYKQLQDRASANLEDCKQLCALRVDEVFEKANCQEELRWTIKE---FDQSIILWHIATDI  502

Query  943   CYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             CY +    +        E  R +S Y+LYLL+M         G    RDTC +  E
Sbjct  503   CYHSEPNPKSSPSC---ETSRLLSNYMLYLLLMCPFMLPDGIGQIRFRDTCAETEE  555



>ref|XP_010650636.1| PREDICTED: uncharacterized protein LOC104879474 [Vitis vinifera]
Length=649

 Score =   108 bits (271),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 79/120 (66%), Gaps = 5/120 (4%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            E  K+  + ++R  AC+ L+ +  L    P +VKG RSKS+L +AC LAK LQ    +++
Sbjct  520  EATKIFHSVKDRIQACKRLVLQVNLEIP-PLKVKGDRSKSVLSEACRLAKSLQSLETEEE  578

Query  358  ---KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
               ++ W+MM  VWVE+L Y ACHC  + HA++L +GGELLT VWLLMAHFG+ E F+  
Sbjct  579  WNCEKKWEMMSHVWVEMLCYAACHCPRNEHAKELTQGGELLTHVWLLMAHFGITEHFKIS  638



>ref|XP_002528769.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33591.1| conserved hypothetical protein [Ricinus communis]
Length=769

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            E K AC+ ++   T    +P  VKG RSKS+L D  +LA++LQ      +++ W+ M  V
Sbjct  657  EEKRACQCILEVDT--EVKPIAVKGDRSKSVLFDGSMLAQELQKL----KEKKWETMSKV  710

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A HCR +AHAQQ++KGGEL+T VWLLMAH GLG+QF+
Sbjct  711  WVELLSYAASHCRANAHAQQVSKGGELITLVWLLMAHLGLGQQFQ  755


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 12/134 (9%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLECNCG--ESIMTTVGQDVGFIQSVLLWHI  956
             IF+E++  ++       A  I  +RG   L   +    + +M  V  DVG+ QS+LLWH+
Sbjct  528   IFDELRGKSSFADDPETAKRIYAARGDWVLQNNDSDKYQELMPYVS-DVGYDQSILLWHV  586

Query  955   ATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEKI  782
             ATE+ Y               E  + I++Y+LYLL+M+     A+A  G    RDTC + 
Sbjct  587   ATELLYNTDAD--DSKSYSYREFSKTIADYMLYLLIMQPGIMQAVAGIGKIRFRDTCAET  644

Query  781   VETTFKD---THEE  749
             V    +    +HEE
Sbjct  645   VRFFVRKGLRSHEE  658



>ref|XP_004253121.1| PREDICTED: uncharacterized protein LOC101249163 [Solanum lycopersicum]
Length=695

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 4/86 (5%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P++VKG RSKS+L DACILAK L+  G    ++ W+++  VWVE+L Y A HCRG+ HAQ
Sbjct  600  PAKVKGDRSKSVLFDACILAKSLKAKG---NQRKWEIISEVWVEMLAYAATHCRGNHHAQ  656

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            QL KGGELLT VWLLMAH G+ EQF+
Sbjct  657  QLRKGGELLTHVWLLMAHLGITEQFQ  682


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 77/173 (45%), Gaps = 20/173 (12%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAVANEIIL--SRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF+  K+ A ++    +  +L  SRG   L    C   + +T   ++ F QS L+WHIAT
Sbjct  461   IFDHFKKFAGESNNKHDHPVLCTSRGTEALKGNGCSSLVWST---ELEFDQSFLIWHIAT  517

Query  949   EICYF--NFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ++CY+  +  G R  +     +    +S+Y+LYLLV+         G    RDTC +  E
Sbjct  518   DLCYYTDDSSGTRSIESKQSKQ----LSDYMLYLLVVCPFMLPIGLGMIRFRDTCAEAKE  573

Query  775   -----TTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSM  632
                     KD    +      NT+  P   K      RS +V+ D  I  +S+
Sbjct  574   FFTERKVGKDLTIASRKLLTVNTEVGPAKVKGD----RSKSVLFDACILAKSL  622



>ref|XP_010494655.1| PREDICTED: uncharacterized protein LOC104771779, partial [Camelina 
sativa]
Length=557

 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = -1

Query  532  EWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK  356
            E + +++ R  K A E+++   +    +P  VKG RSKS+L DA  LAKDL +     +K
Sbjct  432  ERRHIEDKRSVKIATENILNVNS--ETDPMSVKGDRSKSVLFDASRLAKDLTEMEKTHKK  489

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              W+++  VWVELL Y ACHC   AH +QL++G EL+ FVWLLMAHFGL +QF+
Sbjct  490  DKWEILSKVWVELLCYAACHCDATAHVEQLSRGAELINFVWLLMAHFGLTDQFQ  543


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 66/142 (46%), Gaps = 22/142 (15%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTL---LECNCGESIMTTVGQDVGFIQSVLLWH  959
             IF E++  +    +   A  I L+RG+ TL   L  +     +      V + QS+L+WH
Sbjct  300   IFKELRNKSKYGDSPENAKRISLARGEWTLRENLPADAEREKLVRYVTKVDYDQSLLMWH  359

Query  958   IATEICY-------FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             IATE+CY          G     +   + E  + IS+Y++YLL+++    S +AG     
Sbjct  360   IATELCYQQHEDETIPKGDDEKKEHYSNREFSKIISDYMMYLLILQPSLMSEVAG-----  414

Query  799   DTCEKIVETTFKDTHEEAWNFF  734
                  I +  F+DT  EA  FF
Sbjct  415   -----IGKIRFRDTLAEADKFF  431



>ref|XP_007040748.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
 gb|EOY25249.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
Length=800

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 6/101 (6%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            ACE ++   T    EP  VKG RSKS+L DA +LA++L+     ++K  WK++  VWVEL
Sbjct  691  ACEEILSVNT--DVEPVTVKGDRSKSVLFDASMLAQELKRL---ERKDRWKLICRVWVEL  745

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            + Y A HCR   HAQ+++KGGEL+TF WLLMAHFGLGEQF+
Sbjct  746  VSYAASHCRASTHAQRVSKGGELITFFWLLMAHFGLGEQFQ  786


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 11/117 (9%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF E+K  +    T   A  I  +RG   L + +     S +     DV + +S+LLWHI
Sbjct  560   IFEELKTKSEFADTPETAKRISSARGDWVLTDTDSANDRSKLLKYVSDVPYDESLLLWHI  619

Query  955   ATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTC  791
             AT++CY         +++ + E  + +S+Y+LYLL+ +    SA+A  G    RDTC
Sbjct  620   ATDLCYNT-----DTEEEAEKEFSKILSDYMLYLLIFQPSMMSAVAGIGKIRYRDTC  671



>ref|XP_006428082.1| hypothetical protein CICLE_v10024981mg [Citrus clementina]
 gb|ESR41322.1| hypothetical protein CICLE_v10024981mg [Citrus clementina]
Length=742

 Score =   108 bits (270),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            E K ACES++   T     P +VKG ++KS+L DA +LAK+LQ+  +  +   WK++  V
Sbjct  623  EVKKACESILKVDT--SFPPRDVKGDKTKSVLFDASVLAKELQELEVGKK---WKLVSQV  677

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            WVELL Y A HC    HAQQ+++GGEL+TFVWLLMAHFGL EQF
Sbjct  678  WVELLSYAAFHCGPRTHAQQVSEGGELITFVWLLMAHFGLVEQF  721


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = -1

Query  1123  IFNEVK--EIATQTTAVANEIILSRGKRTLLECNCGESIMTTVG-QDVGFIQSVLLWHIA  953
             I+NEVK   ++  +      I  ++G   L E N GE ++ + G  DV + +S+LLWH A
Sbjct  493   IYNEVKRKSLSAGSPEALRRICSAKGDWILQEWN-GEVVLESYGIADVAYDESILLWHTA  551

Query  952   TEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEKIV  779
             TE+ Y+           +  E  + +S+Y+LYLLV +     A+A       +DTC   V
Sbjct  552   TELLYYTTEEGADEITYNAREFSKLLSDYILYLLVSKPAIMDAVAVIAKIRLQDTCADAV  611



>ref|XP_010535680.1| PREDICTED: uncharacterized protein LOC104810911 [Tarenaya hassleriana]
Length=839

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS L DA  LA  +Q+      + MWK+M  VWVELL Y A HC  + HA
Sbjct  739  EPMDVKGDRSKSALFDASKLAHQIQEQQRKGNEDMWKVMSKVWVELLCYAATHCNAEQHA  798

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFR  194
             QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  799  AQLSKGGELISFVWLLMAHFGLGDQFQ  825


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = -1

Query  1066  ILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEI  887
             I S+ KR   E    E ++  V Q V + QS+LLWHIATE+ Y   G           E 
Sbjct  611   IPSQDKRVKEEDR--EKLLQFVTQ-VDYDQSILLWHIATELFYQVEGATEENYSYR--EF  665

Query  886   CRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEK  785
             C+ +S+Y++YLL+M+    SA+   G    RDTCE+
Sbjct  666   CKMLSDYMMYLLIMQPTLMSAVGGIGKIRFRDTCEE  701



>ref|XP_010034341.1| PREDICTED: uncharacterized protein LOC104423568 [Eucalyptus grandis]
Length=693

 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 7/101 (7%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            ACE+L+   T    +P +VKG RSKS+L DACILA +L+ F    ++  WK++  VWVEL
Sbjct  585  ACENLLSIPT--EVKPVDVKGDRSKSVLFDACILANELKKF----KEAKWKIINEVWVEL  638

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A +CR   HAQQL+KGGEL+T VWLLM H GL EQF+
Sbjct  639  LGYAAIYCRPYNHAQQLSKGGELVTLVWLLMVHLGLSEQFQ  679


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 66/123 (54%), Gaps = 17/123 (14%)
 Frame = -1

Query  1123  IFNEVKE--IATQTTAVANEIILSRGKRTL-----LECNCGESIMTTVGQDVGFIQSVLL  965
             IFNE+K+  +  +      ++  +RGK  L      + NC +  +    +DV + +S+LL
Sbjct  451   IFNELKQKSVYAEDLESIKKMCAARGKWALEQSQEQQPNCKD--LLPFVRDVDYGESLLL  508

Query  964   WHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR--DTC  791
             WHIATE+C      Y   +   D EI + +S+Y+L+L++ +    S +AG  E R  DTC
Sbjct  509   WHIATELC------YNTEEMTKDREISKILSDYMLHLMIKQPNMMSTVAGIGEIRFQDTC  562

Query  790   EKI  782
              ++
Sbjct  563   AEM  565



>ref|XP_002863469.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39728.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 72/103 (70%), Gaps = 7/103 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K AC +++   T    +P  VKG RSKS+L+DA +LAK+L+  G    + MW+++  VWV
Sbjct  686  KEACLAILSVNT--EIDPMAVKGDRSKSVLVDASVLAKELEKEG----RNMWEVVSKVWV  739

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ELL Y + HC    HA QL+KGGEL+ FVWLLMAHFGLG+QF+
Sbjct  740  ELLCYASLHCNSQEHASQLSKGGELINFVWLLMAHFGLGDQFQ  782



>gb|KDO64928.1| hypothetical protein CISIN_1g005525mg [Citrus sinensis]
Length=692

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 8/127 (6%)
 Frame = -1

Query  562  THREMTTLWEEWKMMKNYRERKS---ACESLIGKATLRRQEPSEVKG-RSKSMLIDACIL  395
            T +E    +EE    ++Y++R+    AC+ L+   T  R  P +VKG RSKS+L DAC L
Sbjct  557  TCQEARRFFEERMSREDYQKRERRIRACKMLLKVKTDVR--PIKVKGDRSKSVLFDACSL  614

Query  394  AKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHF  215
            A  L +  I D K+ WKM+R VW+E+L Y A   RG  HAQQL +GGELLT VWLLMAHF
Sbjct  615  ASALDE--ISDTKKRWKMVRDVWLEMLTYAASQGRGSQHAQQLKRGGELLTHVWLLMAHF  672

Query  214  GLGEQFR  194
            GL  QF+
Sbjct  673  GLTGQFQ  679



>ref|XP_010045164.1| PREDICTED: uncharacterized protein LOC104433941 isoform X2 [Eucalyptus 
grandis]
Length=596

 Score =   107 bits (267),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            K+ R +  AC+ L+   T  R  P  VKG RSKS+L DAC LA  L+     +Q + WK+
Sbjct  478  KDIRNKSLACKKLLTVDT--RISPIHVKGDRSKSVLFDACRLATSLRSLKTGNQNE-WKV  534

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            M  VW+E+L Y ACHCR + HAQQL +GGELLT VW+LM H G+ +QF+ 
Sbjct  535  MLEVWIEMLCYAACHCRWNHHAQQLRRGGELLTHVWILMTHLGISQQFQI  584



>ref|XP_006465866.1| PREDICTED: uncharacterized protein LOC102612510 [Citrus sinensis]
Length=692

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 8/127 (6%)
 Frame = -1

Query  562  THREMTTLWEEWKMMKNYRERKS---ACESLIGKATLRRQEPSEVKG-RSKSMLIDACIL  395
            T +E    +EE    ++Y++R+    AC+ L+   T  R  P +VKG RSKS+L DAC L
Sbjct  557  TCQEARRFFEERMSREDYQKRERRIRACKMLLKVKTDVR--PIKVKGDRSKSVLFDACSL  614

Query  394  AKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHF  215
            A  L +  I D K+ WKM+R VW+E+L Y A   RG  HAQQL +GGELLT VWLLMAHF
Sbjct  615  ASALDE--ISDTKKRWKMVRDVWLEMLTYAASQGRGSQHAQQLKRGGELLTHVWLLMAHF  672

Query  214  GLGEQFR  194
            GL  QF+
Sbjct  673  GLTGQFQ  679



>ref|XP_010481571.1| PREDICTED: uncharacterized protein LOC104760359 isoform X2 [Camelina 
sativa]
Length=869

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGI--DDQKQMWKMMRSV  329
            K A  +++  A   + EP +VKG RSKS+L D  +LA +L+      +D  +MWK+M  V
Sbjct  751  KEASTAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLADELKGLSKSKEDYTEMWKIMSQV  810

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  811  WVELLCYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  855



>ref|XP_006279990.1| hypothetical protein CARUB_v10025861mg [Capsella rubella]
 gb|EOA12888.1| hypothetical protein CARUB_v10025861mg [Capsella rubella]
Length=873

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 117/223 (52%), Gaps = 18/223 (8%)
 Frame = -1

Query  823  LAGNFETRDTCEKIVETTFKDTHEEA---WNF---FIANTKQNPELFKRYASFLRSNNVV  662
            + GN ET    EK++    +  ++++   W+     +  T +  E+ + Y S    + ++
Sbjct  642  IQGNTETEKKREKLLRYVMEMDYDQSLLVWHIATELLYQTDKTKEISEAYHSAREFSKIL  701

Query  661  LDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRER----KS  494
             D  I L  M  +   A+  I K+     +   T  E    +E   +  N  ++    K 
Sbjct  702  SDYMIYLLMMQPTLMSAVVGIGKI-----RFRDTCEEAQRFFERRHIPDNSTKKEDILKV  756

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID--DQKQMWKMMRSVWV  323
            A  +++  A   + EP +VKG RSKS+L D  +LA++L+    +  D  +MW ++  VWV
Sbjct  757  ASNAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLAEELKGLSKNKEDDTEMWIIVSKVWV  816

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  817  ELLSYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  859



>ref|XP_010481570.1| PREDICTED: uncharacterized protein LOC104760359 isoform X1 [Camelina 
sativa]
Length=866

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGI--DDQKQMWKMMRSV  329
            K A  +++  A   + EP +VKG RSKS+L D  +LA +L+      +D  +MWK+M  V
Sbjct  748  KEASTAILSVAVPAKAEPIDVKGDRSKSVLFDGAMLADELKGLSKSKEDYTEMWKIMSQV  807

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            WVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+  
Sbjct  808  WVELLCYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQIN  854



>gb|KCW87317.1| hypothetical protein EUGRSUZ_B03804 [Eucalyptus grandis]
Length=660

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            K+ R +  AC+ L+   T  R  P  VKG RSKS+L DAC LA  L+     +Q + WK+
Sbjct  542  KDIRNKSLACKKLLTVDT--RISPIHVKGDRSKSVLFDACRLATSLRSLKTGNQNE-WKV  598

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            M  VW+E+L Y ACHCR + HAQQL +GGELLT VW+LM H G+ +QF+ 
Sbjct  599  MLEVWIEMLCYAACHCRWNHHAQQLRRGGELLTHVWILMTHLGISQQFQI  648



>ref|XP_003577300.1| PREDICTED: uncharacterized protein LOC100843708 [Brachypodium 
distachyon]
 ref|XP_010237495.1| PREDICTED: uncharacterized protein LOC100843708 [Brachypodium 
distachyon]
Length=684

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  514  NYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMM  338
            N  E +  CE  +        EP +VKG RSKS+L  AC LAK L++     Q++ W+++
Sbjct  563  NDIEDEKGCEIKLTDVDTSIAEPRDVKGDRSKSVLFQACKLAKQLKELEGVTQEKRWRII  622

Query  337  RSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
             SVWVE+L Y +  C G +HA+QL++GGELLT VWLLMAHFG+G+Q+R ++
Sbjct  623  SSVWVEMLCYASGKCSGSSHARQLSQGGELLTVVWLLMAHFGVGDQYRVES  673



>ref|XP_010045162.1| PREDICTED: uncharacterized protein LOC104433941 isoform X1 [Eucalyptus 
grandis]
Length=684

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 72/109 (66%), Gaps = 4/109 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            K+ R +  AC+ L+   T  R  P  VKG RSKS+L DAC LA  L+     +Q + WK+
Sbjct  566  KDIRNKSLACKKLLTVDT--RISPIHVKGDRSKSVLFDACRLATSLRSLKTGNQNE-WKV  622

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            M  VW+E+L Y ACHCR + HAQQL +GGELLT VW+LM H G+ +QF+
Sbjct  623  MLEVWIEMLCYAACHCRWNHHAQQLRRGGELLTHVWILMTHLGISQQFQ  671



>ref|XP_002863478.1| hypothetical protein ARALYDRAFT_494437 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39737.1| hypothetical protein ARALYDRAFT_494437 [Arabidopsis lyrata subsp. 
lyrata]
Length=838

 Score =   108 bits (269),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L DA  LAKDL +     +K  W+++  VWVELL + ACHC   AH 
Sbjct  738  EPMDVKGDRSKSVLFDASKLAKDLAEMEKTHKKDKWEILSKVWVELLCHAACHCDATAHV  797

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  798  EQLSRGGELINFVWLLMAHFGLTDQFQ  824



>gb|KEH43306.1| DUF594 family protein [Medicago truncatula]
Length=717

 Score =   107 bits (268),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 76/115 (66%), Gaps = 6/115 (5%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDD---Q  359
            K  K  +ER   C+ ++   T     PSEVKG RSKS+L DAC LAK LQ    ++   +
Sbjct  592  KERKYIKERSQVCKMILRVNT--SIPPSEVKGDRSKSVLFDACRLAKSLQSLETEENWSK  649

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +Q W+M+  VWVE+L + A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  650  EQKWEMISHVWVEMLCHAASQCRGLHHARQLSQGGELLTHVWLLMAHLGITEQFQ  704



>emb|CDP16262.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   107 bits (267),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 65/92 (71%), Gaps = 8/92 (9%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDF-----GIDDQKQMWKMMRSVWVELLLYGACHCR  290
            +P  +KG RSKS+L D CILAK L+D      GI+  K  W++M  VWVELL Y A  CR
Sbjct  615  KPVAIKGDRSKSVLFDGCILAKKLRDLKTSEAGIEVDK--WEIMSKVWVELLSYAAIRCR  672

Query  289  GDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
               HAQQL+KGGEL T VWLLMAHFGLG+QF+
Sbjct  673  AYVHAQQLSKGGELFTIVWLLMAHFGLGDQFQ  704


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 68/133 (51%), Gaps = 7/133 (5%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF E+K  +        A +I  +RG   L     GE ++  + Q + + +S+LLWHIAT
Sbjct  464   IFTELKTKSKIADDLDTAKDISSARGDWILRVEGFGE-LLPYISQ-MDYDESLLLWHIAT  521

Query  949   EICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTCEKIVE  776
             E+CY +    +    +    + + +S+Y+LYLLVM+    SA+   G    RDTC ++  
Sbjct  522   ELCYSDEIA-KASSPNKHRHLSKLLSDYMLYLLVMQPTMMSAVTGIGQIRFRDTCAEVKR  580

Query  775   TTFKDTHEEAWNF  737
                K  +++  NF
Sbjct  581   FRGKLANKKEPNF  593



>gb|KFK33780.1| hypothetical protein AALP_AA5G059100 [Arabis alpina]
Length=509

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 5/113 (4%)
 Frame = -1

Query  520  MKNYRERKSACESLIGKATLRRQ-EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMW  347
            +++ R  K AC++++    +R   +P +VKG +SKS+L DA  LAKDL +    + K  W
Sbjct  388  IQDSRNLKVACKTIL---KVRSDIDPMDVKGDQSKSVLFDASRLAKDLMEMETKNGKNKW  444

Query  346  KMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            +++  VWVELL Y ACHC   AH +QL++G EL+ FVWLLMAHFGL +QF+  
Sbjct  445  EILSKVWVELLCYAACHCDTKAHVEQLSRGAELINFVWLLMAHFGLTDQFQIN  497



>ref|XP_010251959.1| PREDICTED: uncharacterized protein LOC104593692 [Nelumbo nucifera]
Length=699

 Score =   107 bits (267),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = -1

Query  496  SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            +AC+ L          P +VKG RSKS L D C LAK LQ  G   ++Q WK +  VW+E
Sbjct  587  TACKKLEAVPMETSVSPMDVKGDRSKSALFDGCRLAKALQKLG---EEQRWKTVSLVWME  643

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            +L Y A HCRG  HAQ+L+ GGELLT VWLLMAH G+GE +R + 
Sbjct  644  MLYYAASHCRGYYHAQRLSAGGELLTVVWLLMAHLGIGEHYRVEA  688



>ref|XP_010529242.1| PREDICTED: uncharacterized protein LOC104806182 [Tarenaya hassleriana]
Length=832

