BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c4523_g1_i1 len=3268 path=[51:0-3267]

Length=3268
                                                                      Score     E

ref|XP_004229283.1|  PREDICTED: uncharacterized protein LOC101268027   1459   0.0     
ref|XP_009757161.1|  PREDICTED: uncharacterized protein LOC104210059   1326   0.0     
ref|XP_009628258.1|  PREDICTED: uncharacterized protein LOC104118664   1318   0.0     
emb|CDP10533.1|  unnamed protein product                               1271   0.0     
ref|XP_011094527.1|  PREDICTED: uncharacterized protein LOC105174198   1270   0.0     
ref|XP_006344598.1|  PREDICTED: uncharacterized protein LOC102579397   1258   0.0     
ref|XP_006358735.1|  PREDICTED: uncharacterized protein LOC102604455   1256   0.0     
emb|CDY38472.1|  BnaA10g16860D                                         1233   0.0     
gb|EYU18176.1|  hypothetical protein MIMGU_mgv1a000714mg               1191   0.0     
ref|XP_006443454.1|  hypothetical protein CICLE_v10018633mg            1168   0.0     
ref|XP_006479137.1|  PREDICTED: uncharacterized protein LOC102628142   1168   0.0     
gb|KDO54987.1|  hypothetical protein CISIN_1g001521mg                  1165   0.0     
ref|XP_010279060.1|  PREDICTED: uncharacterized protein LOC104613064   1159   0.0     
gb|KDP39681.1|  hypothetical protein JCGZ_02701                        1141   0.0     
ref|XP_002525723.1|  conserved hypothetical protein                    1140   0.0     Ricinus communis
ref|XP_007030058.1|  C2 calcium/lipid-binding plant phosphoribosy...   1135   0.0     
ref|XP_011034404.1|  PREDICTED: multiple C2 and transmembrane dom...   1128   0.0     
ref|XP_004294491.1|  PREDICTED: uncharacterized protein LOC101292876   1126   0.0     
ref|XP_002319150.2|  C2 domain-containing family protein               1126   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011034405.1|  PREDICTED: uncharacterized protein LOC105132...   1117   0.0     
ref|XP_010549688.1|  PREDICTED: uncharacterized protein LOC104820783   1111   0.0     
ref|XP_010420533.1|  PREDICTED: uncharacterized protein LOC104706100   1098   0.0     
emb|CDY25472.1|  BnaC09g39870D                                         1098   0.0     
ref|XP_002871792.1|  C2 domain-containing protein                      1095   0.0     
ref|XP_010677826.1|  PREDICTED: uncharacterized protein LOC104893417   1095   0.0     
ref|XP_003542167.1|  PREDICTED: uncharacterized protein LOC100787960   1095   0.0     
ref|XP_004489683.1|  PREDICTED: uncharacterized protein LOC101501960   1093   0.0     
ref|XP_010492789.1|  PREDICTED: uncharacterized protein LOC104770124   1091   0.0     
ref|XP_010454018.1|  PREDICTED: uncharacterized protein LOC104735852   1089   0.0     
gb|KEH25590.1|  calcium-dependent lipid-binding (CaLB domain) fam...   1089   0.0     
ref|NP_197299.1|  C2 calcium/lipid-binding and phosphoribosyltran...   1088   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400340.1|  hypothetical protein EUTSA_v10012529mg            1085   0.0     
ref|XP_008240499.1|  PREDICTED: uncharacterized protein LOC103339006   1080   0.0     
ref|XP_010036234.1|  PREDICTED: uncharacterized protein LOC104425281   1080   0.0     
ref|XP_008391703.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1079   0.0     
ref|XP_010088028.1|  C2 and GRAM domain-containing protein             1077   0.0     
ref|XP_009121034.1|  PREDICTED: uncharacterized protein LOC103845885   1072   0.0     
ref|XP_007204671.1|  hypothetical protein PRUPE_ppa000623mg            1071   0.0     
ref|XP_006286355.1|  hypothetical protein CARUB_v10000107mg            1067   0.0     
ref|XP_007145964.1|  hypothetical protein PHAVU_006G001700g            1059   0.0     
ref|XP_004149122.1|  PREDICTED: uncharacterized protein LOC101222743   1036   0.0     
ref|XP_004166136.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1033   0.0     
ref|XP_002266956.1|  PREDICTED: uncharacterized protein LOC100249668   1033   0.0     Vitis vinifera
ref|XP_008441994.1|  PREDICTED: multiple C2 and transmembrane dom...   1029   0.0     
ref|XP_008778854.1|  PREDICTED: uncharacterized protein LOC103698601    870   0.0     
ref|XP_008437583.1|  PREDICTED: uncharacterized protein LOC103482952    838   0.0     
ref|XP_010029047.1|  PREDICTED: uncharacterized protein LOC104419173    836   0.0     
gb|KCW83529.1|  hypothetical protein EUGRSUZ_B00432                     836   0.0     
ref|XP_004152538.1|  PREDICTED: uncharacterized protein LOC101219043    833   0.0     
ref|XP_004171482.1|  PREDICTED: uncharacterized LOC101219043            833   0.0     
ref|XP_004508771.1|  PREDICTED: multiple C2 and transmembrane dom...    827   0.0     
ref|XP_010538085.1|  PREDICTED: uncharacterized protein LOC104812...    827   0.0     
ref|XP_003609007.1|  Unc-13-like protein                                825   0.0     
gb|AES91204.2|  calcium-dependent lipid-binding (CaLB domain) fam...    825   0.0     
ref|XP_007155336.1|  hypothetical protein PHAVU_003G192500g             823   0.0     