 Score =   107 bits (267),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DA +LAK+LQ      ++ MW+++  VWVELL Y A HC    HA 
Sbjct  733  PMDVKGDRSKSVLFDASMLAKELQHLHSKREENMWEVIGKVWVELLCYAAAHCDSKEHAA  792

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            QL+KGGEL++FVWLLMA FG+GEQF+
Sbjct  793  QLSKGGELISFVWLLMAQFGIGEQFQ  818


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAG  815
            +V + QS+LLWHIATEI Y         ++    E  + +S+Y++YLL+M+   TS +AG
Sbjct  632  EVDYDQSILLWHIATEIFYQEQEKEHTKENHSHREFSKILSDYMMYLLIMQPSLTSTVAG  691

Query  814  --NFETRDTCEK  785
                  RDTCE+
Sbjct  692  IAKIRFRDTCEE  703



>ref|XP_004303690.1| PREDICTED: uncharacterized protein LOC101298623 [Fragaria vesca 
subsp. vesca]
Length=703

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 77/123 (63%), Gaps = 7/123 (6%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E    ++E K+MK+  E K AC  L    T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  572  EAEEFFKEKKIMKS--ETKEACTKLYNVCT--DILPSKVKGDRSKSVLFDACRLAKALQS  627

Query  376  FGIDDQ--KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGE  203
               ++    Q W++M  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAH GL E
Sbjct  628  LKTEENWYNQKWELMSQVWVEMLSYAANQCRWGDHAQQLRRGGELLTHVWLLMAHLGLTE  687

Query  202  QFR  194
            QF+
Sbjct  688  QFQ  690



>ref|NP_199367.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09182.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95266.1| uncharacterized protein AT5G45540 [Arabidopsis thaliana]
Length=803

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 7/103 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            K AC +++   T    +P  VKG RSKS+L DA +LAK+L + G    + MW+++  VWV
Sbjct  693  KEACRAILSVNT--EIDPMAVKGDRSKSVLFDASVLAKELMNEG----ENMWEVVSKVWV  746

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ELL Y + HC    HA QL+KGGEL+ FVWLLMAHFGLG+QF+
Sbjct  747  ELLCYASLHCDSQEHASQLSKGGELINFVWLLMAHFGLGDQFQ  789



>ref|NP_199366.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09181.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95265.1| uncharacterized protein AT5G45530 [Arabidopsis thaliana]
Length=798

 Score =   107 bits (266),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFG-IDDQKQ  353
            + +K+ R+ K A E+++  +     EP  VKG RSKS+L DA +LAK+LQ+     ++  
Sbjct  673  RQIKDLRDMKRASETVLLVSN--DIEPILVKGDRSKSVLFDASMLAKELQNLKESSNEDG  730

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++  VWVELL Y A HC+   H  QL++GGELL FVWLLMAHFGLG+QF+
Sbjct  731  KWRVLSKVWVELLCYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLGDQFQ  783


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 21/163 (13%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IFNEVK+ +   +T  VA ++  +RG+  L +    E  ++M  + + V + QS+LLWHI
Sbjct  544   IFNEVKDKSGFAETPEVAKKVSWARGEWALRDSKLMEVDTLMRYI-EKVDYDQSLLLWHI  602

Query  955   ATEICYFNFGGYRyyddddDP----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+C+    G +      +     E  + IS+Y++YLL+M  K  S +AG         
Sbjct  603   ATELCFQKEEGGKMEKLSREGYDDREFSKIISDYMMYLLIMRPKLMSEVAG---------  653

Query  787   KIVETTFKDTHEEAWNFFIANTKQNPELFKRYAS--FLRSNNV  665
              I    F+DT  EA  FF     ++    KR +    L SN++
Sbjct  654   -IGTIRFRDTKAEAERFFKGRQIKDLRDMKRASETVLLVSNDI  695



>ref|NP_199360.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09175.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAE99033.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95256.1| uncharacterized protein AT5G45470 [Arabidopsis thaliana]
Length=866

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP  VKG RSKS+L DA  LAKDL +      K  W+++  VWVELL Y ACHC   AH 
Sbjct  766  EPMGVKGDRSKSVLFDASRLAKDLAEMEKTHNKDKWEILSKVWVELLCYAACHCDSTAHV  825

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  826  EQLSRGGELINFVWLLMAHFGLTDQFQ  852


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 64/142 (45%), Gaps = 22/142 (15%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTL---LECNCGESIMTTVGQDVGFIQSVLLWH  959
             IF E+K  +    +   A  I L+RG+ TL   L  +     +      V + QS+L+WH
Sbjct  609   IFEELKNKSKYGDSPENAKRISLARGEWTLRENLPVDAEREKLVRYVTKVDYDQSLLMWH  668

Query  958   IATEICY-------FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             IATE+CY          G         + E  + IS+Y++YLL+++    S +AG     
Sbjct  669   IATELCYQQHEKETIPEGYDEQRKHYSNREFSKIISDYMMYLLILQPGLMSEVAG-----  723

Query  799   DTCEKIVETTFKDTHEEAWNFF  734
                  I +  F+DT  E   FF
Sbjct  724   -----IGKIRFRDTLAETHKFF  740



>ref|XP_010251680.1| PREDICTED: uncharacterized protein LOC104593502 [Nelumbo nucifera]
Length=710

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 4/105 (4%)
 Frame = -1

Query  496  SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            +AC+ L          P +VKG RSKS L D C LAK LQ  G   ++Q WK +  VW+E
Sbjct  598  TACKKLEAVPMETSVSPMDVKGDRSKSALFDGCRLAKALQKLG---EEQRWKTVSLVWME  654

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            +L Y A HCRG  HAQ+L+ GGELLT VWLLMAH G+GE +R + 
Sbjct  655  MLYYAASHCRGYYHAQRLSAGGELLTVVWLLMAHLGIGEHYRVEA  699



>ref|XP_004496124.1| PREDICTED: uncharacterized protein LOC101496417 [Cicer arietinum]
Length=677

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 78/115 (68%), Gaps = 6/115 (5%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDD---Q  359
            K  K  RER   C+ ++   T  +  PSEVKG RSKS+L DAC LAK L+    ++   +
Sbjct  552  KERKYIRERSKVCKMILRVNT--KISPSEVKGDRSKSVLFDACRLAKSLESLETEENWSK  609

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ++ W+M+ ++WVE+L + A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  610  ERKWEMISNIWVEMLCHAASQCRGFHHAKQLSQGGELLTHVWLLMAHLGITEQFQ  664


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 61/124 (49%), Gaps = 11/124 (9%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF+++K+ + +   +    ++   +G R L++ NC    +    ++V F QS+LLWHIAT
Sbjct  429   IFDQLKDKSEEAINIEACKKLCAHKGDRVLIKWNCHIRNINQSIKEVEFDQSILLWHIAT  488

Query  949   EICYFNFGGYRyyddddDP------EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ++CY             +P      E  + +S+Y+LYLLV+         G     DTC 
Sbjct  489   DLCY---SSDEDESQILNPVALQSREKSQLLSDYMLYLLVICPFLLPNGIGQIRFEDTCA  545

Query  787   KIVE  776
             ++ E
Sbjct  546   EVDE  549



>ref|XP_010441714.1| PREDICTED: uncharacterized protein LOC104724854 [Camelina sativa]
Length=848

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = -1

Query  532  EWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK  356
            E + +++ R  K A E+++   +    EP  VKG RSKS+L DA  LAKDL +     +K
Sbjct  723  ERRHIEDKRSVKIATENILNVNS--ETEPMSVKGDRSKSVLFDASRLAKDLTEMEKRHKK  780

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
              W+++  VWVELL + ACHC   AH +QL++G EL+ FVWLLMAHFGL +QF+  
Sbjct  781  DKWEILSKVWVELLCHAACHCDATAHVEQLSRGAELINFVWLLMAHFGLTDQFQIN  836


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 20/125 (16%)
 Frame = -1

Query  1078  ANEIILSRGKRTL---LECNCGESIMTTVGQDVGFIQSVLLWHIATEICY-------FNF  929
             A  I L+RG+ TL   L  +     +      V + QS+L+WHIATE+CY          
Sbjct  608   AKRISLARGEWTLRENLPADAEREKLVRYVTKVDYDQSLLMWHIATELCYQQHEDETIPE  667

Query  928   GGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEE  749
                   +   + E  + IS+Y++YLL+++    S +AG          I +  F+DT  E
Sbjct  668   DDDEKKEHYSNREFSKIISDYMMYLLILQPSLMSEVAG----------IGKIRFRDTLAE  717

Query  748   AWNFF  734
             A  FF
Sbjct  718   ADKFF  722



>gb|KFK25862.1| hypothetical protein AALP_AA8G171900 [Arabis alpina]
Length=763

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 77/122 (63%), Gaps = 11/122 (9%)
 Frame = -1

Query  526  KMMKNYRERKS---------ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            K  +NY +RKS         A   ++   +L + EP +VKG RSKS+L D  +LAK+L+ 
Sbjct  628  KEAENYFKRKSTKAGWHKEEASMEILSLMSLAKVEPIDVKGDRSKSVLFDGGMLAKELKG  687

Query  376  FGIDDQKQ-MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQ  200
               DD    MW+++  VWVELL Y A  C    HA QL+KGGEL++FVWLLMAH GLG+Q
Sbjct  688  LKKDDNNTYMWEVVSKVWVELLSYAATKCSAKEHAAQLSKGGELISFVWLLMAHLGLGDQ  747

Query  199  FR  194
            F+
Sbjct  748  FQ  749



>ref|XP_006398220.1| hypothetical protein EUTSA_v10000764mg [Eutrema salsugineum]
 gb|ESQ39673.1| hypothetical protein EUTSA_v10000764mg [Eutrema salsugineum]
Length=927

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 74/105 (70%), Gaps = 3/105 (3%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK--QMWKMMRSV  329
            K+A ++++   +  + EP +VKG RSKS+L D  +LAK+L+    +D+   +MW+M+  V
Sbjct  809  KTASDAIMSVKSPAKAEPIDVKGDRSKSVLFDGSMLAKELKGIVKEDKDDTKMWEMVSKV  868

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A  C    HA QL+KGGEL+TFVWLLMAH GLG+QF+
Sbjct  869  WVELLSYAATKCGAIEHAAQLSKGGELITFVWLLMAHLGLGDQFQ  913



>ref|XP_009128802.1| PREDICTED: uncharacterized protein LOC103853644 isoform X1 [Brassica 
rapa]
Length=822

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            + ++N R+ K A ++++  ++    +P  VKG RSKS+L DA  LAKDL+       K  
Sbjct  699  RHIENVRDVKIASKTILDVSS--DIDPMGVKGDRSKSVLFDASRLAKDLRQLEERYGKDK  756

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+++  VWVELL Y ACHC   AH +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  757  WEILSKVWVELLCYAACHCDSTAHVEQLSRGGELINFVWLLMAHFGLTDQFQ  808


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 25/142 (18%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFI------QSVL  968
             +FNE+K  +    +   A  I L+RG+ TL +    ++ M  +   VG++      QS+L
Sbjct  568   MFNELKYKSKFGDSPENAKRISLARGQWTLRDNLPEDADMEKL---VGYVTNFDYDQSLL  624

Query  967   LWHIATEICYFN----FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             +WHIATE+CY        GY       + E  + IS+Y++YLL+M+    S +AG     
Sbjct  625   MWHIATELCYQQEETIPEGYAKSKHYSNREFSKIISDYVMYLLIMQPGLMSEVAG-----  679

Query  799   DTCEKIVETTFKDTHEEAWNFF  734
                  I +  F+DT  EA  FF
Sbjct  680   -----IGKIRFRDTMAEADKFF  696



>ref|XP_006280029.1| hypothetical protein CARUB_v10025906mg [Capsella rubella]
 gb|EOA12927.1| hypothetical protein CARUB_v10025906mg [Capsella rubella]
Length=798

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 4/113 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID-DQKQ  353
            + +K+ R+ K A E+++  +   + EP  VKG RSKS+L DA +LAK+LQ      +   
Sbjct  674  RYIKDSRDMKGASETVL--SVDNKIEPMLVKGDRSKSVLFDASMLAKELQKLKESRNGDG  731

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++R VWVELL Y A HC+   H  QL +GGELL FVWLLMAHFGL +QF+
Sbjct  732  KWRVLRKVWVELLCYAASHCKATEHVAQLTRGGELLNFVWLLMAHFGLADQFQ  784


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 70/138 (51%), Gaps = 19/138 (14%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF E+K+ +   +    A ++  +RG+  L +    E   +M  + ++V + QS+LLWHI
Sbjct  545   IFYELKDKSEFAEKPEDAKKVSWARGEWALRDTKLVEVDRLMLYI-ENVDYDQSLLLWHI  603

Query  955   ATEICYFNFGGYRyyddddDP----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+C+    G    +   +     E  + IS+Y++YLL+M+ K  S +AG         
Sbjct  604   ATELCFQKEEGEEIKNLSSESYDDREFSKIISDYMMYLLIMQPKLMSEVAG---------  654

Query  787   KIVETTFKDTHEEAWNFF  734
              I    F+DT  EA  FF
Sbjct  655   -IGTIRFRDTKAEAERFF  671



>gb|ABA94980.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ19036.1| hypothetical protein OsJ_34567 [Oryza sativa Japonica Group]
Length=731

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDF-GIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            EP +VKG RSKS+L  AC LAK L +  GI ++++ W++M +VWVE+L Y A  C G+AH
Sbjct  631  EPRDVKGDRSKSVLFQACKLAKQLMELEGITEERR-WQLMAAVWVEMLCYSAGKCSGNAH  689

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            A+QL++GGELLT VWLLMAHFG+G+Q+R ++
Sbjct  690  ARQLSQGGELLTVVWLLMAHFGVGDQYRVES  720



>ref|XP_002863477.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39736.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
Length=870

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQK--QMWKMM  338
            +  K A ++++  A   + EP +VKG RSKS+L D  +LAK+L+    + +   +MW+++
Sbjct  749  KAPKEASDAILSVAVPVKAEPIDVKGDRSKSVLFDGAMLAKELKGLSKNKENNTEMWEIV  808

Query  337  RSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  809  SKVWVELLSYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  856



>ref|XP_006280006.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
 gb|EOA12904.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
Length=838

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            + +++ +  K A E+++   +  + +P  VKG RSKS+L DA  L+KDL +      K  
Sbjct  715  RHIEDKKSVKIATENILNVNS--KTDPMSVKGDRSKSVLFDASRLSKDLTEMERTHGKDK  772

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+++  VWVELL Y ACHC   AH +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  773  WEILSKVWVELLCYAACHCDATAHVEQLSRGGELINFVWLLMAHFGLTDQFQ  824



>ref|XP_010046717.1| PREDICTED: uncharacterized protein LOC104435714 [Eucalyptus grandis]
Length=601

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = -1

Query  535  EEWKMMKNYRERKS-ACESLIGKATLRRQEPSEV-KGRSKSMLIDACILAKDLQDFGIDD  362
            E+W   +  +  KS ACE L+       + P EV  G SKS+L DAC LA  LQ     +
Sbjct  476  EDWLQDREDKLNKSLACEKLLEVGAHYYEPPLEVGPGGSKSVLFDACRLAASLQSLQRGN  535

Query  361  QKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTV  182
            Q + W++M  VWVE+L Y ACHCR D HA+QL +GGELLT VW+LM H G+ ++F    V
Sbjct  536  QNK-WEVMIEVWVEMLCYAACHCRWDHHARQLGRGGELLTHVWILMTHLGISDRFHPSGV  594

Query  181  G  179
            G
Sbjct  595  G  595



>emb|CDY26372.1| BnaA02g23980D [Brassica napus]
Length=1347

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 73/107 (68%), Gaps = 4/107 (4%)
 Frame = -1

Query  511  YRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMR  335
            Y + K A E+++      + EP +VKG RSKS+L D  +LAK+L+   +  +  MW+++ 
Sbjct  507  YGDIKKASEAILSVTAPAKAEPIDVKGDRSKSVLFDGSMLAKELK---VKGEAYMWEVVS  563

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  564  KVWVELLSYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  610


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  526   KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
             + ++N R+ K A ++++  ++    +P  VKG RSKS+L DA  LAKDL+       K  
Sbjct  1224  RHIENVRDVKIASKTILDVSS--DIDPMGVKGDRSKSVLFDASRLAKDLRQLEERYGKDK  1281

Query  349   WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++  VWVELL Y ACHC   AH +QL++GGEL+ FVWLLMAHFGL +QF+
Sbjct  1282  WEILSKVWVELLCYAACHCDSTAHVEQLSRGGELINFVWLLMAHFGLTDQFQ  1333



>gb|KFK31555.1| hypothetical protein AALP_AA6G127100 [Arabis alpina]
Length=798

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFG----IDD  362
            K +KN R+ K A E+++        EP  VKG RSKS+L DA ILAK+L+  G    I D
Sbjct  673  KHIKN-RDMKQASETILW--VQNDIEPVSVKGDRSKSVLFDASILAKELKKLGEGSDIGD  729

Query  361  QKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             K  W+++  VWVELL Y A HC+   H  QL++GGELL FVWLLMAHFGL +QF+
Sbjct  730  GK--WRVLSKVWVELLSYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLADQFQ  783


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 77/144 (53%), Gaps = 15/144 (10%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF+E+K  +   +T  +A ++  +RG+  L +    E   +M+ V ++V + QS+LLWHI
Sbjct  548   IFDELKHKSEFAETPEMAKKVSSARGEWALRDTKLVEIEPLMSYV-ENVDYDQSLLLWHI  606

Query  955   ATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ATE+C+         +  DD E  + IS+Y++YLL+M+ K  S +AG          I  
Sbjct  607   ATELCFQEEEENLSGESCDDREFSKIISDYMMYLLIMQPKLMSEVAG----------IGT  656

Query  775   TTFKDTHEEAWNFFIANTKQNPEL  704
               F++T  EA  FF     +N ++
Sbjct  657   IRFRETLAEAQRFFKGKHIKNRDM  680



>ref|XP_010251958.1| PREDICTED: uncharacterized protein LOC104593691 [Nelumbo nucifera]
Length=308

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = -1

Query  496  SACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            + C+ L+   T     P +VKG RSKS+L D   LAK L+     D +Q WK M  VW+E
Sbjct  196  TVCKRLVDVET--DVAPMDVKGDRSKSVLFDGVKLAKALRKL---DDEQRWKTMSLVWME  250

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            +L Y A HCRG+ HAQ+L+ GGELLT VWLLMAH G+G+Q++ + 
Sbjct  251  MLYYAASHCRGNYHAQRLSTGGELLTLVWLLMAHLGIGDQYKVEA  295



>gb|KCW87320.1| hypothetical protein EUGRSUZ_B03807 [Eucalyptus grandis]
Length=660

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 3/121 (2%)
 Frame = -1

Query  535  EEWKMMKNYRERKS-ACESLIGKATLRRQEPSEV-KGRSKSMLIDACILAKDLQDFGIDD  362
            E+W   +  +  KS ACE L+       + P EV  G SKS+L DAC LA  LQ     +
Sbjct  535  EDWLQDREDKLNKSLACEKLLEVGAHYYEPPLEVGPGGSKSVLFDACRLAASLQSLQRGN  594

Query  361  QKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTV  182
            Q + W++M  VWVE+L Y ACHCR D HA+QL +GGELLT VW+LM H G+ ++F    V
Sbjct  595  QNK-WEVMIEVWVEMLCYAACHCRWDHHARQLGRGGELLTHVWILMTHLGISDRFHPSGV  653

Query  181  G  179
            G
Sbjct  654  G  654



>emb|CDX87779.1| BnaC02g31700D [Brassica napus]
Length=682

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQ---MWKM  341
            R+ K A E+++    L + EP +VKG RSKS+L D  +LAK+L+  G+   K+   MW++
Sbjct  562  RDIKKASEAILSVTALVKAEPIDVKGDRSKSVLFDGSMLAKELK--GLKKAKREAYMWEV  619

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            +  VW ELL Y A  C    HA QL+KGGEL+ FVWLLMAHFGLG+QF
Sbjct  620  VSKVWAELLCYAATKCGAIEHAAQLSKGGELINFVWLLMAHFGLGDQF  667



>ref|XP_006398229.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
 gb|ESQ39682.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
Length=812

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L DA +LAK+L+  G      MW+++  VWVELL + A HC    HA
Sbjct  716  EPMDVKGDRSKSVLFDASVLAKELEKGG----DNMWEVVSKVWVELLCFAATHCDSKEHA  771

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLMAHFGLG+QF+  
Sbjct  772  SQLSKGGELINFVWLLMAHFGLGDQFQIN  800



>ref|XP_004152420.1| PREDICTED: uncharacterized protein LOC101209159 [Cucumis sativus]
 ref|XP_004158159.1| PREDICTED: uncharacterized protein LOC101224461 [Cucumis sativus]
 gb|KGN50284.1| hypothetical protein Csa_5G165300 [Cucumis sativus]
Length=757

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P EVKG +SKS+L +  +LAK L+ +      + W++M  VW+E+L Y A HCR D HAQ
Sbjct  663  PVEVKGDKSKSVLFNGSLLAKKLKKYN-----EKWEIMSKVWIEMLGYAASHCRPDQHAQ  717

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            Q++KGGEL+T VWLLMAHFGLGEQF+
Sbjct  718  QVSKGGELITVVWLLMAHFGLGEQFQ  743


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 66/141 (47%), Gaps = 23/141 (16%)
 Frame = -1

Query  1123  IFNEV--KEIATQTTAVANEIILSRGKRTL------LECNCGESIMTTVGQDVGFIQSVL  968
             IF E+  K  A +T  +  EI  SRG   L       E + GE I      +V F +S++
Sbjct  504   IFEEMLEKSKAAETVEITEEICSSRGSYVLKSMDLPSEIDIGELISDI--DEVAFDESLM  561

Query  967   LWHIATEICYF---NFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRD  797
             LWHIATE+CY    N             E  + +S+Y+LYLLVM     SA+AG      
Sbjct  562   LWHIATELCYRDEQNTNTNVNDTGTSYREFSKVLSDYMLYLLVMLPSMMSAVAG------  615

Query  796   TCEKIVETTFKDTHEEAWNFF  734
                 I E  F+DT  EA  FF
Sbjct  616   ----IGEIRFRDTCAEAKKFF  632



>gb|KDP45940.1| hypothetical protein JCGZ_11843 [Jatropha curcas]
Length=764

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            + K+AC+S++   T    +P  VKG RSKS+L D  +LAK+L+      +++ W+++  V
Sbjct  652  DEKNACQSILDVDT--EVKPIAVKGDRSKSVLFDGSMLAKELKK----LKEKKWEILSKV  705

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVELL Y A HCR +AHAQQ++KGGELLT VWLLMAHFGLG+QF+
Sbjct  706  WVELLSYAASHCRANAHAQQISKGGELLTLVWLLMAHFGLGDQFQ  750


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 60/118 (51%), Gaps = 11/118 (9%)
 Frame = -1

Query  1123  IFNEV--KEIATQTTAVANEIILSRGKRTLLECNCGE---SIMTTVGQDVGFIQSVLLWH  959
             IF+E+  K +      +A  I  +RG   +L+ N  +    +M  V  DV + QS+LLWH
Sbjct  523   IFSELQKKSLFADDPEMAKRICSARGD-WVLQDNVSDKYNGLMPYVS-DVAYDQSLLLWH  580

Query  958   IATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA--GNFETRDTC  791
             IATE+ Y               E  + +S+Y+LYLL+M+    +A+A  G    RDTC
Sbjct  581   IATELLYST--DKDTLKSYSHREFSKILSDYMLYLLIMQPTIMAAVAGIGKIRFRDTC  636



>ref|XP_010481573.1| PREDICTED: uncharacterized protein LOC104760360 [Camelina sativa]
Length=849

 Score =   105 bits (262),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP  VKG RSKS+L DA  LAKDL +     +K  W+++  VWVELL Y ACHC   +H 
Sbjct  749  EPMSVKGDRSKSVLFDASRLAKDLTEMEKTHKKDKWEILSKVWVELLCYAACHCDATSHV  808

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            +QL++G EL+ FVWLLMAHFGL +QF+  
Sbjct  809  EQLSRGAELINFVWLLMAHFGLTDQFQIN  837


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 22/142 (15%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTL---LECNCGESIMTTVGQDVGFIQSVLLWH  959
             IFNE++  +    +   A  I L+RG+ TL   L  +     +      V + QS+L+WH
Sbjct  592   IFNELRNKSKYGDSPENAKRISLARGEWTLRENLPADAEREKLVRYVTKVDYDQSLLMWH  651

Query  958   IATEICY-------FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             IATE+CY          G     +   + E  + IS+Y++YLL+++    S +AG     
Sbjct  652   IATELCYQQHEEETIPKGDDEKKEHYSNREFSKIISDYMMYLLILQPSLMSEVAG-----  706

Query  799   DTCEKIVETTFKDTHEEAWNFF  734
                  I +  F+DT  EA  FF
Sbjct  707   -----IGKIRFRDTLAEADKFF  723



>gb|KCW45556.1| hypothetical protein EUGRSUZ_L00714 [Eucalyptus grandis]
Length=680

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 121/272 (44%), Gaps = 56/272 (21%)
 Frame = -1

Query  1006  TVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTS  827
             T   ++ F + VL+WHIATE+C  ++   R  +        R +S Y+ YLLVM      
Sbjct  451   TWSAELDFDECVLIWHIATELC--SYTDDRDKESYSGFLESRLLSRYMFYLLVMYPCMLP  508

Query  826   ALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYI  647
             +  G    RD            T  EA  FF      +P   K+        +       
Sbjct  509   SGIGQIRLRD------------TFAEADKFFKEKLLLSP---KKRGHCPPCGDT------  547

Query  646   CLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKA  467
             C R   F  R             N++++   E                R+ AC  L+   
Sbjct  548   CNRISHFFWR-------------NQETSVENE---------------ARQKACRMLLEVN  579

Query  466   TLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCR  290
             T  R  P++VKG RSKS+L D C LA  L      D  Q W+M+  VWVE+L   A  CR
Sbjct  580   TEVR--PAKVKGGRSKSVLFDGCRLALGLNK--KYDTSQKWEMISKVWVEMLACAASQCR  635

Query  289   GDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             GD HA+QL +GGEL+T VWL+MAHFGL + F+
Sbjct  636   GDCHARQLRRGGELITHVWLMMAHFGLTDHFQ  667



>emb|CAN61968.1| hypothetical protein VITISV_003279 [Vitis vinifera]
Length=326

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+ L+   T     P +VKG +SKS+L DAC LAK LQ   I  +K+ W+M+  VWVE+
Sbjct  216  ACQKLLAVNT--EVPPQQVKGDKSKSVLFDACRLAKSLQSLKIA-EKEKWEMICDVWVEM  272

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            L Y A  C  + HAQQL +GGELLT VWLLMAHFG+ E F+ 
Sbjct  273  LCYAASQCGWNQHAQQLRRGGELLTHVWLLMAHFGISEHFKI  314



>ref|XP_010040022.1| PREDICTED: uncharacterized protein LOC104428779 [Eucalyptus grandis]
 ref|XP_010040023.1| PREDICTED: uncharacterized protein LOC104428779 [Eucalyptus grandis]
Length=701

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 123/275 (45%), Gaps = 62/275 (23%)
 Frame = -1

Query  1006  TVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTS  827
             T   ++ F + VL+WHIATE+C  ++   R  +        R +S Y+ YLLVM      
Sbjct  472   TWSAELDFDECVLIWHIATELC--SYTDDRDKESYSGFLESRLLSRYMFYLLVMYPCMLP  529

Query  826   ALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYI  647
             +  G    RD            T  EA  FF      +P   K+        +       
Sbjct  530   SGIGQIRLRD------------TFAEADKFFKEKLLLSP---KKRGHCPPCGDT------  568

Query  646   CLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKA  467
             C R   F  R             N++++   E                R+ AC  L+   
Sbjct  569   CNRISHFFWR-------------NQETSVENE---------------ARQKACRMLLEVN  600

Query  466   TLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQMWKMMRSVWVELLLYGAC  299
             T  R  P++VKG RSKS+L D C LA      G++   D  Q W+M+  VWVE+L   A 
Sbjct  601   TEVR--PAKVKGGRSKSVLFDGCRLA-----LGLNKKYDTSQKWEMISKVWVEMLACAAS  653

Query  298   HCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              CRGD HA+QL +GGEL+T VWL+MAHFGL + F+
Sbjct  654   QCRGDCHARQLRRGGELITHVWLMMAHFGLTDHFQ  688



>ref|XP_006414015.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
 gb|ESQ55468.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
Length=812

 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 128/272 (47%), Gaps = 81/272 (30%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAG  815
            +V + QS+L+WHIATE+ +          + +  E  + +S+Y++YLL+++    S +AG
Sbjct  596  EVDYDQSILVWHIATELLHQT--DENNARNVEYRESSKTLSDYMMYLLIVQPSLMSTVAG  653

Query  814  NFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRS  635
                      I +  F+D   EA      N  +  +LF+R                    
Sbjct  654  ----------IDKVRFRDAIAEA-----RNLPEAKKLFQR--------------------  678

Query  634  MWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIG--KATL  461
                     R+IA        DS                    + K AC++++   K   
Sbjct  679  ---------RHIA--------DSG-------------------DAKMACKAILDSYKVDG  702

Query  460  RRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQK---QMWKMMRSVWVELLLYGACHCR  290
            +R E ++V  RSKS+L  A +LAK+L    I  Q+   +MW+++  VWVE+L Y A HC 
Sbjct  703  QRNENAKVY-RSKSVLFQASMLAKEL--LRIQTQQGNSKMWEVVSKVWVEMLCYAATHCD  759

Query  289  GDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
               HA QL +GGEL+ FVWLLMA FGLGEQFR
Sbjct  760  SKQHAAQLNRGGELINFVWLLMAQFGLGEQFR  791



>gb|KCW51701.1| hypothetical protein EUGRSUZ_J01172, partial [Eucalyptus grandis]
Length=591

 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 8/104 (8%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            ++  C+ L+   T  + +P +VKG RSKS L DACILAK L+  G       W+++  VW
Sbjct  481  KEIVCQRLLDVPT--KVKPVDVKGDRSKSALFDACILAKVLRKLG-----NKWEILSGVW  533

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            VELL Y A HCR   HAQQL+KGGEL+T VWLLM H GL EQF+
Sbjct  534  VELLGYAAIHCRPYNHAQQLSKGGELVTLVWLLMVHLGLSEQFQ  577



>gb|EAY81637.1| hypothetical protein OsI_36806 [Oryza sativa Indica Group]
Length=725

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = -1

Query  490  CESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF-GIDDQKQMWKMMRSVWVEL  317
            C   + K      EP +VKG RSKS+L  AC LA+ L +  GI ++++ W+++  VWVE+
Sbjct  607  CAKRLTKVDTSIAEPRDVKGDRSKSVLFQACKLARQLNELEGITEERR-WRLIAGVWVEM  665

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            L Y A  C G+AHA+QL++GGE+LT VWLLMAHFG+G+Q+R ++
Sbjct  666  LCYAAGKCSGNAHARQLSQGGEMLTVVWLLMAHFGMGDQYRVES  709



>ref|XP_010692889.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692890.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692891.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692892.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
Length=670

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 6/105 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            +R  AC+ L+   T     P +VKG R KS+L DAC +A +L+     DQ   W ++  V
Sbjct  558  DRAQACKMLLRVNT--EIPPGKVKGDRCKSVLFDACRIATELRTKHAKDQ---WNIISKV  612

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WVE+L Y ACHCRG  HAQQL KGGE LT VWLLMAH G+ EQF+
Sbjct  613  WVEILAYAACHCRGTHHAQQLRKGGEFLTHVWLLMAHLGITEQFQ  657


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 69/155 (45%), Gaps = 17/155 (11%)
 Frame = -1

Query  1123  IFNEVKEIATQ-TTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATE  947
             IF E  EI+T    +    +  SRGKR L       S +     +V F QS+LLWHIATE
Sbjct  435   IFEEFLEISTNGNKSDLTALCKSRGKRVLEMKKFKCSDLNWSTTEVEFDQSILLWHIATE  494

Query  946   ICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTF  767
             +CY++       +     E  +Y+SEY+LYLL +         G    RDTC        
Sbjct  495   LCYYSDD---VSETIKCKESSKYMSEYMLYLLALCPFMLPMGIGLIRFRDTC--------  543

Query  766   KDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVV  662
                  EA  FF   T+Q P+  +     LR N  +
Sbjct  544   ----AEAMQFFKEKTEQ-PDRAQACKMLLRVNTEI  573



>gb|KDP43572.1| hypothetical protein JCGZ_16859 [Jatropha curcas]
Length=751

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 7/123 (6%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKGR-SKSMLIDACILAKDLQDFGIDDQKQM  350
            K +++  + K AC+ ++   T  R  P++VKG  S S+L  A +LAK+L+      + Q 
Sbjct  635  KGIRSPNKMKKACKKILEVNTHFR--PTDVKGDGSTSVLFTASMLAKELRKL----KAQK  688

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGTS*  170
            WK++  VWVE+L Y A HC    HAQQL+KGGEL+TFVWLLMAHFGLG QF+      S 
Sbjct  689  WKILSQVWVEMLSYAASHCTATCHAQQLSKGGELVTFVWLLMAHFGLGTQFQTNVSLLSQ  748

Query  169  SQN  161
             QN
Sbjct  749  GQN  751


 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 75/147 (51%), Gaps = 16/147 (11%)
 Frame = -1

Query  1123  IFNEV--KEIATQTTAVANEIILSRGKRTLLECNCG--ESIMTTVGQDVGFIQSVLLWHI  956
             IF+E+  K         A +I  +RG+  LL    G  +S + T    + F +S+L+WHI
Sbjct  511   IFSELQMKSWLIDDPETARKICTARGEWVLLNNGLGKDQSYLMTYIVGITFDESLLMWHI  570

Query  955   ATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ATE+ Y +  G    DD    E C+++S+Y+LYLL+M+    +A+AG          I +
Sbjct  571   ATELLYNDKNGIDNCDDQR--EFCKFLSDYMLYLLIMQPTMMAAVAG----------IGK  618

Query  775   TTFKDTHEEAWNFFIANTKQNPELFKR  695
               F+DT  +A  FF     ++P   K+
Sbjct  619   LRFQDTCADAERFFRKKGIRSPNKMKK  645



>ref|XP_004983450.1| PREDICTED: uncharacterized protein LOC101760534 [Setaria italica]
Length=686

 Score =   104 bits (259),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L  AC LA+ L +     + + W+++ SVWVE+L Y A  C G AHA
Sbjct  586  EPRDVKGDRSKSVLFQACKLARQLLELEGATEAKRWRLVTSVWVEMLCYAAGKCAGSAHA  645

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            +QL++GGELLT VWLLMAHFG+G+Q+R ++
Sbjct  646  RQLSQGGELLTVVWLLMAHFGVGDQYRVES  675


 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 43/86 (50%), Gaps = 11/86 (13%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFN-----FGGYRyyddddDPEICRYISEYLLYLLVMEQKFT  830
            D  F +S+LLWHIAT++C++       GG      D  P + R +S Y+L+LLVM     
Sbjct  487  DCEFDKSILLWHIATDLCFYANQDDIIGG------DPLPAMSREVSSYMLFLLVMRPFMM  540

Query  829  SALAGNFETRDTCEKIVETTFKDTHE  752
            +A  G     DTC +     F+   E
Sbjct  541  TASIGQIRFGDTCAEAKSFFFRRADE  566



>emb|CDX87780.1| BnaC02g31690D [Brassica napus]
Length=1332

 Score =   104 bits (260),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 7/108 (6%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRS  332
            R+ K A E+++      + EP +VKG RSKS+L D  +LAK+L+      +  MW+++  
Sbjct  508  RDIKKASEAILSVTAPAKAEPIDVKGDRSKSVLFDGSMLAKELK------EAYMWEVVNK  561

Query  331  VWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
            VW ELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+  
Sbjct  562  VWAELLCYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQIN  609


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 5/85 (6%)
 Frame = -1

Query  442   EVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLA  263
             +VK  SK++L D       ++ +G    K  W+++  VWVELL Y ACHC   AH +QL+
Sbjct  1241  DVKIASKTIL-DVSSDIDPMERYG----KDKWEILSKVWVELLCYAACHCDSTAHVEQLS  1295

Query  262   KGGELLTFVWLLMAHFGLGEQFRFQ  188
             +GGEL+ FVWLLMAHFGL +QF+  
Sbjct  1296  RGGELINFVWLLMAHFGLTDQFQIN  1320



>ref|XP_006398228.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
 gb|ESQ39681.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
Length=813

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 8/114 (7%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF----GIDDQKQ  353
            KN R+ + A ++++  +     EP  VKG RSKS+L DA +LAK+LQ      G DD   
Sbjct  681  KNRRDMRGASKTVL--SVCNDIEPMNVKGDRSKSVLFDASMLAKELQRLDESGGSDDGAD  738

Query  352  -MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              W+++  VWVELL Y A HC    H  QL++GGELL FVWLLMAHFGL +QF+
Sbjct  739  GKWRVLSKVWVELLSYAASHCEATEHVAQLSRGGELLNFVWLLMAHFGLADQFQ  792


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 28/150 (19%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IFNE+K  +   +T  +A ++  +RG+  L +    E   +M  V ++V + QS+LLWHI
Sbjct  548   IFNELKHKSDFAETPEIAKKVSSARGEWALRDTKVVEVERLMRYV-ENVDYDQSLLLWHI  606

Query  955   ATEICY---------FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFET  803
             ATE+C+          N  G    D     E  + +S+Y++YLL+M+ K  S +AG    
Sbjct  607   ATELCFQEEEEKKKVMNRSGESCDDR----EFSKIVSDYMMYLLIMQPKLMSEVAG----  658

Query  802   RDTCEKIVETTFKDTHEEAWNFFIANTKQN  713
                   I    F+DT  EA  FF     +N
Sbjct  659   ------IGTIRFRDTLAEAERFFKGRHSKN  682



>ref|XP_010481562.1| PREDICTED: uncharacterized protein LOC104760352 [Camelina sativa]
Length=790

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP  VKG RSKS+  DA +LAK+L+    D+ + MW+++  VWVE+L Y A HC    HA
Sbjct  691  EPMAVKGDRSKSVFFDASVLAKELRRLK-DEGENMWEVVSKVWVEMLCYAAIHCSSQEHA  749

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLM HFGLG+QF+  
Sbjct  750  SQLSKGGELIDFVWLLMTHFGLGDQFQIN  778



>ref|XP_010441702.1| PREDICTED: uncharacterized protein LOC104724847 [Camelina sativa]
Length=791

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP  VKG RSKS+  DA +LAK+L+    D+ + MW+++  VWVE+L Y A HC    HA
Sbjct  692  EPMAVKGDRSKSVFFDASVLAKELRRLK-DEGENMWEVVSKVWVEMLCYAAIHCSSQEHA  750

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLM HFGLG+QF+  
Sbjct  751  SQLSKGGELIDFVWLLMTHFGLGDQFQIN  779



>gb|KEH43307.1| DUF594 family protein [Medicago truncatula]
Length=717

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 6/115 (5%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDD---Q  359
            K  K  +ER   C+ ++   T     PSEVKG RSKS+L DAC LAK LQ    ++   +
Sbjct  588  KERKYIKERSQVCKMILRVNT--DILPSEVKGDRSKSVLFDACRLAKSLQSLETEENWSK  645

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ++ W+M+  VWVE+L + A  CRG  HA+QL +GGELLT VWLLMAH G+ EQF+
Sbjct  646  ERKWEMISHVWVEMLCHAASQCRGLQHAKQLTQGGELLTHVWLLMAHLGITEQFQ  700



>ref|XP_008225847.1| PREDICTED: uncharacterized protein LOC103325459 [Prunus mume]
Length=686

 Score =   103 bits (258),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 8/124 (6%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E    ++E K+MK+  ERK AC  L+   T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  554  EAEEFFKEKKIMKS-GERK-ACTKLLDVCT--DILPSKVKGDRSKSVLFDACRLAKALQS  609

Query  376  FGID---DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLG  206
               D     ++ WK +  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAH GL 
Sbjct  610  LESDRGWSNERKWKFVSHVWVEMLSYAANQCRWSGHAQQLRRGGELLTHVWLLMAHLGLT  669

Query  205  EQFR  194
            EQF+
Sbjct  670  EQFQ  673


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = -1

Query  1057  RGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF-NFGGYRyyddddDPEICR  881
             RG + L + +C + +  T+ + V F QS+LLWHIAT++CY+ +          ++ E  +
Sbjct  464   RGDQVLQKAHCLKELGWTINE-VEFDQSILLWHIATDLCYYSDVNRNSNLVPSENCEDSK  522

Query  880   YISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKD  761
              +S Y++YLLVM         G    RDTC +  E  FK+
Sbjct  523   LLSNYMMYLLVMCPFMLPNGIGQIRFRDTCAE-AEEFFKE  561



>ref|XP_008228196.1| PREDICTED: uncharacterized protein LOC103327633 [Prunus mume]
Length=540

 Score =   102 bits (255),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ----KQ  353
            K+  + + AC  L+  +T     PSEVKG RSKS+L DAC LAK LQ   ++      ++
Sbjct  417  KSITDEEKACTMLLKVST--DISPSEVKGDRSKSVLFDACRLAKALQSMEVEGHWGTNEK  474

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAH GL EQF+
Sbjct  475  KWELVSQVWVEMLSYAANRCRWSDHAQQLRRGGELLTHVWLLMAHLGLTEQFQ  527



>emb|CDY38969.1| BnaC07g18510D [Brassica napus]
Length=663

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 83/146 (57%), Gaps = 19/146 (13%)
 Frame = -1

Query  577  NKDSTTHREMTTLWEEWKM--------------MKNYRERKSACESLIGKATLRRQ---E  449
            NK   T+RE + +  ++ M              +   R +K        +A L  +   E
Sbjct  505  NKAEYTNREFSKILSDYMMYLLIMQPALMSSVHINKIRHKKENLVKEASRAILSVKTFVE  564

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L D  +LA++L     + ++ MW+++  VWVELL + A HC    HA 
Sbjct  565  PMDVKGDRSKSVLFDGSVLAQELMKLQ-NGRESMWEVVSKVWVELLCFAATHCDSQEHAS  623

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            QL+KGGEL+ FVWLLMAHFGLG+QF+
Sbjct  624  QLSKGGELINFVWLLMAHFGLGDQFQ  649



>ref|NP_001068343.1| Os11g0639300 [Oryza sativa Japonica Group]
 gb|ABA94974.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28706.1| Os11g0639300 [Oryza sativa Japonica Group]
 gb|EAZ19030.1| hypothetical protein OsJ_34561 [Oryza sativa Japonica Group]
 dbj|BAG95360.1| unnamed protein product [Oryza sativa Japonica Group]
Length=726

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 3/104 (3%)
 Frame = -1

Query  490  CESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF-GIDDQKQMWKMMRSVWVEL  317
            C   + K      EP +VKG RSKS+L  AC L + L +  GI ++++ W+++  VWVE+
Sbjct  608  CAKRLTKVDTSIAEPRDVKGDRSKSVLFQACKLVRQLNELEGITEERR-WRLIAGVWVEM  666

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            L Y A  C G+AHA+QL++GGE+LT VWLLMAHFG+G+Q+R ++
Sbjct  667  LCYAAGKCSGNAHARQLSQGGEMLTVVWLLMAHFGMGDQYRVES  710



>gb|KDO39751.1| hypothetical protein CISIN_1g005146mg [Citrus sinensis]
Length=712

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            R  AC+ L+   T  +  P +VKG RSKS+L DAC +A  L +  I D K  WKM+R VW
Sbjct  600  RIQACKMLLKVKT--QVLPIKVKGDRSKSVLFDACRVASALNE--ISDSKSRWKMVRDVW  655

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            +E+L Y A   RG  HA+QL +GGELLT VWLLMAHFG+ +QF+ 
Sbjct  656  LEMLTYAASQSRGSEHARQLKRGGELLTHVWLLMAHFGMTDQFQI  700



>ref|XP_006426735.1| hypothetical protein CICLE_v10025020mg [Citrus clementina]
 gb|ESR39975.1| hypothetical protein CICLE_v10025020mg [Citrus clementina]
Length=712

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            R  AC+ L+   T  +  P +VKG RSKS+L DAC +A  L +  I D K  WKM+R VW
Sbjct  600  RIQACKMLLKVKT--QVLPIKVKGDRSKSVLFDACRVASALNE--ISDSKNRWKMVRDVW  655

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            +E+L Y A   RG  HA+QL +GGELLT VWLLMAHFG+ +QF+ 
Sbjct  656  LEMLTYAASQSRGSEHARQLKRGGELLTHVWLLMAHFGMTDQFQI  700