ref|XP_002309131.2|  C2 domain-containing family protein                823   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002323568.2|  C2 domain-containing family protein                823   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006300670.1|  hypothetical protein CARUB_v10019701mg             824   0.0     
ref|XP_010471563.1|  PREDICTED: uncharacterized protein LOC104751340    824   0.0     
ref|XP_006390396.1|  hypothetical protein EUTSA_v10018050mg             823   0.0     
emb|CDX85853.1|  BnaC06g22810D                                          820   0.0     
emb|CDX68168.1|  BnaA07g22080D                                          820   0.0     
ref|XP_009104747.1|  PREDICTED: uncharacterized protein LOC103830687    820   0.0     
ref|XP_010428463.1|  PREDICTED: uncharacterized protein LOC104713111    821   0.0     
ref|NP_177610.1|  putative transmembrane protein QUIRKY                 820   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887555.1|  C2 domain-containing protein                       820   0.0     
ref|XP_003524952.1|  PREDICTED: uncharacterized protein LOC100783882    818   0.0     
ref|XP_010086578.1|  Multiple C2 and transmembrane domain-contain...    817   0.0     
gb|KDP31210.1|  hypothetical protein JCGZ_11586                         813   0.0     
ref|XP_011019135.1|  PREDICTED: uncharacterized protein LOC105121952    815   0.0     
ref|XP_008652057.1|  PREDICTED: uncharacterized protein LOC103631978    815   0.0     
ref|XP_009417087.1|  PREDICTED: uncharacterized protein LOC103997556    812   0.0     
gb|KFK41908.1|  hypothetical protein AALP_AA2G188000                    811   0.0     
ref|XP_009614187.1|  PREDICTED: extended synaptotagmin-1                809   0.0     
ref|XP_009799877.1|  PREDICTED: uncharacterized protein LOC104245873    809   0.0     
dbj|BAC79748.1|  putative anthranilate phosphoribosyltransferase        800   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006367076.1|  PREDICTED: uncharacterized protein LOC102584166    807   0.0     
ref|XP_010678580.1|  PREDICTED: uncharacterized protein LOC104894108    807   0.0     
ref|XP_004236192.1|  PREDICTED: uncharacterized protein LOC101246333    806   0.0     
emb|CDP14853.1|  unnamed protein product                                803   0.0     
ref|XP_002511523.1|  conserved hypothetical protein                     805   0.0     Ricinus communis
gb|EEC81571.1|  hypothetical protein OsI_25017                          791   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007037224.1|  C2 calcium/lipid-binding plant phosphoribosy...    801   0.0     
ref|NP_001058966.1|  Os07g0165100                                       800   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476653.1|  PREDICTED: uncharacterized protein LOC102631240    800   0.0     
ref|XP_002267314.1|  PREDICTED: multiple C2 and transmembrane dom...    796   0.0     Vitis vinifera
ref|XP_011047438.1|  PREDICTED: uncharacterized protein LOC105141781    798   0.0     
ref|XP_004301166.1|  PREDICTED: uncharacterized protein LOC101314668    797   0.0     
ref|XP_011071607.1|  PREDICTED: uncharacterized protein LOC105157...    795   0.0     
ref|XP_008239837.1|  PREDICTED: multiple C2 and transmembrane dom...    792   0.0     
ref|XP_010275005.1|  PREDICTED: uncharacterized protein LOC104610189    795   0.0     
ref|XP_006439651.1|  hypothetical protein CICLE_v10018651mg             794   0.0     
ref|XP_007211180.1|  hypothetical protein PRUPE_ppa000632mg             792   0.0     
ref|XP_008656618.1|  PREDICTED: uncharacterized protein LOC103636036    787   0.0     
ref|XP_008374521.1|  PREDICTED: multiple C2 and transmembrane dom...    786   0.0     
ref|XP_002458061.1|  hypothetical protein SORBIDRAFT_03g026320          786   0.0     Sorghum bicolor [broomcorn]
ref|XP_009369348.1|  PREDICTED: multiple C2 and transmembrane dom...    785   0.0     
ref|XP_004969388.1|  PREDICTED: uncharacterized protein LOC101753534    778   0.0     
gb|EAZ38802.1|  hypothetical protein OsJ_23205                          777   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    766   0.0     
ref|XP_010933296.1|  PREDICTED: uncharacterized protein LOC105053703    774   0.0     
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           764   0.0     
ref|XP_008778481.1|  PREDICTED: uncharacterized protein LOC103698267    772   0.0     
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    763   0.0     
ref|XP_006850074.1|  hypothetical protein AMTR_s00022p00214560          761   0.0     
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    761   0.0     
gb|EYU35883.1|  hypothetical protein MIMGU_mgv1a000608mg                770   0.0     
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           760   0.0     
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200          759   0.0     Sorghum bicolor [broomcorn]
ref|XP_009412381.1|  PREDICTED: uncharacterized protein LOC103993884    769   0.0     
gb|EPS62334.1|  hypothetical protein M569_12455                         768   0.0     
ref|NP_001055351.1|  Os05g0370600                                       756   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           756   0.0     
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...    756   0.0     
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    752   0.0     