>ref|XP_007217306.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
 gb|EMJ18505.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
Length=690

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ----KQ  353
            K+  + + AC  L+  +T     PSEVKG RSKS+L DAC LAK LQ   ++      ++
Sbjct  567  KSITDEEKACTMLLKVST--DISPSEVKGDRSKSVLFDACRLAKALQSMEVEGHWGTNEK  624

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAH GL EQF+
Sbjct  625  KWELVSQVWVEMLSYAANRCRWSDHAQQLRRGGELLTHVWLLMAHLGLTEQFQ  677



>ref|XP_010494665.1| PREDICTED: uncharacterized protein LOC104771784 [Camelina sativa]
Length=792

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP  VKG RSKS+  DA +LAK+L+    D+ + MW+++  VWVE+L Y A HC    HA
Sbjct  693  EPMAVKGDRSKSVFFDASMLAKELRRLK-DEGENMWEVVSKVWVEMLCYAAIHCSSQEHA  751

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLM HFGLG+QF+  
Sbjct  752  SQLSKGGELIDFVWLLMTHFGLGDQFQIN  780



>ref|XP_006465849.1| PREDICTED: uncharacterized protein LOC102607771 isoform X1 [Citrus 
sinensis]
 ref|XP_006465850.1| PREDICTED: uncharacterized protein LOC102607771 isoform X2 [Citrus 
sinensis]
Length=712

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            R  AC+ L+   T  +  P +VKG RSKS+L DAC +A  L +  I D K  WKM+R VW
Sbjct  600  RIQACKMLLKVKT--QVLPIKVKGDRSKSVLFDACRVASALNE--ISDSKSRWKMVRDVW  655

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            +E+L Y A   RG  HA+QL +GGELLT VWLLMAHFG+ +QF+ 
Sbjct  656  LEMLTYAASQSRGSEHARQLKRGGELLTHVWLLMAHFGMTDQFQI  700



>emb|CBI36698.3| unnamed protein product [Vitis vinifera]
Length=638

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKGR-SKSMLIDACILAKDLQDFGID--DQK  356
            ++ K  ++R  ACE L+ +       P + KG  SKS+L+DAC LAK LQ    +  + +
Sbjct  414  EIFKCVKDRIQACERLLLQVN-TEIPPLKAKGDGSKSVLLDACRLAKSLQSLESEKWNNE  472

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQ  200
            + W+MM  VWVE+L Y ACHC  + HA++L +GGELLT VWLLMAHFG+ E 
Sbjct  473  KKWEMMSHVWVEMLCYAACHCPRNKHAKELTQGGELLTHVWLLMAHFGITEH  524


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF ++++ +  T  +  A E+   RGKRTL E  C  ++  ++  +  F + +L+WH+AT
Sbjct  298   IFEQLQKKSKHTPGIKEAKELCADRGKRTLEEMKCFSTLHWSIEGE--FDKCILVWHLAT  355

Query  949   EICY-FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ++CY  +         + + E  + +S+Y++YLLV          G    +D+C K  E
Sbjct  356   DLCYDTDLNKKSSPAKNSNREASKLLSDYMVYLLVKHPVMLPDGIGQIRFQDSCAKATE  414



>ref|NP_193643.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65529.1| hypothetical protein At4g19080 [Arabidopsis thaliana]
 gb|AEE84137.1| uncharacterized protein AT4G19080 [Arabidopsis thaliana]
Length=327

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = -1

Query  508  RERKSACESLIGKAT-LRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQK---QMWKM  341
            R+ K AC +++   T       +  + +SKSML  A +LAK+L    I +++    MWK+
Sbjct  200  RDAKKACAAIVDSFTEFELGNGNARRYQSKSMLFQASMLAKEL--LHITNERGNDAMWKV  257

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  VWVE+L Y A HC    HA QL KGGEL+ FVWLLMAHFGLGEQFR
Sbjct  258  VSKVWVEMLCYAATHCDSKQHAAQLNKGGELINFVWLLMAHFGLGEQFR  306



>ref|XP_007217388.1| hypothetical protein PRUPE_ppa025953mg, partial [Prunus persica]
 gb|EMJ18587.1| hypothetical protein PRUPE_ppa025953mg, partial [Prunus persica]
Length=137

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 76/128 (59%), Gaps = 8/128 (6%)
 Frame = -1

Query  562  THREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKD  386
            T  E    ++E K+MK   ERK AC  L+   T     PS+VKG RSKS+L DAC LAK 
Sbjct  1    TRAEAEEFFKEKKIMK-LGERK-ACTKLLDVCTYIL--PSKVKGDRSKSVLFDACRLAKA  56

Query  385  LQDFGID---DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHF  215
            LQ    D      + W+ +  VWVE+L Y A  CR    AQQL +GGELLT VWLLMAH 
Sbjct  57   LQSLESDRGWTNGRKWQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHL  116

Query  214  GLGEQFRF  191
            GL EQF+ 
Sbjct  117  GLTEQFQI  124



>ref|XP_007221914.1| hypothetical protein PRUPE_ppa026837mg [Prunus persica]
 gb|EMJ23113.1| hypothetical protein PRUPE_ppa026837mg [Prunus persica]
Length=735

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 7/104 (7%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            +  ACE L+  +T    +P++VKG RSKS+L DAC LA  L +     +++ W+++  VW
Sbjct  625  KTEACEMLLRVST--EVKPAKVKGDRSKSVLFDACSLASSLNN----QKEKKWEILSQVW  678

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +E+L Y A HCRG+ HAQQL +GGELLT VWLLMAH G+ EQ +
Sbjct  679  IEILGYAASHCRGNFHAQQLRRGGELLTHVWLLMAHLGITEQLQ  722



>gb|KFK31560.1| hypothetical protein AALP_AA6G127700 [Arabis alpina]
Length=861

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 3/112 (3%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            + +++ +  K A ++++   +  + EP  VKG RSKS+L DA  LAKDL++   + +   
Sbjct  738  RHIEDAKNVKKASDTILKVES--KIEPMGVKGDRSKSVLFDASRLAKDLKEMEENYEVDK  795

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WK++  VWVELL + ACHC   AH +QL++G EL+ FVWLLMAHFGL +QF+
Sbjct  796  WKILSKVWVELLCHAACHCDSTAHVEQLSRGAELINFVWLLMAHFGLTDQFQ  847


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 68/136 (50%), Gaps = 17/136 (13%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRG----KRTLLECNCGESIMTTVGQDVGFIQSVLLW  962
             IF E+K  +    +   A  I ++RG    +  L E    E ++  V + V + QS+L+W
Sbjct  611   IFKELKNKSKFGDSPENAKRISMARGEWSLRDNLPEGADREKLVRYVTK-VDYDQSLLMW  669

Query  961   HIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKI  782
             HIATE+CY     ++  +     E  + IS+Y++YLL+++    S +AG          I
Sbjct  670   HIATELCYQQKDTFKDKEHYSYREFSKIISDYMMYLLILQPGLMSEVAG----------I  719

Query  781   VETTFKDTHEEAWNFF  734
              +  F+DT  EA  FF
Sbjct  720   GKIRFRDTMAEADKFF  735



>gb|ABK28253.1| unknown [Arabidopsis thaliana]
Length=328

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = -1

Query  508  RERKSACESLIGKAT-LRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQK---QMWKM  341
            R+ K AC +++   T       +  + +SKSML  A +LAK+L    I +++    MWK+
Sbjct  200  RDAKKACAAIVDSFTEFELGNGNARRYQSKSMLFQASMLAKEL--LHITNERGNDAMWKV  257

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  VWVE+L Y A HC    HA QL KGGEL+ FVWLLMAHFGLGEQFR
Sbjct  258  VSKVWVEMLCYAATHCDSKQHAAQLNKGGELINFVWLLMAHFGLGEQFR  306



>ref|XP_002863470.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39729.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=749

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 74/114 (65%), Gaps = 6/114 (5%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQ-  353
            K +KN R+ K A + ++  +     EP  VKG RSKS+L DA +LAK+LQ    ++ +  
Sbjct  623  KHIKNLRDMKRASKMILSVSN--DYEPMYVKGNRSKSVLFDASMLAKELQRLEDNNSRNG  680

Query  352  --MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
               W+++  VWVELL Y A  C+   H  QL++GGELL+FVWLLMAHFGL +QF
Sbjct  681  YGKWRVLSKVWVELLCYAASQCKAMEHVAQLSRGGELLSFVWLLMAHFGLSDQF  734


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 76/158 (48%), Gaps = 19/158 (12%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGES--IMTTVGQDVGFIQSVLLWHI  956
             IFNEVK  +   +T  +  ++  +RG+  L +    ES  +M  V ++V + QS+LLWHI
Sbjct  494   IFNEVKNKSYFAETPDLTKKLSSARGEWVLRDMILAESERLMRYV-ENVSYDQSLLLWHI  552

Query  955   ATEICYFNFGGYRyyddddDP----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+C+         +   D     E  +  S+Y++YLL+M  K  S +AG         
Sbjct  553   ATELCFQQEENEEMENLSRDNYDDREFSKITSDYMMYLLIMRPKLMSQVAG---------  603

Query  787   KIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRS  674
              I    F+DT  EA  FF     +N    KR +  + S
Sbjct  604   -IGTIRFRDTLAEAERFFKGKHIKNLRDMKRASKMILS  640



>dbj|BAJ89418.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 75/108 (69%), Gaps = 7/108 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            ER+ A      KA +   EP +VKG RSKS+L DAC LA+ L+   I   ++ W+++  V
Sbjct  614  ERQGASALAAVKADI---EPRKVKGDRSKSVLFDACRLAEQLRGMEI---RKRWRLVAGV  667

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            WVE++ Y A  CRG+ HA+QL++GGELLT +WLLMAHFG+G+Q+R + 
Sbjct  668  WVEMMCYAAGKCRGNFHAKQLSQGGELLTVLWLLMAHFGIGDQYRVEA  715



>ref|XP_006398219.1| hypothetical protein EUTSA_v10000775mg [Eutrema salsugineum]
 gb|ESQ39672.1| hypothetical protein EUTSA_v10000775mg [Eutrema salsugineum]
Length=856

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            + ++NYR+ + A E+++  ++    +P  VKG RSKS+L DA  LAKDL       +   
Sbjct  733  RHIENYRDVELASETILDISS--DVDPMGVKGDRSKSVLFDASRLAKDLMKLEEHFEIDK  790

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+++  VWVELL + ACHC   AH +QL +G EL+ FVWLLMAHFGL +QF+
Sbjct  791  WEILSKVWVELLCHAACHCDATAHVEQLTRGAELINFVWLLMAHFGLTDQFQ  842


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 58/123 (47%), Gaps = 18/123 (15%)
 Frame = -1

Query  1078  ANEIILSRGKRTL---LECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFN-----FGG  923
             A  I L+RG+ TL   L        +     +V + QS+L+WHIATE+CY N        
Sbjct  618   AKRISLARGEWTLRANLPEGADREKLVRYVTNVDYDQSLLMWHIATELCYQNKKETIPKD  677

Query  922   YRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAW  743
             Y         E  + IS+Y++YLL+++    S +AG          I +  F+DT  EA 
Sbjct  678   YDKSKHYSYREFSKIISDYMMYLLILQPGLMSEVAG----------IGKIRFRDTLAEAD  727

Query  742   NFF  734
              FF
Sbjct  728   KFF  730



>gb|KDP43866.1| hypothetical protein JCGZ_20876 [Jatropha curcas]
Length=121

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQMWKMMRSVWVELLLYGACHCRGDA  281
            PS+VKG RSKS+L DAC L K LQ    ++Q   ++ WKM+  VW+E+L Y A  C  + 
Sbjct  20   PSQVKGNRSKSVLFDACRLTKSLQSLETEEQWTSEKKWKMINDVWIEMLCYAANLCGWNN  79

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            HA++L  GGELLT VWLLMAH G+ EQF+ 
Sbjct  80   HAKKLTGGGELLTHVWLLMAHLGITEQFQI  109



>ref|XP_010650647.1| PREDICTED: uncharacterized protein LOC100241320 [Vitis vinifera]
Length=686

 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+ L+   T     P +VKG +SKS+L DAC LAK LQ   I  +K+ W+M+  VWVE+
Sbjct  576  ACQKLLAVNT--EVPPQQVKGDKSKSVLFDACRLAKSLQSLKIA-EKEKWEMICDVWVEM  632

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A  C  + HAQQL +GGELLT VWLLMAHFG+ E F+
Sbjct  633  LCYAASQCGWNQHAQQLRRGGELLTHVWLLMAHFGISEHFK  673



>ref|XP_010529253.1| PREDICTED: uncharacterized protein LOC104806187 [Tarenaya hassleriana]
Length=829

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 3/106 (3%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRS  332
            RE + AC ++   +T    EP +VKG RSKS+L +   LAK L+      +   W +M  
Sbjct  712  REVREACRTISSIST--DVEPVDVKGDRSKSVLFEGSSLAKQLKLVEEKHKVNKWMIMSR  769

Query  331  VWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            VWVELL Y AC C   AH +QL++GGEL+ FVWLLMAHFGLG+QF+
Sbjct  770  VWVELLSYAACRCEATAHVKQLSRGGELINFVWLLMAHFGLGDQFQ  815



>ref|XP_007200116.1| hypothetical protein PRUPE_ppa018880mg [Prunus persica]
 gb|EMJ01315.1| hypothetical protein PRUPE_ppa018880mg [Prunus persica]
Length=153

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 76/125 (61%), Gaps = 8/125 (6%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E   L++E K+MK   ERK AC  L+   T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  21   EAEELFKEKKIMK-LGERK-ACTKLLDVCT--DILPSKVKGDRSKSVLFDACRLAKALQS  76

Query  376  FGID---DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLG  206
               D      + W+ +  VWVE+L Y A  CR    AQQL +GGELLT VWLLMAH GL 
Sbjct  77   LESDRGWTNGRKWQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHLGLT  136

Query  205  EQFRF  191
            EQF+ 
Sbjct  137  EQFQI  141



>ref|XP_007214073.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
 gb|EMJ15272.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
Length=686

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 8/124 (6%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E    ++E K+MK+  ERK AC  L+   T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  554  EAEEFFKEKKIMKS-GERK-ACTKLLDVCT--DILPSKVKGDRSKSVLFDACRLAKALQS  609

Query  376  FGID---DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLG  206
               D     ++ W+ +  VWVE+L Y A  CR   HAQQL +GGELLT VWLLMAH GL 
Sbjct  610  LESDRGWSNERKWEFVSHVWVEMLSYAANQCRWSGHAQQLRRGGELLTHVWLLMAHLGLT  669

Query  205  EQFR  194
            EQF+
Sbjct  670  EQFQ  673


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = -1

Query  1057  RGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF-NFGGYRyyddddDPEICR  881
             RG + L + +C + +  T+ + V F QS+LLWHIAT++CY+ +          ++ E  +
Sbjct  464   RGDQVLQKAHCLKELGWTINE-VEFDQSILLWHIATDLCYYSDVNRNSNSVPSENCEDSK  522

Query  880   YISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKD  761
              +S Y++YLLVM         G    RDTC +  E  FK+
Sbjct  523   LLSNYMMYLLVMCPFMLPNGIGQIRFRDTCAE-AEEFFKE  561



>emb|CDX90102.1| BnaA08g18820D [Brassica napus]
Length=740

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 64/89 (72%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L D  +LA++L     + ++ MW+++  VWVELL + A HC    HA
Sbjct  641  EPMDVKGDRSKSVLFDGSVLAQELMKLQ-NGRESMWEVVSKVWVELLCFAATHCDSQEHA  699

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLMAHFGLG+QF+  
Sbjct  700  SQLSKGGELINFVWLLMAHFGLGDQFQIN  728



>ref|XP_007227431.1| hypothetical protein PRUPE_ppb023961mg, partial [Prunus persica]
 gb|EMJ28630.1| hypothetical protein PRUPE_ppb023961mg, partial [Prunus persica]
Length=199

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E    ++E K+MK   ERK AC  L+   T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  57   EAEGFFKEKKIMK-LGERK-ACTKLLDVCT--DILPSKVKGDRSKSVLFDACRLAKALQS  112

Query  376  FGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
                ++ + W+ +  VWVE+L Y A  CR    AQQL +GGELLT VWLLMAH GL EQF
Sbjct  113  LE-SNRGRKWQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHMGLTEQF  171

Query  196  RF  191
            + 
Sbjct  172  QI  173



>ref|XP_010112453.1| hypothetical protein L484_013837 [Morus notabilis]
 gb|EXC33640.1| hypothetical protein L484_013837 [Morus notabilis]
Length=155

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 62/104 (60%), Gaps = 5/104 (5%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
             +   ACE +I   T  R    +   +SKS+L D CILAK LQ       ++ W++M  +
Sbjct  46   HDHSKACEKIISVKTKLRASAVKGSSKSKSVLFDTCILAKQLQRL-----EKWWEVMDRM  100

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            WVELL Y A +CR   HAQQ +KGGELLTF WLLM H GLG  F
Sbjct  101  WVELLSYAAVNCRSIVHAQQPSKGGELLTFTWLLMNHMGLGFHF  144



>ref|XP_010445807.1| PREDICTED: uncharacterized protein LOC104728544 [Camelina sativa]
Length=819

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFG-IDDQKQ  353
            + +K+ R  K A E+++  +   + EP  VKG RSKS+L +A +LAK+L +     +   
Sbjct  674  RHIKDLRNMKRASETVL--SVNNKIEPMLVKGDRSKSVLFEASMLAKELMNLKETSNGDG  731

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W++M  VWVELL Y A HC+   H  QL++GGELL FVWLLMAHFGL +QF+
Sbjct  732  KWRVMSKVWVELLCYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLADQFQ  784


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 78/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF E+K+ +   +   VA ++  +RG+  L +    E   +M  + ++V + QS+LLWHI
Sbjct  544   IFYELKDKSDFAEKPEVAKKVSWARGEWALRDTKVAEIDRLMLYI-ENVDYDQSLLLWHI  602

Query  955   ATEICYFNFGGYRyyddddDP-----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTC  791
             ATE+C+    G    ++         E  + IS+Y++YLL+M  K  S +AG        
Sbjct  603   ATELCFQKQEGDEEIENLSGESYDDREFSKIISDYMMYLLIMRPKLMSEVAG--------  654

Query  790   EKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNN  668
               I    F+DT  EA  FF     ++    KR +  + S N
Sbjct  655   --IGTIRFRDTKAEAERFFQGRHIKDLRNMKRASETVLSVN  693



>ref|XP_006663073.1| PREDICTED: uncharacterized protein LOC102709120 [Oryza brachyantha]
Length=745

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDF-GIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            EP +VKG RSKS+L  AC LAK L++  GI D  + W+++  VWVE+L + A  C G AH
Sbjct  645  EPRDVKGDRSKSVLFQACKLAKQLRELEGITDVTR-WQLIAGVWVEMLCHAAGKCSGSAH  703

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            A+QL++GGELLT VWLLMAHFG+G+Q+R ++
Sbjct  704  ARQLSQGGELLTVVWLLMAHFGVGDQYRVES  734



>ref|XP_010671772.1| PREDICTED: uncharacterized protein LOC104888479 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            ++ ++ K+AC  L+   T  R  PS++KG RSKS+L DAC LAK L +    +++ MW++
Sbjct  583  RSIKDDKTACRRLLNIKTKIR--PSDIKGDRSKSVLFDACRLAKLLNN----NKEWMWQV  636

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  VWVE+L Y A  CR + HAQQL++GGELLT +WLL+AH GL E  +
Sbjct  637  IAGVWVEMLAYAANQCRSNYHAQQLSQGGELLTHIWLLLAHLGLSEHIQ  685



>ref|XP_010650601.1| PREDICTED: uncharacterized protein LOC104879459 [Vitis vinifera]
Length=582

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 4/112 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKGR-SKSMLIDACILAKDLQDFGID--DQK  356
            ++ K  ++R  ACE L+ +       P + KG  SKS+L+DAC LAK LQ    +  + +
Sbjct  468  EIFKCVKDRIQACERLLLQVN-TEIPPLKAKGDGSKSVLLDACRLAKSLQSLESEKWNNE  526

Query  355  QMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQ  200
            + W+MM  VWVE+L Y ACHC  + HA++L +GGELLT VWLLMAHFG+ E 
Sbjct  527  KKWEMMSHVWVEMLCYAACHCPRNKHAKELTQGGELLTHVWLLMAHFGITEH  578


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF ++++ +  T  +  A E+   RGKRTL E  C  ++  ++  +  F + +L+WH+AT
Sbjct  352   IFEQLQKKSKHTPGIKEAKELCADRGKRTLEEMKCFSTLHWSIEGE--FDKCILVWHLAT  409

Query  949   EICY-FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
             ++CY  +         + + E  + +S+Y++YLLV          G    +D+C K  E
Sbjct  410   DLCYDTDLNKKSSPAKNSNREASKLLSDYMVYLLVKHPVMLPDGIGQIRFQDSCAKATE  468



>ref|XP_010441715.1| PREDICTED: uncharacterized protein LOC104724856 [Camelina sativa]
Length=834

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID--DQKQMWKMMR  335
            + K A  +++  A   + E  +VKG RSKS+L D   LAK+L     +  DQ  MWK++ 
Sbjct  714  DAKGASLAILSVAAPAKAETMDVKGDRSKSVLFDGAKLAKELNGLSKNEGDQANMWKVVS  773

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVELL Y A  C    HA QL+KGGEL++FVWLLMAH GLG+QF+
Sbjct  774  QVWVELLCYAATKCGAIEHAAQLSKGGELISFVWLLMAHLGLGDQFQ  820



>emb|CAN73463.1| hypothetical protein VITISV_034873 [Vitis vinifera]
Length=717

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+ L+   T     P +VKG +SKS+L DAC LAK LQ   I  +K+ W+M+  VWVE+
Sbjct  607  ACQKLLAVNT--EVPPLQVKGDKSKSVLFDACRLAKSLQSLKIA-EKEKWEMICDVWVEM  663

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A  C  + HAQQL +GGELLT VWLLMAHFG+ E F+
Sbjct  664  LCYAASQCGWNQHAQQLRRGGELLTHVWLLMAHFGISEHFK  704



>ref|XP_010671800.1| PREDICTED: uncharacterized protein LOC104888495 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671801.1| PREDICTED: uncharacterized protein LOC104888495 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671802.1| PREDICTED: uncharacterized protein LOC104888495 [Beta vulgaris 
subsp. vulgaris]
Length=565

 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK LQ+     +++ W+++  VWVE+L+Y A  CR + HAQ
Sbjct  472  PGDVKGDRSKSVLFDACRLAKYLQN-----RERKWQIIVGVWVEMLVYAASQCRSNHHAQ  526

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFR  194
            QLA+GGELLT VWLL+AH GL E FR
Sbjct  527  QLAQGGELLTHVWLLLAHVGLSEHFR  552



>ref|XP_008437035.1| PREDICTED: uncharacterized protein LOC103482584 [Cucumis melo]
Length=757

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            +P EVKG +SKS+L +  +LA+ L+        + W++M  VW+E+L Y A HCR D HA
Sbjct  662  KPVEVKGDKSKSVLFNGSLLARKLKK-----HNEKWEIMSKVWIEMLSYAASHCRPDQHA  716

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFR  194
            QQ++KGGEL+T VWLLMAHFGLG QF+
Sbjct  717  QQVSKGGELITMVWLLMAHFGLGGQFQ  743


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 66/141 (47%), Gaps = 23/141 (16%)
 Frame = -1

Query  1123  IFNEV--KEIATQTTAVANEIILSRGKRTL------LECNCGESIMTTVGQDVGFIQSVL  968
             IF E+  K  A +T  +  EI  SRG   L       E + GE I      +V F +S++
Sbjct  504   IFEEMLEKSKAAETVEITEEICSSRGSYVLKSMDLRSEIDIGELISDI--DEVAFDESLM  561

Query  967   LWHIATEICYF---NFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRD  797
             LWHIATE+CY    N             E  + +S+Y+LYL+VM     SA+AG      
Sbjct  562   LWHIATELCYRDEQNTNTNVNDTSTTYREFSKLLSDYMLYLIVMLPSMMSAVAG------  615

Query  796   TCEKIVETTFKDTHEEAWNFF  734
                 I E  F+DT  EA  FF
Sbjct  616   ----IGEIRFRDTCAEAKKFF  632



>ref|XP_010481563.1| PREDICTED: uncharacterized protein LOC104760353 [Camelina sativa]
Length=798

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFG-IDDQKQ  353
            + +K+ R+ K A E+++  +   + EP  VKG RSKS+L +A +LAK+L +     +   
Sbjct  674  RHIKDLRDMKRASETVL--SVNNKIEPMLVKGDRSKSVLFEASMLAKELGNLKETSNGDG  731

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+++  VWVELL Y A HC+   H  QL++GGELL+FVWLLMAHFGL +QF+
Sbjct  732  KWRVLSKVWVELLCYAASHCKATEHVAQLSRGGELLSFVWLLMAHFGLADQFQ  784


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 78/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF E+K+ +   +   VA ++  +RG+  L +    E   +M  + ++V + QS+LLWHI
Sbjct  544   IFYELKDKSDFAEKPEVAKKVSWARGEWALRDTKVAEIDRLMLYI-ENVDYDQSLLLWHI  602

Query  955   ATEICYFNFGGYRyyddddDP-----EICRYISEYLLYLLVMEQKFTSALAGNFETRDTC  791
             ATE+C+    G    ++         E  + IS+Y++YLL+M  K  S +AG        
Sbjct  603   ATELCFQKQEGDEEIENLSGESYDDREFSKIISDYMMYLLIMRPKLMSEVAG--------  654

Query  790   EKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNN  668
               I    F+DT  EA  FF     ++    KR +  + S N
Sbjct  655   --IGTIRFRDTKAEAERFFKGRHIKDLRDMKRASETVLSVN  693



>ref|XP_010097448.1| hypothetical protein L484_004684 [Morus notabilis]
 gb|EXB68336.1| hypothetical protein L484_004684 [Morus notabilis]
Length=736

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 15/115 (13%)
 Frame = -1

Query  511  YRERKSACESL------IGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQ  353
            +++ K +C S       + K  +R    S VKG RSKS+L DACILA+ LQ      + +
Sbjct  617  FKKHKLSCHSQACKRISLAKPKVRS---SAVKGNRSKSVLFDACILAQQLQK-----EAE  668

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             W++M  VWVEL+ Y A +CR   HAQQL+KGGELLTF WLLM H GLG QF  Q
Sbjct  669  QWEIMSRVWVELMSYAAINCRPFVHAQQLSKGGELLTFTWLLMNHLGLGSQFAEQ  723



>ref|XP_006280036.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
 gb|EOA12934.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
Length=787

 Score =   102 bits (253),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATL------RRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            +N  E K+  E+L+ +A+          +P  VKG R KS+  DA +LAK+++    D+ 
Sbjct  660  RNIYESKNEEENLVNEASRAILSVNTDVDPMAVKGDRCKSVFFDASVLAKEMRRLK-DEG  718

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            + MW+++  VWVE+L Y A HC    HA QL+KGGEL+ FVWLLM HFGLG+QF+
Sbjct  719  ENMWEVVSKVWVEMLCYAAIHCSSQEHASQLSKGGELINFVWLLMTHFGLGDQFQ  773



>ref|XP_010061838.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 ref|XP_010061839.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 ref|XP_010061840.1| PREDICTED: uncharacterized protein LOC104449398 [Eucalyptus grandis]
 gb|KCW68878.1| hypothetical protein EUGRSUZ_F02468 [Eucalyptus grandis]
Length=687

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 124/279 (44%), Gaps = 89/279 (32%)
 Frame = -1

Query  1000 GQDVGFIQSVLLWHIATEICYFN-------FGGYRyyddddDPEICRYISEYLLYLLVME  842
            G +  F Q +L  HIATE+C+++       F  Y+         + +++S Y+LYLLV  
Sbjct  475  GTEAEFDQIILTLHIATELCFYSEKVKESGFPNYK---------LSKHLSRYMLYLLV--  523

Query  841  QKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFF--IANTKQNPELFKRYASFLRSNN  668
             ++   L            I +   +DT  EA  FF   A++K  PE  +  +S  R + 
Sbjct  524  -RYPFTLPNG---------IGQIRIRDTFAEAIKFFEEQAHSKPKPEERRGASSADRRSQ  573

Query  667  VVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSAC  488
              L++                                                     AC
Sbjct  574  KALEL-----------------------------------------------------AC  580

Query  487  ESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLL  311
              L+   T     P++VKG RSKS+L D C L + L     +D+ + W+++ ++WV++LL
Sbjct  581  NMLLKVNT--EVPPTKVKGGRSKSVLFDGCRLVRVLNK---EDRTKKWEIIWNLWVDVLL  635

Query  310  YGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            Y A   RGD HA QL +GGELLT VWLL+AHFGL + F+
Sbjct  636  YAARQSRGDCHADQLRRGGELLTHVWLLLAHFGLTDHFK  674



>ref|XP_002269508.1| PREDICTED: uncharacterized protein LOC100261035 [Vitis vinifera]
Length=716

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = -1

Query  517  KNY-RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQ  353
            +NY   R  AC +L+   T     P EVKG RSKS+L DAC LAK LQ    ++Q   +Q
Sbjct  593  RNYITSRSQACTTLLQVNT--EILPLEVKGDRSKSVLFDACRLAKCLQSLETEEQWQCEQ  650

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+MM  VWVE+L + A  C+ + HA+QL +GGELLT VWLLMAHFG+ E F+
Sbjct  651  KWEMMSHVWVEMLSHAAGQCQWNHHAKQLGQGGELLTHVWLLMAHFGITEHFQ  703



>ref|XP_009128804.1| PREDICTED: uncharacterized protein LOC103853646 [Brassica rapa]
Length=859

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 14/120 (12%)
 Frame = -1

Query  511  YRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFG------------  371
            Y + K A E+++      + EP +VKG RSKS+L D  +LAK+L+               
Sbjct  726  YGDIKKASEAILSVTAPAKAEPIDVKGDRSKSVLFDGSMLAKELKGLKELPEPKELNGLK  785

Query  370  -IDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             +  +  MW+++  VWVELL Y A  C    HA QL+KGGEL++FVWLLMAHFGLG+QF+
Sbjct  786  KVKGEAYMWEVVSKVWVELLSYAATKCGAIEHAAQLSKGGELISFVWLLMAHFGLGDQFQ  845



>gb|EMS47411.1| hypothetical protein TRIUR3_14463 [Triticum urartu]
Length=756

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 7/108 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSV  329
            ER+ A      KA +   +P +VKG RSKS+L DAC LA+ L+  G++ +K+ W+++  V
Sbjct  644  ERQGASALAAVKADI---DPRKVKGDRSKSVLFDACRLAEQLR--GMEARKR-WRLVAGV  697

Query  328  WVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            WVE++ Y A  CRG+ HA+QL++GGELLT +WLLMAHFG+G+Q+R + 
Sbjct  698  WVEMMCYAAGKCRGNFHAKQLSQGGELLTVLWLLMAHFGIGDQYRVEA  745



>ref|XP_010644941.1| PREDICTED: uncharacterized protein LOC104877757 [Vitis vinifera]
Length=684

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            E +K  K+ + R  AC+ L+  +T      S+VKG RSKS+L DAC LAK LQ      +
Sbjct  564  EFFKDRKHIKSRTQACKDLLRVST--EFPASQVKGDRSKSLLFDACRLAKSLQS-----R  616

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  W++MR VWVE+L Y A  CR + HA+QL +GGELLT VWLLMAH  + E F+
Sbjct  617  EHKWELMRGVWVEMLCYAASQCRPNQHAKQLRRGGELLTHVWLLMAHLDVRENFQ  671



>ref|XP_010650642.1| PREDICTED: uncharacterized protein LOC100252444 [Vitis vinifera]
Length=697

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 4/101 (4%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVEL  317
            AC+ L+   T     P +VKG +SKS+L DAC LAK LQ   I  +K+ W+M+  VWVE+
Sbjct  587  ACQKLLAVNT--EVPPLQVKGDKSKSVLFDACRLAKSLQSLKIA-EKEKWEMICDVWVEM  643

Query  316  LLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            L Y A  C  + HAQQL +GGELLT VWLLMAHFG+ E F+
Sbjct  644  LCYAASQCGWNQHAQQLRRGGELLTHVWLLMAHFGISEHFK  684



>emb|CDY39432.1| BnaAnng05630D [Brassica napus]
Length=709

 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L D  +LA++L       ++ MW+++  VWVELL + A HC    HA
Sbjct  610  EPMDVKGDRSKSVLFDGSVLAQELMKLQ-KGRENMWEVVSKVWVELLCFAATHCDSQEHA  668

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLMAHFGLG+QF+  
Sbjct  669  SQLSKGGELINFVWLLMAHFGLGDQFQIN  697



>ref|XP_010449415.1| PREDICTED: uncharacterized protein LOC104731663 [Camelina sativa]
Length=810

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID-DQKQMWKMMR  335
            R+ K+AC +++       Q     +G RSKS+L  A +LA++LQ   I    K+MW+++ 
Sbjct  683  RDAKTACNAILDYYKADGQGNENPQGYRSKSVLFQASMLAQELQRIEIQISNKKMWEVVS  742

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVE+L Y A HC    HA QL  GGEL++FVWLLMAHFGLG QFR
Sbjct  743  KVWVEMLSYAAKHCDPKQHAAQLNIGGELISFVWLLMAHFGLGHQFR  789



>ref|XP_009101588.1| PREDICTED: uncharacterized protein LOC103827791 [Brassica rapa]
Length=779

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L D  +LA++L       ++ MW+++  VWVELL + A HC    HA
Sbjct  680  EPMDVKGDRSKSVLFDGSVLAQELMKLQ-KGRENMWEVVSKVWVELLCFAATHCDSQEHA  738

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             QL+KGGEL+ FVWLLMAHFGLG+QF+  
Sbjct  739  SQLSKGGELINFVWLLMAHFGLGDQFQIN  767



>ref|XP_006282059.1| hypothetical protein CARUB_v10028304mg [Capsella rubella]
 gb|EOA14957.1| hypothetical protein CARUB_v10028304mg [Capsella rubella]
Length=780

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 3/115 (3%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKGR-SKSMLIDACILAKDLQDFGIDDQKQM  350
            + ++N R  K+A  +++   +    +P EVKG  SKS+L DA  LAKDL    +      
Sbjct  665  RHIENKRSVKTATINILNVNS--DTDPMEVKGDGSKSVLFDASRLAKDLMHLELRYSINK  722

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            W+++  VWVELL Y AC+C   AH +QL++GGEL+ FVWLLMAHFGL +QF+   
Sbjct  723  WEILSKVWVELLCYAACYCDSMAHVEQLSRGGELINFVWLLMAHFGLTDQFQINN  777


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 71/140 (51%), Gaps = 21/140 (15%)
 Frame = -1

Query  1123  IFNEVKEIAT--QTTAVANEIILSRGKRTLLECNCGESI----MTTVGQDVGFIQSVLLW  962
             IFNE+K  +        A  + L+RG+ TL E N  E +    +     +V + QS+L+W
Sbjct  534   IFNELKYKSKFGDNPENAKSLSLARGEWTLRE-NLPEDVDCEKLLRCITNVDYDQSILMW  592

Query  961   HIATEICY----FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDT  794
             HIATE+CY     N       +     E+ + IS+Y++YLL+++    S +AGN      
Sbjct  593   HIATELCYQQEETNSEDEEKCEHYSYRELSKIISDYMMYLLILQPGLMSKVAGN------  646

Query  793   CEKIVETTFKDTHEEAWNFF  734
               KIV   F+DT  EA  FF
Sbjct  647   -GKIV---FRDTLAEAEMFF  662



>ref|XP_010645062.1| PREDICTED: uncharacterized protein LOC100259488 [Vitis vinifera]
Length=549

 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            E +K  K+ + R  AC+ L+  +T      S+VKG RSKS+L DAC LAK LQ      +
Sbjct  429  EFFKDRKHIKSRTQACKDLLRVST--EFPASQVKGDRSKSLLFDACRLAKSLQS-----R  481

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  W++MR VWVE+L Y A  CR + HA+QL +GGELLT VWLLMAH  + E F+
Sbjct  482  EHKWELMRGVWVEMLCYAASQCRPNQHAKQLRRGGELLTHVWLLMAHLDVRENFQ  536



>ref|XP_008228365.1| PREDICTED: uncharacterized protein LOC103327776 [Prunus mume]
Length=713

 Score =   101 bits (251),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
             P++VKG RSKS+L DAC LAKDLQ     D K+ W+++  VWVE+L Y A  CR   H 
Sbjct  614  HPAKVKGDRSKSVLFDACRLAKDLQAKENWDNKKKWELISHVWVEMLSYAANQCRWRDHT  673

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQTVG  179
            QQL +GGELLT VWLLMAH GL EQ++  +VG
Sbjct  674  QQLRRGGELLTHVWLLMAHLGLTEQYQI-SVG  704



>ref|XP_002458635.1| hypothetical protein SORBIDRAFT_03g037110 [Sorghum bicolor]
 gb|EES03755.1| hypothetical protein SORBIDRAFT_03g037110 [Sorghum bicolor]
Length=692

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  595  PRDVKGDRSKSVLFDACRLAKSLLEL---QPHKRWRVIRVVWVEMLCYAANKCRSNFHAK  651

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LMAHFG+GEQ+R + 
Sbjct  652  QLSAGGELLTVVWFLMAHFGVGEQYRIEA  680



>ref|XP_004496298.1| PREDICTED: uncharacterized protein LOC101495324 [Cicer arietinum]
Length=728

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 76/115 (66%), Gaps = 6/115 (5%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDD---Q  359
            K  K  +ER   C+ +I +       PSEVKG RSKS+L DAC LAK L+    ++   +
Sbjct  603  KERKYIKERSQVCK-MIDRVN-TAIPPSEVKGDRSKSVLFDACRLAKSLESLETEENWSK  660

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ++ W+M+  VWVE+L + A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  661  EKKWEMICHVWVEILCHAASQCRGLHHAKQLSQGGELLTHVWLLMAHLGITEQFQ  715



>ref|XP_002459209.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
 gb|EER95730.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
Length=768

 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++PSEVKG RSKS+L DA ILAK+L+     +++ MWK++  VW E+L Y A  CRG  H
Sbjct  669  KKPSEVKGDRSKSVLFDAVILAKELRKL---EEELMWKVITGVWGEMLTYAAGKCRGSMH  725

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH GLG+ ++ Q
Sbjct  726  VRQLSRGGELITLVWFLMAHMGLGDMYQIQ  755


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 66/139 (47%), Gaps = 14/139 (10%)
 Frame = -1

Query  1021  ESIMTTVGQDVGFIQSVLLWHIATEICYF-NFGGYRyyddddDPEICRYISEYLLYLLVM  845
             E I+ +V Q   F +S+LLWHIAT++C   ++ G    D      I   +SEY+LYLL+ 
Sbjct  560   ELILNSVVQS-DFDESLLLWHIATDLCLLRDYQGPMPQDISRKQVISETLSEYMLYLLIK  618

Query  844   EQKFTSALAGN--FETRDTCEKI------VETTFKDTHEEAWNFFIANTKQNPELFKRYA  689
             + +  +A AG      RDTCE+       +E    D+ +        NT + P   K   
Sbjct  619   QPEMLAATAGIGLLRYRDTCEEARRFFGSMEAWIDDSKDARRMLLSVNTSKKPSEVKGD-  677

Query  688   SFLRSNNVVLDIYICLRSM  632
                RS +V+ D  I  + +
Sbjct  678   ---RSKSVLFDAVILAKEL  693



>gb|KFK31554.1| hypothetical protein AALP_AA6G127000 [Arabis alpina]
Length=794

 Score =   101 bits (251),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (67%), Gaps = 8/115 (7%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLR------RQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            K+ ++  +A E+L+ +A+        + +P +VKG +SKS+L DA +LAK+L       +
Sbjct  667  KHIKKSSNAEENLMKQASKDILSVNTKIDPMDVKGDKSKSVLFDASVLAKELIRLKRGGE  726

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              MW+++  VWVEL+ Y A HC    HA QL+KGGEL+ FVWLLMAHFGLG+QF+
Sbjct  727  -NMWEVVSKVWVELICYAATHCDSKEHASQLSKGGELINFVWLLMAHFGLGDQFQ  780



>ref|XP_010034687.1| PREDICTED: uncharacterized protein LOC104423969 [Eucalyptus grandis]
 gb|KCW53118.1| hypothetical protein EUGRSUZ_J02410 [Eucalyptus grandis]
Length=735

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 78/273 (29%), Positives = 123/273 (45%), Gaps = 46/273 (17%)
 Frame = -1

Query  997  QDVGFIQSVLLWHIATEICYFN---FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTS  827
             D+ F QS+L+WHIATE+C++           +   D ++ + +S Y+LYLLV+      
Sbjct  491  NDMEFDQSILIWHIATELCHYKDLEKSEGEISEHIKDYKMSKLVSRYMLYLLVLHPSMLP  550

Query  826  ALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYI  647
               G               ++DT  +A  FF    +   E   +  + + S+ V      
Sbjct  551  TGIGMLR------------YEDTSVDAQKFF----EDKLETLSKRETSINSSAV------  588

Query  646  CLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKA  467
                 W                F K+   H  + +  E  K  ++ R+    C  L+   
Sbjct  589  ---KTWAQN------------LFKKEKHGHTGVKSCSEAHKSTES-RDLCEVCHLLLHVG  632

Query  466  TLRRQEPSEV--KGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHC  293
            T   Q P+     G+S+S+L DAC LA  L     +D  + WK++  VW + L+Y AC  
Sbjct  633  T---QLPATKIRGGKSRSVLFDACHLASQLNKIESEDLGRKWKLIGKVWAKFLIYAACLS  689

Query  292  RGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            RG  H++ L++GGEL+T VWLLMAH G+ E  +
Sbjct  690  RGYQHSENLSRGGELITHVWLLMAHLGVVEPVQ  722



>ref|XP_007015633.1| Uncharacterized protein TCM_041206 [Theobroma cacao]
 gb|EOY33252.1| Uncharacterized protein TCM_041206 [Theobroma cacao]
Length=680

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = -1

Query  493  ACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQMWKMMRSVW  326
            ACE L+   T  R EP+ VKG RSKS+L DAC LAK+L     + +   K+ W+++  VW
Sbjct  566  ACEKLLQVDT--RIEPAIVKGDRSKSVLFDACRLAKELHSLEQERKWHTKEKWELVSHVW  623

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            +E+L Y A  CR + HAQQL +GGELLT VWLLMAH GL +QF
Sbjct  624  LEMLSYAASQCRWNQHAQQLRRGGELLTHVWLLMAHLGLTKQF  666



>ref|XP_008670985.1| PREDICTED: uncharacterized protein LOC103648281 [Zea mays]
Length=827

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            Q+P+EVKG RSKS+L DA ILAK L++    D++ MW+++  VW E+L + A  CRG  H
Sbjct  728  QKPAEVKGDRSKSVLFDAVILAKALREL---DEELMWEVITGVWGEMLTFAAAKCRGSMH  784

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH GLG+ ++ Q
Sbjct  785  VRQLSRGGELITLVWFLMAHMGLGDMYQIQ  814



>emb|CDY39431.1| BnaAnng05620D [Brassica napus]
Length=699

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 70/109 (64%), Gaps = 6/109 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            KN R+ K   + ++  +     EP  VKG RSKS+L DA +LAK+L+     D+   W++
Sbjct  582  KNLRDMKRGSKMILEVSN--DIEPMHVKGDRSKSVLFDASMLAKELKRL---DENGKWRV  636

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  VWVELL Y A HC+      QL++GGELL FVWLLMAHFGL +QF+
Sbjct  637  LSKVWVELLSYAASHCKATEQVAQLSRGGELLNFVWLLMAHFGLADQFQ  685


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (52%), Gaps = 19/151 (13%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF+E+K+ +   +T   A ++  +RG+  L +    E   +M  V  +V + QS+LLWHI
Sbjct  450   IFSELKQKSEFAETPERAKKVSSARGEWALHDSKLKEVERLMRYVA-NVDYDQSLLLWHI  508

Query  955   ATEICYFNFGG----YRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+C+ +        R  +  DD E  + IS+Y++YLL+M+ K  S +AG         
Sbjct  509   ATELCFQDEKDEEVENRSGESCDDREFSKIISDYMMYLLIMQPKLMSEVAG---------  559

Query  787   KIVETTFKDTHEEAWNFFIANTKQNPELFKR  695
              I    F+DT +EA  FF     +N    KR
Sbjct  560   -IGTIRFRDTLDEAKRFFKGRHFKNLRDMKR  589