emb|CDP10110.1|  unnamed protein product                                751   0.0     
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...    751   0.0     
gb|AAD55273.1|AC008263_4  Similar to gb|D86180 phosphoribosylanth...    768   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KDP28646.1|  hypothetical protein JCGZ_14417                         759   0.0     
ref|XP_002978420.1|  hypothetical protein SELMODRAFT_109101             758   0.0     
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707    758   0.0     
ref|XP_002970262.1|  hypothetical protein SELMODRAFT_93870              757   0.0     
gb|KDO76051.1|  hypothetical protein CISIN_1g042999mg                   757   0.0     
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             748   0.0     
gb|ABR16393.1|  unknown                                                 748   0.0     Picea sitchensis
ref|NP_001043430.2|  Os01g0587300                                       758   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...    747   0.0     
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg                754   0.0     
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...    755   0.0     
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...    754   0.0     
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758    754   0.0     
ref|XP_011080971.1|  PREDICTED: uncharacterized protein LOC105164103    753   0.0     
gb|KDP24596.1|  hypothetical protein JCGZ_25512                         743   0.0     
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             743   0.0     Populus trichocarpa [western balsam poplar]
gb|EAY74728.1|  hypothetical protein OsI_02619                          754   0.0     Oryza sativa Indica Group [Indian rice]
ref|NP_001054305.1|  Os04g0683800                                       751   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...    743   0.0     
ref|XP_002986408.1|  hypothetical protein SELMODRAFT_123924             742   0.0     
ref|XP_004144665.1|  PREDICTED: uncharacterized protein LOC101203...    742   0.0     
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    750   0.0     
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    740   0.0     
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...    748   0.0     
ref|XP_006850085.1|  hypothetical protein AMTR_s00022p00218970          749   0.0     
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...    748   0.0     
ref|XP_002511838.1|  synaptotagmin, putative                            748   0.0     Ricinus communis
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           739   0.0     
emb|CDP08834.1|  unnamed protein product                                747   0.0     
dbj|BAK04937.1|  predicted protein                                      748   0.0     
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973    747   0.0     
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    738   0.0     
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166    747   0.0     
ref|XP_009626688.1|  PREDICTED: multiple C2 and transmembrane dom...    746   0.0     
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...    746   0.0     
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...    746   0.0     
ref|XP_009779007.1|  PREDICTED: multiple C2 and transmembrane dom...    745   0.0     
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...    746   0.0     
ref|XP_004244612.1|  PREDICTED: multiple C2 and transmembrane dom...    745   0.0     
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962    743   0.0     
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...    744   0.0     
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...    736   0.0     
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...    736   0.0     
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   735   0.0     
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...    744   0.0     
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...    744   0.0     
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    735   0.0     
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg             743   0.0     
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    735   0.0     
ref|NP_001168012.1|  uncharacterized protein LOC100381735               743   0.0     Zea mays [maize]
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             734   0.0     
ref|XP_006381053.1|  C2 domain-containing family protein                734   0.0     
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    734   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...    742   0.0     
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020    743   0.0     
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                   742   0.0     
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg             742   0.0     
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...    742   0.0     
ref|XP_010228332.1|  PREDICTED: uncharacterized protein LOC100828926    744   0.0     