>ref|XP_010095740.1| hypothetical protein L484_003352 [Morus notabilis]
 gb|EXB62123.1| hypothetical protein L484_003352 [Morus notabilis]
Length=734

 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 5/102 (5%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKGR-SKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            + AC  L+ K      +P+ VKG+ SKS+L DAC+LAK+L++    ++K  W+ +  +WV
Sbjct  622  EDACTRLL-KVDTEDYKPATVKGKKSKSVLFDACVLAKELRNM---EEKNRWEFVSKIWV  677

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
             LL Y AC CR   H   L KGGEL+T+VWLLMAHFG+G+Q 
Sbjct  678  GLLSYAACRCRPSPHLDLLGKGGELITYVWLLMAHFGVGKQL  719



>ref|XP_008224933.1| PREDICTED: uncharacterized protein LOC103324630 [Prunus mume]
Length=675

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            + + ACE +   A   +   + VKG+SKS+L DAC L K L+    D     WK+M  VW
Sbjct  564  DHREACEKI--NAVEAKFRSAAVKGKSKSVLFDACFLVKQLEKVEADP----WKLMSRVW  617

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            VELL Y +  CR   HAQQ ++GGELLTF WLLM H GLG QF
Sbjct  618  VELLSYASIKCRPIVHAQQPSRGGELLTFTWLLMNHLGLGTQF  660


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 14/130 (11%)
 Frame = -1

Query  1111  VKEIATQTTAVANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFN  932
             +K +       A E    RG   LL+ +    +  +VG+   + +SVLLWHIATE+    
Sbjct  446   IKSLEANNRRAAMEASSQRGDWALLQTSNYLGLKWSVGE-YQYAESVLLWHIATELY---  501

Query  931   FGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHE  752
             F    +  +++  +IC+ +S+Y+ YLL M+    +A  GN+             F+DT  
Sbjct  502   FAKTEHNAENERRKICKLLSDYMFYLLAMQHNMMAAFLGNW----------HIVFQDTRA  551

Query  751   EAWNFFIANT  722
             EA  FF  ++
Sbjct  552   EAKRFFFKHS  561



>gb|EAZ02516.1| hypothetical protein OsI_24619 [Oryza sativa Indica Group]
Length=767

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 4/95 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L      D   MW+++  VW E+L+Y A  C+G  H
Sbjct  667  KKPADVKGDRSKSVLFDACILAKVLLQL---DDDTMWRVVAGVWREMLMYAANKCQGSTH  723

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGTS  173
             +QL++GGEL+T VW LMAH G+G+ +R   +G +
Sbjct  724  VRQLSRGGELITMVWFLMAHMGMGDVYRIGELGDT  758



>ref|XP_002513101.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49604.1| conserved hypothetical protein [Ricinus communis]
Length=712

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 9/117 (8%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESL--IGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID  365
            E ++ MK   +++ ACE L  +  A L    P +VKG RSKS+L DAC LA  L+D  I 
Sbjct  589  ECYRKMKIKLQKREACEMLLQVNTAVL----PKKVKGDRSKSVLFDACRLASQLED--IA  642

Query  364  DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            D++  W+M+   WVE L Y A  C G  HAQQL +GGELLT VWLLM+H GL +QF+
Sbjct  643  DKEIKWEMVCKSWVERLTYAASQCSGTYHAQQLRRGGELLTHVWLLMSHLGLTDQFQ  699



>ref|XP_002267918.2| PREDICTED: uncharacterized protein LOC100242192 [Vitis vinifera]
Length=757

 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            R  AC+ L+   T     P +V+G +SKSML +AC LAK LQ   I  +K+ W+MM  VW
Sbjct  644  RTEACQKLLEVNT--EVPPLQVEGDKSKSMLFEACRLAKSLQSLEIT-EKEKWEMMCDVW  700

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            VE+L Y A  C  + HA+QL +GGELLT VWLLMAHFG+ E F+
Sbjct  701  VEMLCYAASQCGWNQHAKQLRRGGELLTHVWLLMAHFGISEHFK  744


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 9/124 (7%)
 Frame = -1

Query  1117  NEVKEIATQTTAVANEIILSRGKRTLLE--CNCGESIMTTVGQDVGFIQSVLLWHIATEI  944
             N  KE  +   A+  ++   RG   L +   NC   +  +V +D  F QS+LLWHIAT++
Sbjct  518   NSAKE-QSDANAIYKQLCAGRGDLVLKKEKYNCHSILGWSVEED--FEQSILLWHIATDL  574

Query  943   CYFNFGGYRyyddddDPE---ICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
              Y      +    D  P+   +C+ +S+Y+LYLLVM         G+   RD+  + ++ 
Sbjct  575   LYHTDNQDQNPSLDKCPDYRAMCKLVSDYMLYLLVMRPSMLPDGIGHMRFRDSRAEGIQ-  633

Query  772   TFKD  761
              FKD
Sbjct  634   FFKD  637



>gb|EEC71644.1| hypothetical protein OsI_04079 [Oryza sativa Indica Group]
Length=688

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  591  PRDVKGDRSKSVLFDACRLAKSLLEL---QPGKRWRLIRVVWVEILCYAASKCRSNFHAK  647

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LMAH G+GEQ+R + 
Sbjct  648  QLSNGGELLTVVWFLMAHLGMGEQYRIEA  676



>ref|NP_001044525.1| Os01g0798800 [Oryza sativa Japonica Group]
 dbj|BAD68272.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06439.1| Os01g0798800 [Oryza sativa Japonica Group]
 dbj|BAG89050.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55529.1| hypothetical protein OsJ_03757 [Oryza sativa Japonica Group]
Length=688

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  591  PRDVKGDRSKSVLFDACRLAKSLLEL---QPGKRWRLIRVVWVEILCYAASKCRSNFHAK  647

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LMAH G+GEQ+R + 
Sbjct  648  QLSNGGELLTVVWFLMAHLGMGEQYRIEA  676



>ref|XP_003555479.1| PREDICTED: uncharacterized protein LOC100799916 [Glycine max]
Length=674

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQM  350
            K   +    CE + G +   +  PS+VKG RSKS+L DAC LAK ++    +    ++Q 
Sbjct  550  KYISQTDQVCEVIGGVSVDEKFLPSKVKGDRSKSVLFDACRLAKSIKSLEEEKKWSKEQK  609

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+M+  VWVE+L + A  CRG  HA+QL++GGELLT VW LMAH G+ EQF+
Sbjct  610  WEMISRVWVEMLCHAASQCRGFHHAKQLSRGGELLTHVWFLMAHLGITEQFQ  661



>emb|CAA16765.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78910.1| hypothetical protein [Arabidopsis thaliana]
Length=514

 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  508  RERKSACESLIGKAT-LRRQEPSEVKGRSKSMLIDACILAKDLQDFGID-DQKQMWKMMR  335
            R+ K AC +++   T       +  + +SKSML  A +LAK+L     +     MWK++ 
Sbjct  387  RDAKKACAAIVDSFTEFELGNGNARRYQSKSMLFQASMLAKELLHITNERGNDAMWKVVS  446

Query  334  SVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             VWVE+L Y A HC    HA QL KGGEL+ FVWLLMAHFGLGEQFR
Sbjct  447  KVWVEMLCYAATHCDSKQHAAQLNKGGELINFVWLLMAHFGLGEQFR  493



>ref|NP_001183408.1| uncharacterized protein LOC100501828 [Zea mays]
 gb|ACR36680.1| unknown [Zea mays]
Length=404

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  C+ + HA+
Sbjct  307  PRDVKGDRSKSVLFDACRLAKSLLEL---QPHKRWRVIRVVWVEMLCYAANKCQSNFHAK  363

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LMAHFG+GEQ+R + 
Sbjct  364  QLSTGGELLTVVWFLMAHFGVGEQYRIEA  392



>ref|XP_007216037.1| hypothetical protein PRUPE_ppa017443mg [Prunus persica]
 gb|EMJ17236.1| hypothetical protein PRUPE_ppa017443mg [Prunus persica]
Length=154

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 75/125 (60%), Gaps = 8/125 (6%)
 Frame = -1

Query  553  EMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQD  377
            E    ++E K+MK   ERK AC  L+   T     PS+VKG RSKS+L DAC LAK LQ 
Sbjct  21   EAEEFFKEKKIMK-LGERK-ACTKLLDMCT--DILPSKVKGDRSKSVLFDACRLAKALQS  76

Query  376  FGID---DQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLG  206
               D      + W+ +  VWVE+L Y A  CR    AQ+L +GGELLT VWLLMAH GL 
Sbjct  77   LDSDRGWTNGRKWQFVSHVWVEMLPYAANQCRWSGQAQKLRRGGELLTHVWLLMAHLGLT  136

Query  205  EQFRF  191
            EQF+ 
Sbjct  137  EQFQI  141



>ref|XP_004496121.1| PREDICTED: uncharacterized protein LOC101495219 isoform X1 [Cicer 
arietinum]
Length=712

 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQMWKMM  338
            +R   CE ++   T     PS+VKG RSKS+L DAC LAK L+    +    + + W+M+
Sbjct  594  KRSQVCEMILRVNT--EILPSKVKGDRSKSVLFDACRLAKSLESLETEQNWSKDRKWEMI  651

Query  337  RSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              VWVE+L + A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  652  SHVWVEMLCHAASQCRGIHHAKQLSQGGELLTHVWLLMAHLGITEQFQ  699



>ref|XP_010650649.1| PREDICTED: uncharacterized protein LOC100852780 [Vitis vinifera]
Length=721

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = -1

Query  502  RKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            R  AC+ L+   T     P +V+G +SKSML +AC LAK LQ   I  +K+ W+MM  VW
Sbjct  608  RTEACQKLLEVNT--EVPPLQVEGDKSKSMLFEACRLAKSLQSLEIT-EKEKWEMMCDVW  664

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            VE+L Y A  C  + HA+QL +GGELLT VWLLMAHFG+ E F+ 
Sbjct  665  VEMLCYAASQCGWNQHAKQLRRGGELLTHVWLLMAHFGIREHFKI  709


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 61/124 (49%), Gaps = 9/124 (7%)
 Frame = -1

Query  1117  NEVKEIATQTTAVANEIILSRGKRTLLE--CNCGESIMTTVGQDVGFIQSVLLWHIATEI  944
             N  KE  +   A+  ++   RG   L +   NC   +  +V +D  F QS+LLWHIAT++
Sbjct  482   NSAKE-QSDANAIYKQLCAGRGDLVLKKEKYNCHSILGWSVEED--FEQSILLWHIATDL  538

Query  943   CYFNFGGYRyyddddDPE---ICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
              Y      +       P+   +C+ +S+Y+LYLLVM         G+   RD+  + ++ 
Sbjct  539   LYHTDNQDQNPSLGKCPDYRAMCKLVSDYMLYLLVMRPSMLPDGIGHMRFRDSRAEGIQ-  597

Query  772   TFKD  761
              FKD
Sbjct  598   FFKD  601



>emb|CDY38971.1| BnaC07g18490D [Brassica napus]
Length=687

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 6/109 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKM  341
            KN R+ K   + ++  +     EP  VKG RSKS+L DA +LAK+L+     D    W++
Sbjct  570  KNLRDMKRGSKMVLEVSN--DIEPMHVKGDRSKSVLFDASMLAKELKRL---DGNGKWRV  624

Query  340  MRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            +  VWVELL Y A HC+      QL++GGELL FVWLLMAHFGL +QF+
Sbjct  625  LSKVWVELLSYAASHCKATEQVAQLSRGGELLNFVWLLMAHFGLADQFQ  673


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 82/176 (47%), Gaps = 33/176 (19%)
 Frame = -1

Query  1123  IFNEVKEIA--TQTTAVANEIILSRGKRTLLECNCGE--SIMTTVGQDVGFIQSVLLWHI  956
             IF+E+K  +   +T   A ++  +RG+  L +    E   +M  V  +V + QS+LLWHI
Sbjct  438   IFSELKRKSEFAETPERAKKVSSARGEWVLQDSKLEEVERLMRYVA-NVDYDQSLLLWHI  496

Query  955   ATEICYF--------NFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             ATE+C+         N  G    D     E  + IS+Y++YLL+M+ K  S +AG     
Sbjct  497   ATELCFQEEEDKEVENGSGKSCDDR----EFSKIISDYMMYLLIMQPKLMSEVAG-----  547

Query  799   DTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSM  632
                  I    F+DT +EA  FF          FK      R + +VL++   +  M
Sbjct  548   -----IGTIRFRDTLDEAKRFFKGRH------FKNLRDMKRGSKMVLEVSNDIEPM  592



>ref|XP_010032441.1| PREDICTED: uncharacterized protein LOC104421953 isoform X2 [Eucalyptus 
grandis]
Length=488

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKGRS-KSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            ++AC+ L+      R   ++VKG   KS+L DA ILAK+L+ +G    +  W ++  VWV
Sbjct  393  ENACKILLSVKPEARS--ADVKGDGIKSVLFDAGILAKELRKYG----ETKWVIVSEVWV  446

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            ELL Y A HCR D HAQQL+ GGEL+T VWLLM HFGL E F
Sbjct  447  ELLAYAAIHCRPDMHAQQLSTGGELVTLVWLLMVHFGLSEHF  488



>tpg|DAA57257.1| TPA: hypothetical protein ZEAMMB73_901217 [Zea mays]
Length=503

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  C+ + HA+
Sbjct  406  PRDVKGDRSKSVLFDACRLAKSLLEL---QPHKRWRVIRVVWVEMLCYAANKCQSNFHAK  462

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LMAHFG+GEQ+R + 
Sbjct  463  QLSTGGELLTVVWFLMAHFGVGEQYRIEA  491



>emb|CBI36717.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM---WKMMRSVWVELLLYGACHCRGDA  281
            PSEVKG RSKS+L DAC LA  LQ    ++Q Q    W M+  VWVE+L + A  CR + 
Sbjct  112  PSEVKGDRSKSVLFDACRLANSLQSLEREEQWQCEKKWGMISLVWVEMLCHAANQCRWNH  171

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            HA QL +GGELLT VWLLM HFG+ E F+ 
Sbjct  172  HATQLRRGGELLTHVWLLMGHFGITEHFKI  201



>ref|XP_003561517.1| PREDICTED: uncharacterized protein LOC100832608 [Brachypodium 
distachyon]
Length=786

 Score = 99.0 bits (245),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++PSEVKG R KS+L DA ILAK L++    D + MWK++ +VW E+L Y A  CRG  H
Sbjct  687  KKPSEVKGDRCKSVLFDAVILAKVLREL---DAQLMWKVVANVWAEMLTYAAGKCRGSTH  743

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
             +QL++GGEL+T VW LMAH GLG+ ++   
Sbjct  744  VRQLSRGGELITLVWFLMAHMGLGDMYQIHA  774



>gb|KDP43872.1| hypothetical protein JCGZ_20882 [Jatropha curcas]
Length=121

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQMWKMMRSVWVELLLYGACHCRGDA  281
            PS+VKG RSKS+L DAC LAK LQ    ++Q   ++  KM+  VW+E+L Y A  C  + 
Sbjct  20   PSQVKGDRSKSVLFDACRLAKSLQSLDTEEQWTSEKKRKMINDVWIEMLCYAANLCGWNN  79

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
            HA++L  GGELLT VWLLMAH G+ EQF+ 
Sbjct  80   HAKKLTGGGELLTHVWLLMAHLGITEQFQI  109



>gb|KHN00959.1| hypothetical protein glysoja_000627 [Glycine soja]
Length=595

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 72/112 (64%), Gaps = 4/112 (4%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQM  350
            K   +    C+ + G +   +  PS+VKG RSKS+L DAC LAK ++    +    ++Q 
Sbjct  471  KYISQTDQVCQVIGGVSVDEKFLPSKVKGDRSKSVLFDACRLAKSIKSLEEEKKWSKEQK  530

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+M+  VWVE+L + A  CRG  HA+QL++GGELLT VW LMAH G+ EQF+
Sbjct  531  WEMISRVWVEMLCHAASQCRGFHHAKQLSRGGELLTHVWFLMAHLGITEQFQ  582



>gb|EMS52027.1| hypothetical protein TRIUR3_01711 [Triticum urartu]
Length=675

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  581  PRDVKGDRSKSVLFDACRLAKSLLEL---PPGKKWRLIRVVWVEMLCYAASKCRSNFHAK  637

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LM H G+GEQ+R + 
Sbjct  638  QLSNGGELLTVVWFLMTHLGMGEQYRIEA  666



>ref|XP_010032440.1| PREDICTED: uncharacterized protein LOC104421953 isoform X1 [Eucalyptus 
grandis]
Length=678

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKGRS-KSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            ++AC+ L+      R   ++VKG   KS+L DA ILAK+L+ +G    +  W ++  VWV
Sbjct  583  ENACKILLSVKPEARS--ADVKGDGIKSVLFDAGILAKELRKYG----ETKWVIVSEVWV  636

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            ELL Y A HCR D HAQQL+ GGEL+T VWLLM HFGL E F
Sbjct  637  ELLAYAAIHCRPDMHAQQLSTGGELVTLVWLLMVHFGLSEHF  678



>ref|XP_007214584.1| hypothetical protein PRUPE_ppa025788mg [Prunus persica]
 gb|EMJ15783.1| hypothetical protein PRUPE_ppa025788mg [Prunus persica]
Length=650

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVW  326
            +   ACE +   A   +   + VKG+SKS+L DAC L K L++     ++  WK+M  VW
Sbjct  539  DHGKACEKI--NAVEAKFRSAAVKGKSKSVLFDACFLVKQLEEV----EEDPWKLMSRVW  592

Query  325  VELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQF  197
            VELL Y +  CR   HAQQ ++GGELLTF WLLM H GLG QF
Sbjct  593  VELLSYASIKCRPIVHAQQPSRGGELLTFTWLLMNHLGLGTQF  635


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 14/111 (13%)
 Frame = -1

Query  1057  RGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRY  878
             RG   LL+ +    +  +VG+   + +SVLLWHIATE+    F   +   D +  EIC+ 
Sbjct  439   RGDWALLQTSNYLELKWSVGE-CQYAESVLLWHIATEL---YFAKKKPNADQERREICKL  494

Query  877   ISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIAN  725
             +S+Y+ YLLVM+    +   GN+             F+DT  EA  FF+ +
Sbjct  495   LSDYMFYLLVMQHNMMAPFLGNW----------HIVFQDTRAEAKRFFLKH  535



>gb|KCW68870.1| hypothetical protein EUGRSUZ_F02459 [Eucalyptus grandis]
Length=680

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 123/282 (44%), Gaps = 74/282 (26%)
 Frame = -1

Query  985  FIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFE  806
            F Q VL+WHI TE+ Y++           D  + + +S Y+ YLLV+      +  G   
Sbjct  465  FDQVVLIWHIGTELLYYS--DQERESVLHDIWVSKLLSRYMFYLLVVYPFMLPSGIG---  519

Query  805  TRDTCEKIVETTFKDTHEEAWNFF----IANTKQNPELFKRYASFLRSNNVVLDIYICLR  638
                     E   +DT  EA+ FF    I N+K N E ++                    
Sbjct  520  ---------EIRLRDTFAEAFKFFKDHRIPNSKSNREPYQ--------------------  550

Query  637  SMWFSTRYAIRYIAKLICFFNKDSTTHREMTT-LWEEWKMMKNYRERKSACESLIGKATL  461
                       +I  L+    K      EM   L E  KM+   R               
Sbjct  551  -----------WIKNLVISRGK----RNEMNPYLQEASKMLLRVRTE-------------  582

Query  460  RRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGD  284
                P++VKG +SKS+L D C +    ++  +   ++ W+ +   W ++L+Y A  CRGD
Sbjct  583  --VHPNQVKGGKSKSVLFDGCRIVAAFKETEV---RKKWETIAKFWTKILMYAASQCRGD  637

Query  283  AHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQTVGTS*SQNI  158
             HA+QL +GGELLT VWL+MAHFGL + F+  T G + +Q I
Sbjct  638  GHARQLRRGGELLTHVWLMMAHFGLTDHFKM-TQGQAIAQLI  678



>ref|XP_010034349.1| PREDICTED: uncharacterized protein LOC104423580 [Eucalyptus grandis]
Length=464

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = -1

Query  499  KSACESLIGKATLRRQEPSEVKGRS-KSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWV  323
            ++AC+ L+      R   ++VKG   KS+L D  ILAK+L+ +G    +  W ++  VWV
Sbjct  364  ENACKILLSVKPEARS--ADVKGDGIKSVLFDKGILAKELRKYG----ETKWVIVSEVWV  417

Query  322  ELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            ELL Y A HCR D HAQQL+ GGEL+T VWLLM HFGL E F+
Sbjct  418  ELLAYAAIHCRPDMHAQQLSTGGELITLVWLLMVHFGLSEHFQ  460



>gb|EMT02725.1| hypothetical protein F775_13361 [Aegilops tauschii]
Length=693

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  596  PRDVKGDRSKSVLFDACRLAKSLLEL---PPGKRWRLIRVVWVEMLCYAASKCRSNFHAK  652

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LM H G+GEQ+R + 
Sbjct  653  QLSNGGELLTVVWFLMTHLGMGEQYRIEA  681



>ref|XP_010529252.1| PREDICTED: uncharacterized protein LOC104806186 [Tarenaya hassleriana]
Length=794

 Score = 98.6 bits (244),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 74/112 (66%), Gaps = 7/112 (6%)
 Frame = -1

Query  526  KMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQM  350
            + M+  +  K A E+++  +T    EP E+KG RS+S+L +A +L K+L+  G D     
Sbjct  675  RHMEYSKNVKEASETILSVST--DIEPVEIKGDRSQSVLFEATLLVKELRKLGRDK----  728

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            WK M  VWVELL + A +     HA+QL++GGEL++FVWLLMAHFGLG+ F+
Sbjct  729  WKTMSKVWVELLSFAANNVEAKEHAKQLSRGGELISFVWLLMAHFGLGDAFQ  780


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 28/138 (20%)
 Frame = -1

Query  1114  EVKEIATQTTAVANEIILSRGKRTL-------LECNCGESIMTTVGQDVGFIQSVLLWHI  956
             ++K    +T+A A EI  ++G+  L        E + G+ +M  V     + Q +LLWHI
Sbjct  552   KIKSEVAETSAEAKEISSAKGEWVLRQMRPEVTESDDGDRLMNYVKLK-SYDQVLLLWHI  610

Query  955   ATEICY----FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCE  788
             ATE+ Y       G +         E  + +S+Y++YLL+M+ K  S ++G         
Sbjct  611   ATELSYQENEPTEGNWEDR------EFSKILSDYMMYLLMMQPKLMSQVSG---------  655

Query  787   KIVETTFKDTHEEAWNFF  734
              IV+  F+DT  EA  FF
Sbjct  656   -IVKIRFRDTKAEADKFF  672



>ref|XP_008384010.1| PREDICTED: uncharacterized protein LOC103446657 [Malus domestica]
Length=716

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 120/265 (45%), Gaps = 61/265 (23%)
 Frame = -1

Query  985  FIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFE  806
            + +SVLLWHIATE+C+         D D   +IC   +       V E  F    A   E
Sbjct  497  YAESVLLWHIATELCFAKCSAKPLEDADGRRKICFAKT-------VKELCFAKCFAKPLE  549

Query  805  TRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYICLRSMWF  626
              D   KI +          + F++   +      K  A FL + ++V            
Sbjct  550  DADGRRKICKIL------SDYMFYLLVMQH-----KMMAPFLGNWHIVFQ----------  588

Query  625  STRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIG-KATLRRQE  449
             TR      A+   FF+K S +                  + ++AC+ +   +A  R   
Sbjct  589  DTR------AEAKRFFSKHSIS------------------DHQNACDRITALRAKFRS--  622

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
             + VKG +SKS+L DAC LA+ L++   D     W++M  VWVELL Y +  CR   HAQ
Sbjct  623  -AAVKGSKSKSVLFDACFLAEQLENLDGDK----WELMSGVWVELLSYASIKCRPIVHAQ  677

Query  271  QLAKGGELLTFVWLLMAHFGLGEQF  197
            Q ++GGELLTF WLLM H GLG QF
Sbjct  678  QPSRGGELLTFTWLLMTHLGLGTQF  702



>emb|CDM84572.1| unnamed protein product [Triticum aestivum]
Length=692

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 61/89 (69%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +       + W+++R VWVE+L Y A  CR + HA+
Sbjct  595  PRDVKGDRSKSVLFDACRLAKSLLEL---PPGKRWRLIRVVWVEMLCYAASKCRSNFHAK  651

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LM H G+GEQ+R + 
Sbjct  652  QLSNGGELLTVVWFLMTHLGMGEQYRIEA  680



>ref|XP_002529493.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32903.1| conserved hypothetical protein [Ricinus communis]
Length=713

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQM  350
            K   +R  AC +L+   T     PS+VKG RSKS+L DAC L+K ++     +Q   ++ 
Sbjct  591  KYVSDRNQACAALLQVNT--DILPSQVKGDRSKSVLFDACRLSKSIESLETVEQWTSEKK  648

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+M+  VW+E+L Y A  CR + HA+QL  GGELLT VWLLMAH G+ EQF+
Sbjct  649  WEMINHVWIEMLSYAANQCRWNNHAKQLTGGGELLTHVWLLMAHLGITEQFQ  700



>ref|XP_007217587.1| hypothetical protein PRUPE_ppa019290mg [Prunus persica]
 gb|EMJ18786.1| hypothetical protein PRUPE_ppa019290mg [Prunus persica]
Length=685

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 62/89 (70%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQMWKMMRSVWVELLLYGACHCRGDA  281
            P+EVKG  SKS+L DAC LAKDL+     +    ++ W+++  VWVE+L Y A HCR + 
Sbjct  584  PAEVKGDESKSVLFDACKLAKDLESLETKENWENQKKWQLISHVWVEMLSYAASHCRWNH  643

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            HA QL +GGELLT VWLLMAH GL EQ +
Sbjct  644  HAVQLRRGGELLTHVWLLMAHLGLTEQLQ  672


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (6%)
 Frame = -1

Query  1030  NCGESIMTTVGQDVGFIQSVLLWHIATEICYF---NFGGYRyyddddDPEICRYISEYLL  860
             NC E +  ++G++  F  SVLLWHIAT++CY+   +   Y     D + E  + +SEY+L
Sbjct  470   NCIEKLGWSIGEE--FDLSVLLWHIATQLCYYSDRDQDKYPNAFPDPNCEASKLLSEYML  527

Query  859   YLLVMEQKFTSALAGNFETRDTCEKIVE  776
             YLLV          G    +DTC +  E
Sbjct  528   YLLVKRSSMLPNGIGQIRFKDTCAEATE  555



>ref|XP_004985802.1| PREDICTED: uncharacterized protein LOC101763926 [Setaria italica]
Length=740

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 69/118 (58%), Gaps = 10/118 (8%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQE------PSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            KN+ ER        G A     +      P +VKG RSKS L DAC LAK L +      
Sbjct  614  KNFFERAEMARPDAGAAARMVLDVNAEIAPRDVKGDRSKSALFDACRLAKSLLEL---QP  670

Query  358  KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
             + W+++R VWVE+L Y A  CR + HA+QL+ GGELLT VW LMAH G+GEQ+R + 
Sbjct  671  HKRWRVIRVVWVEMLCYAANKCRSNFHAKQLSGGGELLTVVWFLMAHLGVGEQYRIEA  728



>ref|XP_006586078.1| PREDICTED: uncharacterized protein LOC100794157 [Glycine max]
Length=998

 Score = 98.2 bits (243),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 120/254 (47%), Gaps = 34/254 (13%)
 Frame = -1

Query  892  EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFI------  731
            +  + +S+YLLYL++M+    SA+ G          I +  F+DT  EA NFF       
Sbjct  735  DFSKLLSDYLLYLVIMQPNMMSAVRG----------IAQIRFQDTCAEATNFFSKRQMMA  784

Query  730  -ANTKQNPELFKRY----ASFLRSNNVVL--DIYICLRSMWFSTRYAIRYIAKLICFFNK  572
                K   +  KR      +  +SN + L  D  I L++          +I      FN 
Sbjct  785  EGERKMEAQGKKRKRDEEKALQKSNTMRLPPDQRIALQAKDMCKTLYDGFIGFFKKVFNS  844

Query  571  DSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACIL  395
             S   R    + EE    K+  + + AC  L  +      EPS VKG RSKS+L DAC L
Sbjct  845  ISC-RRNFFQVKEENGTEKS--DEQEACMRL--REVCVDHEPSAVKGDRSKSLLFDACKL  899

Query  394  AKDLQDFGIDDQKQMWK-----MMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWL  230
            A  +    +++  +  K     M+  VWVELL Y A +C    H QQL+KGGE L+ VWL
Sbjct  900  ASVIDGLRLEEPDKWKKADKWKMIAQVWVELLSYAAANCIPITHVQQLSKGGEFLSLVWL  959

Query  229  LMAHFGLGEQFRFQ  188
            LM H GL +QF+ +
Sbjct  960  LMTHLGLAKQFQIK  973



>ref|XP_003564400.2| PREDICTED: uncharacterized protein LOC100835510 [Brachypodium 
distachyon]
Length=695

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P +VKG RSKS+L DAC LAK L +    +++  W+++R VWVE+L Y A  C+ + HA+
Sbjct  597  PKDVKGDRSKSVLFDACRLAKSLLELQPANKR--WRLIRVVWVEMLCYAASKCQSNFHAK  654

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL+ GGELLT VW LM H G+GEQ+R + 
Sbjct  655  QLSNGGELLTVVWFLMTHLGMGEQYRIEA  683



>ref|XP_008362520.1| PREDICTED: uncharacterized protein LOC103426202 [Malus domestica]
Length=706

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 71/113 (63%), Gaps = 9/113 (8%)
 Frame = -1

Query  505  ERKSACESLIGKATLRRQE----PSEVKG-RSKSMLIDACILAKDLQDFGI----DDQKQ  353
            ERKS  ++  G   L +      PS+VKG RSKS+L DAC LAK LQ        ++ ++
Sbjct  581  ERKSITDAEKGCTMLLKVSTDILPSKVKGDRSKSVLFDACRLAKALQSLESKGHWENNEK  640

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+ +  VWVE+L + A  CR   HAQQL +GGELLT +WLLMAH GL EQF+
Sbjct  641  KWEFISHVWVEMLAFAANQCRWSDHAQQLRRGGELLTHIWLLMAHLGLTEQFQ  693


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = -1

Query  1072  EIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF-NFGGYRyyddddD  896
             E+   RG R L +  C + +  T+     F QS++LWHIAT++CY+ +      +    +
Sbjct  479   ELCARRGNRVLEKAKCLDELGWTIN-GAEFDQSIILWHIATDLCYYSDLNRNPEFYQSLN  537

Query  895   PEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
              E  R +S Y+LYLLVM         G    RDTC +  E
Sbjct  538   FEASRVLSNYMLYLLVMCPFMLPNGIGQIRFRDTCAEAKE  577



>gb|KHM99576.1| hypothetical protein glysoja_006419 [Glycine soja]
Length=998

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 120/254 (47%), Gaps = 34/254 (13%)
 Frame = -1

Query  892  EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFI------  731
            +  + +S+YLLYL++M+    SA+ G          I +  F+DT  EA NFF       
Sbjct  735  DFSKLLSDYLLYLVIMQPNMMSAVRG----------IAQIRFQDTCAEATNFFSKRQMMA  784

Query  730  -ANTKQNPELFKRY----ASFLRSNNVVL--DIYICLRSMWFSTRYAIRYIAKLICFFNK  572
                K   +  KR      +  +SN + L  D  I L++          +I      FN 
Sbjct  785  EGERKMEAQGKKRKRDEEKALQKSNTMRLPPDQRIALQAKDMCKTLYDGFIEFFKKVFNS  844

Query  571  DSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACIL  395
             S   R    + EE    K+  + + AC  L  +      EPS VKG RSKS+L DAC L
Sbjct  845  ISC-RRNFFQVKEENGTEKS--DEQEACMRL--REVCVDHEPSAVKGDRSKSLLFDACKL  899

Query  394  AKDLQDFGIDDQKQMWK-----MMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWL  230
            A  +    +++  +  K     M+  VWVELL Y A +C    H QQL+KGGE L+ VWL
Sbjct  900  ASVIDGLRLEEPDKWKKADKWKMIAQVWVELLSYAAANCIPITHVQQLSKGGEFLSLVWL  959

Query  229  LMAHFGLGEQFRFQ  188
            LM H GL +QF+ +
Sbjct  960  LMTHLGLAKQFQIK  973



>gb|KEH40110.1| DUF594 family protein [Medicago truncatula]
Length=723

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 4/92 (4%)
 Frame = -1

Query  457  RQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ---KQMWKMMRSVWVELLLYGACHCR  290
            R  PS+VKG RSK +L DA  LAK++ +   D++   K+MWK +  VWVE+L Y ACHC+
Sbjct  619  RVSPSKVKGDRSKYVLFDAFKLAKNVMEIKDDEEWETKKMWKFITQVWVEMLAYAACHCQ  678

Query  289  GDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
               HAQ L  GGELLT VWLLMAHFG+ ++ +
Sbjct  679  VIHHAQHLRHGGELLTHVWLLMAHFGITDRLQ  710



>ref|XP_009347581.1| PREDICTED: uncharacterized protein LOC103939247 [Pyrus x bretschneideri]
 ref|XP_009347583.1| PREDICTED: uncharacterized protein LOC103939247 [Pyrus x bretschneideri]
Length=701

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDF----GIDDQKQ  353
            K+ ++ + AC  L+  +T     PS+VKG RSKS+L DAC LAK LQ        ++ ++
Sbjct  578  KSIKDAEKACTMLLKVST--DILPSKVKGDRSKSVLFDACRLAKALQSLEDKGHWENNEK  635

Query  352  MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             W+ +  VWVE+L + A  CR   HAQQL +GGELLT +WLLMAH GL EQF+
Sbjct  636  KWEFISHVWVEMLSFAANQCRWRDHAQQLRRGGELLTHIWLLMAHLGLTEQFQ  688


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 7/100 (7%)
 Frame = -1

Query  1072  EIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF-NFGGYRyyddddD  896
             E+   RG R L +  C E +  T+     F QS++LWHIAT++CY+ +    R    D  
Sbjct  479   ELCARRGNRVLEKAKCLEELGWTIN-GAEFDQSIILWHIATDLCYYSDLNRNREMGLD--  535

Query  895   PEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVE  776
                 R +S Y+LYLLVM         G    RDTC +  E
Sbjct  536   ---SRALSNYMLYLLVMCPFMLPNGIGQIRFRDTCAEAKE  572



>gb|EAZ38443.1| hypothetical protein OsJ_22821 [Oryza sativa Japonica Group]
Length=764

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L++    D   MW+++  VW E+L Y A  C+G  H
Sbjct  663  KKPADVKGDRSKSVLFDACILAKVLREL---DDDTMWRVVAGVWREMLTYAAGKCQGSTH  719

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
             +QL++GGEL+T  W LMAH G+G+ +R 
Sbjct  720  VRQLSRGGELITMAWFLMAHMGIGDVYRI  748



>ref|XP_003627290.1| hypothetical protein MTR_8g020780 [Medicago truncatula]
 gb|AET01766.1| DUF594 family protein [Medicago truncatula]
Length=771

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 65/95 (68%), Gaps = 5/95 (5%)
 Frame = -1

Query  463  LRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDD----QKQMWKMMRSVWVELLLYGAC  299
            + +  PS+VKG RSKS+L DA  LAK++++   DD     K+MWK +  VWVE+L Y AC
Sbjct  664  IDKVSPSKVKGDRSKSVLFDAFRLAKNVREIRNDDVEWETKEMWKFITQVWVEMLAYAAC  723

Query  298  HCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            HC+   HAQ L  GGELLT VWLLMAH G+ ++ +
Sbjct  724  HCQVIHHAQHLRHGGELLTHVWLLMAHLGITDRLQ  758



>ref|NP_001058721.1| Os07g0109100 [Oryza sativa Japonica Group]
 dbj|BAC06937.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30637.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20635.1| Os07g0109100 [Oryza sativa Japonica Group]
Length=799

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L++    D   MW+++  VW E+L Y A  C+G  H
Sbjct  698  KKPADVKGDRSKSVLFDACILAKVLREL---DDDTMWRVVAGVWREMLTYAAGKCQGSTH  754

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
             +QL++GGEL+T  W LMAH G+G+ +R 
Sbjct  755  VRQLSRGGELITMAWFLMAHMGIGDVYRI  783



>ref|XP_010097432.1| hypothetical protein L484_003203 [Morus notabilis]
 gb|EXB68162.1| hypothetical protein L484_003203 [Morus notabilis]
Length=707

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 69/104 (66%), Gaps = 10/104 (10%)
 Frame = -1

Query  493  ACESLIG-KATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVE  320
            ACE +I  KA  R   P+ VKG +SKS+  DACILA+ L+   ++D+   W +M  +WVE
Sbjct  600  ACEKMISIKAKFR---PAAVKGIKSKSVFFDACILAQQLRR--LEDR---WDVMAKLWVE  651

Query  319  LLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             + Y A +CR + HAQQ ++GGELLT  WLLM HFGLG QF  Q
Sbjct  652  FMCYAAINCRANIHAQQTSRGGELLTITWLLMYHFGLGTQFSEQ  695


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (49%), Gaps = 23/142 (16%)
 Frame = -1

Query  1123  IFNEVKEIAT---QTTAVANEIILSRGKRTLLECNCGESIMT--TVGQDVGFIQSVLLWH  959
             IFNE+K+ +    +    A E  L +G+  LL  +    I    ++G+   + +S+LLWH
Sbjct  459   IFNELKDKSKDHGENPRDAREACLQKGESALLRSSTRSYIQLKWSIGE-FQYTESILLWH  517

Query  958   IATEICYF--NFGGYRyyddddDP-----EICRYISEYLLYLLVMEQKFTSALAGNFETR  800
             +ATE+CY   N          D P     EIC+ +S+Y+ YLLVM+    S + GN+   
Sbjct  518   LATELCYHQENQTSNSTTTTTDRPVNDNEEICKLVSDYMFYLLVMQTTMMSPVLGNW---  574

Query  799   DTCEKIVETTFKDTHEEAWNFF  734
                       F+DT  EA  FF
Sbjct  575   -------YKVFQDTCAEAKRFF  589



>gb|EAZ02517.1| hypothetical protein OsI_24621 [Oryza sativa Indica Group]
Length=799

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L++    D   MW+++  VW E+L Y A  C+G  H
Sbjct  698  KKPADVKGDRSKSVLFDACILAKVLREL---DDDTMWRVVAGVWREMLTYAAGKCQGSTH  754

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRF  191
             +QL++GGEL+T  W LMAH G+G+ +R 
Sbjct  755  VRQLSRGGELITMAWFLMAHMGIGDVYRI  783



>gb|KDP43880.1| hypothetical protein JCGZ_20890 [Jatropha curcas]
Length=715

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -1

Query  562  THREMTTLWEEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKD  386
            T  E T  + E K M    ++  AC +L+   T     PS+VKG RSKS+L DAC LAK 
Sbjct  581  TCAEATQFFHEKKYMS---DKIQACTALLQVNT--DILPSQVKGDRSKSVLFDACRLAKS  635

Query  385  LQDFGIDDQ---KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHF  215
            L+    ++Q   ++ WKM+  VW+E+L Y A  C  + HA++L  GGELLT VWLLMAH 
Sbjct  636  LKSLETEEQWTSEKKWKMINDVWIEMLCYAANLCGWNNHAKKLTGGGELLTHVWLLMAHL  695

Query  214  GLGEQFR  194
            G+ EQF+
Sbjct  696  GITEQFQ  702



>emb|CAN83022.1| hypothetical protein VITISV_036395 [Vitis vinifera]
Length=557

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = -1

Query  448  PSEVKGR-SKSMLIDACILAKDLQDFGID---DQKQMWKMMRSVWVELLLYGACHCRGDA  281
            P + KG  SKS+L+DAC LAK LQ    +   + ++ W+MM  VWVE+L Y ACHC  + 
Sbjct  467  PLKAKGDGSKSVLLDACRLAKSLQSLESEKEWNNEKKWEMMSHVWVEMLCYAACHCPRNE  526

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQ  200
            HA++L +GGELLT VWLLMAHFG+ E 
Sbjct  527  HAKELTQGGELLTHVWLLMAHFGITEH  553


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 9/161 (6%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF +++E +     +  A E+   RGKRTL E  C  ++  +V ++  F + +L+WH+AT
Sbjct  325   IFEQLQEKSRHAPGIKEAKELCADRGKRTLEEMKCFSTLHWSVERE--FDECILVWHLAT  382

Query  949   EICY-FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
             ++CY  +         + + E  + +S+Y++YLL+          G    RD+C K  + 
Sbjct  383   DLCYDTDLNKKSSPAKNSNREASKLLSDYMVYLLLKRPLMLPPGIGQIRFRDSCAKATKI  442

Query  772   --TFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLD  656
               T KD + ++   F+     N E+    A    S +V+LD
Sbjct  443   FQTVKDRNIQSCKRFLLQV--NTEIPPLKAKGDGSKSVLLD  481



>ref|XP_010650602.1| PREDICTED: uncharacterized protein LOC104879460 [Vitis vinifera]
 ref|XP_010650603.1| PREDICTED: uncharacterized protein LOC104879460 [Vitis vinifera]
Length=618

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -1

Query  451  EPSEVKGR-SKSMLIDACILAKDLQDFGID--DQKQMWKMMRSVWVELLLYGACHCRGDA  281
             P + KG  SKS+L+DAC LAK LQ    +  + ++ W+MM  VWVE+L Y ACHC  + 
Sbjct  528  PPLKAKGDGSKSVLLDACRLAKSLQSLESEKWNNEKKWEMMSHVWVEMLCYAACHCPRNE  587

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQ  200
            HA++L +GGELLT VWLLMAHFG+ E 
Sbjct  588  HAKELTQGGELLTHVWLLMAHFGITEH  614


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 79/161 (49%), Gaps = 9/161 (6%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF +++E +     +  A E+   RGKRTL E  C  ++  +V ++  F + +L+WH+AT
Sbjct  387   IFEQLQEKSRHAPGIKEAKELCADRGKRTLEEMKCFSTLHWSVERE--FDECILVWHLAT  444

Query  949   EICY-FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
             ++CY  +         + + E  + +S+Y++YLL+          G    RD+C K  + 
Sbjct  445   DLCYDTDLNKKSSPAKNSNREASKLLSDYMVYLLLKRPLMLPPGIGQIRFRDSCAKATKI  504

Query  772   --TFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLD  656
               T KD + ++   F+     N E+    A    S +V+LD
Sbjct  505   FQTVKDRNIQSCKRFLLQV--NTEIPPLKAKGDGSKSVLLD  543



>ref|XP_010097434.1| hypothetical protein L484_003205 [Morus notabilis]
 gb|EXB68164.1| hypothetical protein L484_003205 [Morus notabilis]
Length=785

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P+ VKG +SKS+  DACILAK LQ  G     + W +M  +W EL+ Y A +CR   HAQ
Sbjct  690  PAAVKGPKSKSVFFDACILAKQLQKLG----DERWDIMDRMWEELMCYAAINCRPIIHAQ  745

Query  271  QLAKGGELLTFVWLLMAHFGLGEQF  197
            Q ++GGELLTF WLLM HFGLG QF
Sbjct  746  QPSRGGELLTFTWLLMNHFGLGIQF  770



>ref|XP_010086813.1| hypothetical protein L484_009584 [Morus notabilis]
 gb|EXB23823.1| hypothetical protein L484_009584 [Morus notabilis]
Length=687

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 4/106 (4%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRS  332
            ++ K AC +L+  +T  +  P EVKG RSKS+L DAC LA+ L+      +K+  +M+  
Sbjct  572  KDAKKACATLLQVST--KIPPLEVKGDRSKSVLFDACKLAQALRSLKWKKEKKW-EMVSH  628

Query  331  VWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            VWVE+L Y AC C+   HAQQL +GGELLT VWLLMAH G+ EQF+
Sbjct  629  VWVEMLSYAACQCQRSQHAQQLRQGGELLTHVWLLMAHLGITEQFQ  674


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 56/113 (50%), Gaps = 18/113 (16%)
 Frame = -1

Query  1057  RGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIATEICYF-----NFGGYRyyddddDP  893
             RG   L E  C + +  ++ ++  F QS+LLWHIAT++CY+     N       +  +  
Sbjct  466   RGLWVLEEEKCLDQLGWSI-ENAEFDQSILLWHIATDLCYYSGMLENSSDAELNEKSNFK  524

Query  892   EICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFF  734
             EI +++S+Y+LYLLVM         G            +  F+DTH EA  FF
Sbjct  525   EISKWLSDYMLYLLVMRPFMLPNGIG------------QIRFQDTHAEAEEFF  565



>ref|XP_010650637.1| PREDICTED: uncharacterized protein LOC104879475 [Vitis vinifera]
Length=742

 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = -1

Query  451  EPSEVKGR-SKSMLIDACILAKDLQDFGID--DQKQMWKMMRSVWVELLLYGACHCRGDA  281
             P + KG  SKS+L+DAC LAK LQ    +  + ++ W+MM  VWVE+L Y ACHC  + 
Sbjct  652  PPLKAKGDGSKSVLLDACRLAKSLQSLESEKWNNEKKWEMMSHVWVEMLCYAACHCPRNE  711

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQ  200
            HA++L +GGELLT VWLLMAHFG+ E 
Sbjct  712  HAKELTQGGELLTHVWLLMAHFGITEH  738


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 79/161 (49%), Gaps = 9/161 (6%)
 Frame = -1

Query  1123  IFNEVKEIATQTTAV--ANEIILSRGKRTLLECNCGESIMTTVGQDVGFIQSVLLWHIAT  950
             IF ++++ +  T  +  A E+   RGKRTL E  C  ++  ++  +  F + +L+WH+AT
Sbjct  511   IFEQLQKKSKHTPGIKEAKELCADRGKRTLEEMKCFSTLHWSIEGE--FDECILVWHLAT  568

Query  949   EICY-FNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVET  773
             ++CY  +         + + E  + +S+Y++YLL+          G    RD+C K  + 
Sbjct  569   DLCYDTDLNKKSSPAKNSNREASKLLSDYMVYLLLKRPLMLPPGIGQIRFRDSCAKATKI  628

Query  772   --TFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLD  656
               T KD + ++   F+     N E+    A    S +V+LD
Sbjct  629   FQTVKDRNIQSCKRFLLQV--NTEIPPLKAKGDGSKSVLLD  667



>gb|EMT21377.1| hypothetical protein F775_05712 [Aegilops tauschii]
Length=792

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++PS VKG R KS+L DA ILAK L++ G D    MW+++  VW E+L Y A  CRG  H
Sbjct  693  EKPSVVKGDRCKSVLFDAVILAKVLRELGDD---LMWEVVAGVWGEMLTYAAGKCRGSTH  749

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH GLG+ +R  
Sbjct  750  VRQLSRGGELITMVWFLMAHMGLGDMYRIH  779


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 9/113 (8%)
 Frame = -1

Query  1009  TTVGQDVGFIQSVLLWHIATEICYFNF-GGYRyyddddDPEICRYISEYLLYLLVMEQKF  833
             ++V +D  F +S+LLWHIAT++C + F          +   I   +SEY+LYLL+ + + 
Sbjct  587   SSVNRDREFDESLLLWHIATDLCCYPFQHTAPTKATSNMKPIANTLSEYMLYLLIKQPEM  646

Query  832   TSALAGN--FETRDTC---EKIVET--TFKDTHEEAWNFFIA-NTKQNPELFK  698
              SA AG      RDTC   ++  E+   +   H++A    ++ NT + P + K
Sbjct  647   LSATAGIGLLRYRDTCAEAKRFFESAAAWDPDHKDARRMLLSVNTTEKPSVVK  699



>gb|KHN00983.1| hypothetical protein glysoja_000651 [Glycine soja]
Length=718

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQM  350
            K   +R   C+ ++   T     PS+VKG RSKS+L DA  LAK LQ         +++ 
Sbjct  596  KYISQRDKVCQVILRVNT--DVLPSKVKGDRSKSVLFDARRLAKSLQSLETKRNWSKEEK  653

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+M+  VWVE+L Y A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  654  WEMISHVWVEMLCYAASQCRGLHHAKQLSRGGELLTHVWLLMAHLGITEQFQ  705



>ref|XP_006606322.1| PREDICTED: uncharacterized protein LOC102663983 [Glycine max]
Length=718

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQM  350
            K   +R   C+ ++   T     PS+VKG RSKS+L DA  LAK LQ         +++ 
Sbjct  596  KYISQRDKVCQVILRVNT--DVLPSKVKGDRSKSVLFDARRLAKSLQSLETKRNWSKEEK  653

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W+M+  VWVE+L Y A  CRG  HA+QL++GGELLT VWLLMAH G+ EQF+
Sbjct  654  WEMISHVWVEMLCYAASQCRGLHHAKQLSRGGELLTHVWLLMAHLGITEQFQ  705



>emb|CAN59756.1| hypothetical protein VITISV_034568 [Vitis vinifera]
Length=704

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -1

Query  517  KNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQ---M  350
            K    R  A E L+  +T     PSEVKG RSKS+L DAC LA  LQ    ++Q Q    
Sbjct  582  KPITNRIQASEKLLQVST--EILPSEVKGDRSKSVLFDACRLANSLQSLEREEQWQCEKK  639

Query  349  WKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            W M+  VWVE+L   A  CR + HA QL +GGELLT VWLLMAHFG+ E F+
Sbjct  640  WGMISLVWVEMLCXAANQCRWNHHAXQLRRGGELLTHVWLLMAHFGITEHFK  691



>gb|EAY77257.1| hypothetical protein OsI_05231 [Oryza sativa Indica Group]
Length=239

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHAQ  272
            P EVKG RSKS+L DAC LA+ L+     ++++ W+++  VWVE+L Y A  CRG+ HAQ
Sbjct  143  PREVKGDRSKSVLFDACRLAEQLR---RLERRKRWRLVAGVWVEMLCYAAGKCRGNFHAQ  199

Query  271  QLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            QL++GGELLT VWLLMAHFG+G+Q+R + 
Sbjct  200  QLSQGGELLTVVWLLMAHFGMGDQYRVEA  228



>gb|KFK31559.1| hypothetical protein AALP_AA6G127600 [Arabis alpina]
Length=884

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 32/137 (23%)
 Frame = -1

Query  508  RERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDL-----------------  383
            ++ K A  +++   T  + +P +VKG RSKS+L D  +LAKDL                 
Sbjct  734  KDAKKASIAILSVETPAKADPIDVKGDRSKSVLFDGGMLAKDLIRYRELLVNKERQEPEK  793

Query  382  ----QDFGIDDQKQ----------MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELL  245
                +D G  +  Q          MWKM+  VWVE+L Y A  C    HA QL+KGGEL+
Sbjct  794  IKKIRDPGNRNDTQEPEPETPDTKMWKMVSQVWVEMLSYAATKCGAIEHAAQLSKGGELI  853

Query  244  TFVWLLMAHFGLGEQFR  194
            +FVWLLMAHFGLG+QF+
Sbjct  854  SFVWLLMAHFGLGDQFQ  870



>ref|XP_006657393.1| PREDICTED: uncharacterized protein LOC102714841 [Oryza brachyantha]
Length=808

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKGR-SKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG  SKS+L DACILAK L+     D   MW+++  VW+E+L Y A  C G  H
Sbjct  709  KKPADVKGDLSKSVLFDACILAKVLRQL---DGDTMWRVVAGVWMEMLTYAAGRCHGSTH  765

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH G+G+ +R  
Sbjct  766  VRQLSRGGELITLVWFLMAHMGIGDMYRIH  795



>ref|XP_010034372.1| PREDICTED: uncharacterized protein LOC104423603 [Eucalyptus grandis]
Length=698

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 15/118 (13%)
 Frame = -1

Query  526  KMMKNYRE-------RKSACESLIGKATLRRQEPSEVKGRSKSMLIDACILAKDLQDFGI  368
            K ++N+ +       ++SAC +L     L  + P   +    S+L +AC+LA++LQ    
Sbjct  558  KFLRNFSDGSKMNITKESACGTL-----LEAEPPLGGRKNISSVLFNACVLARELQSI--  610

Query  367  DDQKQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             ++K  WK+M  VWVELL Y A HC+  AHAQQL+KGGEL+T VWLLMA  G  +  R
Sbjct  611  -EKKDRWKIMSEVWVELLGYAAVHCQPSAHAQQLSKGGELVTLVWLLMAQLGFYQHLR  667



>ref|NP_001058700.1| Os07g0105800 [Oryza sativa Japonica Group]
 dbj|BAC10377.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31939.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31121.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20614.1| Os07g0105800 [Oryza sativa Japonica Group]
 gb|EAZ38420.1| hypothetical protein OsJ_22798 [Oryza sativa Japonica Group]
Length=814

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L     D    MW+++  VW E+L Y A  C G  H
Sbjct  715  KKPADVKGDRSKSVLFDACILAKVLLQLHDD---TMWRVVAGVWREMLTYAAGKCHGSTH  771

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH G+G+ +R  
Sbjct  772  VRQLSRGGELITLVWFLMAHMGMGDMYRIN  801



>ref|XP_010650638.1| PREDICTED: uncharacterized protein LOC104879477 [Vitis vinifera]
Length=737

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            E   + K  ++R  AC+ L+ +      +  +VKG RSKS+L +AC LAK LQ    +++
Sbjct  619  EATDIFKCVKDRIQACKKLLLQVNTEIPQ-LKVKGDRSKSVLSEACRLAKSLQSLETEEE  677

Query  358  ---KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQ  200
               ++ W++M  VWVE+L Y ACHC  + HA++L  GGELLT VWLLMAHFG+ E 
Sbjct  678  WNCEKKWELMSHVWVEMLCYAACHCPRNHHAEKLRLGGELLTHVWLLMAHFGITEH  733



>gb|EEC81382.1| hypothetical protein OsI_24593 [Oryza sativa Indica Group]
Length=786

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P++VKG RSKS+L DACILAK L     D    MW+++  VW E+L Y A  C G  H
Sbjct  687  KKPADVKGDRSKSVLFDACILAKVLLQLHDD---TMWRVVAGVWREMLTYAAGKCHGSTH  743

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQ  188
             +QL++GGEL+T VW LMAH G+G+ +R  
Sbjct  744  VRQLSRGGELITLVWFLMAHMGMGDMYRIN  773



>ref|XP_004980515.1| PREDICTED: uncharacterized protein LOC101785884 [Setaria italica]
Length=420

 Score = 94.4 bits (233),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -1

Query  451  EPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAHA  275
            EP +VKG RSKS+L  A  LA+ L +     + +  +++ SVWVE+L Y A  C G AHA
Sbjct  320  EPRDVKGDRSKSVLFQAYKLAQQLLELEGATEAKRCRLVASVWVEMLCYAAGKCSGSAHA  379

Query  274  QQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
            +QL++GGELL  VWLLMAHFG+G+Q+R ++
Sbjct  380  RQLSQGGELLNLVWLLMAHFGVGDQYRVES  409



>gb|KCW53050.1| hypothetical protein EUGRSUZ_J02347, partial [Eucalyptus grandis]
Length=696

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 138/293 (47%), Gaps = 58/293 (20%)
 Frame = -1

Query  1048  RTLLE-CNCGESIMTTVGQDVGFIQSVLLWHIATEICYFN----FGGYRy-yddddDPEI  887
             RTL++  NC   I +    D+ F Q++L+WHIATE+ Y       G      ++  + E+
Sbjct  443   RTLMQRSNCDFMIWSV---DMEFDQNILIWHIATELLYHEDRDAMGSDTIGLENIRNSEM  499

Query  886   CRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPE  707
                IS Y+LYL+V    + S L            I    ++DT  EAW FF      + E
Sbjct  500   SMLISRYMLYLVVF---YPSVLPTG---------IGVLRYEDTLVEAWKFF------DDE  541

Query  706   LFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEW  527
             L       + SN+    I          +   I++  KL   F K++  H       +E 
Sbjct  542   LA------MLSNDEGSSI----------SSVVIKWAPKL---FKKEAPVHTRFGNCIKEH  582

Query  526   KMMKNYRERKSACESLIGKATLRRQEPS-EVKG-RSKSMLIDACILAKDLQDFGIDDQKQ  353
             + M    E +  C+       ++ + P+ +++G +S S+L DAC LA  L+         
Sbjct  583   ESM----ESRDLCDLCWLLLQVKTELPAWKMRGAKSTSVLFDACHLADQLK------SAD  632

Query  352   MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              W ++  VWV +L+Y AC C+G  H + L++GGELL+ VWLLMAH G+ +  +
Sbjct  633   TWDIISKVWVRMLIYAACQCKGYEHCESLSRGGELLSHVWLLMAHLGIAQPVK  685



>gb|EEC66778.1| hypothetical protein OsI_33168 [Oryza sativa Indica Group]
Length=724

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 4/91 (4%)
 Frame = -1

Query  454  QEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDAH  278
            ++P+ VKG  SKS+L DACILAK L   G D    MW+++  VW E+L++ A  C G  H
Sbjct  625  KKPAVVKGDESKSVLFDACILAKALLQLGDD---TMWRVVAGVWREMLVHAAGRCHGSTH  681

Query  277  AQQLAKGGELLTFVWLLMAHFGLGEQFRFQT  185
             +QL +GGEL+T VW LMAH G+G+ +R Q 
Sbjct  682  VRQLGRGGELITLVWFLMAHMGIGDMYRTQV  712



>emb|CAN83020.1| hypothetical protein VITISV_036393 [Vitis vinifera]
Length=760

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -1

Query  535  EEWKMMKNYRERKSACESLIGKATLRRQEPSEVKG-RSKSMLIDACILAKDLQDFGIDDQ  359
            E   + K  ++R  AC+ L+ +      +  +VKG RSKS+L +AC LAK LQ    +++
Sbjct  642  EATDIFKCVKDRIQACKKLLLQVNTEIPQ-LKVKGDRSKSVLSEACRLAKSLQSLETEEE  700

Query  358  ---KQMWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQ  200
               ++ W++M  VWVE+L Y ACHC  + HA++L  GGELLT VWLLMAHFG+ E 
Sbjct  701  WNCEKKWELMSHVWVEMLCYAACHCPRNHHAEKLRLGGELLTHVWLLMAHFGITEH  756



>gb|KCW53121.1| hypothetical protein EUGRSUZ_J02413 [Eucalyptus grandis]
Length=723

 Score = 95.1 bits (235),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 77/278 (28%), Positives = 120/278 (43%), Gaps = 56/278 (20%)
 Frame = -1

Query  997  QDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPE---ICRYISEYLLYLLVMEQKFTS  827
             D  F QS+L+WHIATE+C++     R     +  +   + + +S Y+LYLLV+      
Sbjct  479  NDKEFDQSILVWHIATELCHYKDHDNRQGKSAEHIKDYKMSKLVSRYMLYLLVLHPSMLP  538

Query  826  ALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVVLDIYI  647
               G               ++DT  +A  FF     +   L K+  S    N+ V++   
Sbjct  539  TGIGMLR------------YEDTSIDAQKFF---DDKLAVLSKKETSI---NSSVVE---  577

Query  646  CLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKS-----ACES  482
                 W                F KD   H  + +        K ++   S      C  
Sbjct  578  ----TWAQN------------LFKKDKYHHTNVKS------CNKAHKSTVSCDLCEVCHL  615

Query  481  LIGKATLRRQEPSEV--KGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLY  308
            L+   T   Q P+     G+S+S+L DAC LA  L +    D  + W ++  VW + L+Y
Sbjct  616  LLQVGT---QLPATKIRGGKSRSVLFDACHLASQLNEIESKDFGRKWNLIGKVWAQFLIY  672

Query  307  GACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             AC  +GD H++ L++GGE L+ VWLLM H G+ E  +
Sbjct  673  AACRSKGDEHSESLSRGGEFLSHVWLLMVHLGMAEPVQ  710



>ref|XP_010034674.1| PREDICTED: uncharacterized protein LOC104423944 [Eucalyptus grandis]
Length=734

 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 138/293 (47%), Gaps = 58/293 (20%)
 Frame = -1

Query  1048  RTLLE-CNCGESIMTTVGQDVGFIQSVLLWHIATEICYFN----FGGYRy-yddddDPEI  887
             RTL++  NC   I +    D+ F Q++L+WHIATE+ Y       G      ++  + E+
Sbjct  479   RTLMQRSNCDFMIWSV---DMEFDQNILIWHIATELLYHEDRDAMGSDTIGLENIRNSEM  535

Query  886   CRYISEYLLYLLVMEQKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPE  707
                IS Y+LYL+V    + S L            I    ++DT  EAW FF      + E
Sbjct  536   SMLISRYMLYLVVF---YPSVLPTG---------IGVLRYEDTLVEAWKFF------DDE  577

Query  706   LFKRYASFLRSNNVVLDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEW  527
             L       + SN+    I          +   I++  KL   F K++  H       +E 
Sbjct  578   LA------MLSNDEGSSI----------SSVVIKWAPKL---FKKEAPVHTRFGNCIKEH  618

Query  526   KMMKNYRERKSACESLIGKATLRRQEPS-EVKG-RSKSMLIDACILAKDLQDFGIDDQKQ  353
             + M    E +  C+       ++ + P+ +++G +S S+L DAC LA  L+         
Sbjct  619   ESM----ESRDLCDLCWLLLQVKTELPAWKMRGAKSTSVLFDACHLADQLK------SAD  668

Query  352   MWKMMRSVWVELLLYGACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
              W ++  VWV +L+Y AC C+G  H + L++GGELL+ VWLLMAH G+ +  +
Sbjct  669   TWDIISKVWVRMLIYAACQCKGYEHCESLSRGGELLSHVWLLMAHLGIAQPVK  721



>gb|KDP45937.1| hypothetical protein JCGZ_11840 [Jatropha curcas]
Length=361

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 108/264 (41%), Gaps = 75/264 (28%)
 Frame = -1

Query  997  QDVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYISEYLLYLLVMEQKFTSALA  818
            +DV F QS+LLWHIATEI Y             + E  + +S+YL YLL ++    +   
Sbjct  169  KDVSFDQSILLWHIATEILYNTDEENSNPSTYGNREFSKILSDYLFYLLTIQPNLIAVAM  228

Query  817  GNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLR-SNNVVLDIYICL  641
            G  + R           K  + E    F A   +  EL K   S L   +N ++D     
Sbjct  229  GVRKIR----------IKKVYVEVERLFKARKLRWNELKKACQSILDMEDNTIMD-----  273

Query  640  RSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACESLIGKATL  461
                                          +T++  +W   ++YR        L+  A++
Sbjct  274  ------------------------------LTSIASDWAEGRSYR-------YLVPYASI  296

Query  460  RRQEPSEVKGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLYGACHCRGDA  281
                                 LAK+L+    ++Q   W++M  VW+E+L YG CHCR   
Sbjct  297  ---------------------LAKELKKLE-EEQHDKWQIMSKVWIEMLCYGVCHCRPYN  334

Query  280  HAQQLAKGGELLTFVWLLMAHFGL  209
              QQL KGGE  TFVWLL+ HFG+
Sbjct  335  LVQQLTKGGEFFTFVWLLLTHFGI  358



>gb|KHN37888.1| hypothetical protein glysoja_017012 [Glycine soja]
Length=681

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQMWKMMRSVWVELLLYGACHCRGDA  281
            PSEVKG RSKS+L DA  LAK ++    +    +++ W+MM  VWVE+L + A  CRG  
Sbjct  580  PSEVKGDRSKSVLFDARRLAKSIESLEREKKWSKEEKWEMMSHVWVEMLCHAASQCRGFH  639

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            HA+QL++GGELLT VW LMAH G+ EQF+
Sbjct  640  HAKQLSRGGELLTHVWFLMAHLGITEQFQ  668



>gb|KCW53120.1| hypothetical protein EUGRSUZ_J02412 [Eucalyptus grandis]
Length=687

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 127/278 (46%), Gaps = 58/278 (21%)
 Frame = -1

Query  994  DVGFIQSVLLWHIATEICYFNFGGYRyyddddDPEICRYI---------SEYLLYLLVME  842
            D+ F QS+L+W IATE+ ++         +    EI  +I         S Y+LYLLV+ 
Sbjct  444  DMEFDQSILIWQIATELFHYK------DLEKSRGEISEHIKDFKMSKLDSRYMLYLLVLH  497

Query  841  QKFTSALAGNFETRDTCEKIVETTFKDTHEEAWNFFIANTKQNPELFKRYASFLRSNNVV  662
                S L    +            ++DT  +A  FF    +   E+  +  + + S+   
Sbjct  498  ---PSMLPTGIDV---------LRYEDTSVDAQKFF----EDKLEMLSKKETGINSS---  538

Query  661  LDIYICLRSMWFSTRYAIRYIAKLICFFNKDSTTHREMTTLWEEWKMMKNYRERKSACES  482
                            A++ +A+    F K+   H  + +  E  K  ++ R+    C  
Sbjct  539  ----------------AVKTLAQ--NLFKKEKNDHTGVESCSEAHKSTES-RDLCEVCHL  579

Query  481  LIGKATLRRQEPSEV--KGRSKSMLIDACILAKDLQDFGIDDQKQMWKMMRSVWVELLLY  308
            L+   T   Q P+     G+S+S+L DAC LA  L     +D  + WK++  VW + L+Y
Sbjct  580  LLHVGT---QLPATKIRGGKSRSVLFDACHLASQLNKIESEDLGRKWKLIGKVWAKFLIY  636

Query  307  GACHCRGDAHAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
             AC  RG  H++ L++GGEL+T VWLLMAH G+ E  +
Sbjct  637  AACLSRGYQHSENLSRGGELITHVWLLMAHLGVVEPVQ  674



>ref|XP_003535480.1| PREDICTED: uncharacterized protein LOC100819249 [Glycine max]
Length=686

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 63/89 (71%), Gaps = 4/89 (4%)
 Frame = -1

Query  448  PSEVKG-RSKSMLIDACILAKDLQDFGID---DQKQMWKMMRSVWVELLLYGACHCRGDA  281
            PSEVKG RSKS+L DA  LAK ++    +    +++ W+MM  VWVE+L + A  CRG  
Sbjct  585  PSEVKGDRSKSVLFDARRLAKSIESLEREKKWSKEEKWEMMSHVWVEMLCHAASQCRGFH  644

Query  280  HAQQLAKGGELLTFVWLLMAHFGLGEQFR  194
            HA+QL++GGELLT VW LMAH G+ EQF+
Sbjct  645  HAKQLSRGGELLTHVWFLMAHLGITEQFQ  673



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2701966396416