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase        736   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDX86768.1|  BnaA09g21580D                                          741   0.0     
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                733   0.0     
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    733   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           733   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529567.1|  PREDICTED: multiple C2 and transmembrane dom...    741   0.0     
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    732   0.0     
ref|XP_010529565.1|  PREDICTED: multiple C2 and transmembrane dom...    741   0.0     
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681    740   0.0     
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257    740   0.0     
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1       740   0.0     
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             731   0.0     
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...    739   0.0     
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    731   0.0     
ref|XP_009108158.1|  PREDICTED: uncharacterized protein LOC103833855    739   0.0     
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg             739   0.0     
ref|XP_006352275.1|  PREDICTED: uncharacterized protein LOC102594579    739   0.0     
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...    739   0.0     
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    730   0.0     
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                730   0.0     
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                730   0.0     
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    730   0.0     
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...    739   0.0     
ref|XP_010231956.1|  PREDICTED: uncharacterized protein LOC100844...    740   0.0     
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                   738   0.0     
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
emb|CDP10108.1|  unnamed protein product                                730   0.0     
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_003566820.2|  PREDICTED: uncharacterized protein LOC100844...    740   0.0     
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880    738   0.0     
ref|XP_002298449.2|  C2 domain-containing family protein                739   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g             738   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg             737   0.0     
emb|CDX78498.1|  BnaA03g04100D                                          729   0.0     
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209    736   0.0     
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        729   0.0     
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_003611102.1|  Glutathione peroxidase                             737   0.0     
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...    737   0.0     
emb|CDX97214.1|  BnaC09g44110D                                          728   0.0     
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
emb|CDX98254.1|  BnaC06g16150D                                          728   0.0     
ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           728   0.0     
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368    729   0.0     
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    728   0.0     
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...    737   0.0     
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...    736   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ADT92187.1|  unknown                                                 737   0.0     
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
gb|EPS67145.1|  hypothetical protein M569_07629                         728   0.0     
emb|CAN75086.1|  hypothetical protein VITISV_010815                     728   0.0     Vitis vinifera
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg             736   0.0     
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    727   0.0     
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     Vitis vinifera
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           727   0.0     
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    727   0.0     
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             727   0.0     
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g             726   0.0     
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    726   0.0     
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             726   0.0     
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...    734   0.0     
emb|CDP09751.1|  unnamed protein product                                734   0.0     
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...    726   0.0     
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...    736   0.0     
emb|CDY68091.1|  BnaAnng26150D                                          725   0.0     
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...    735   0.0     
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...    726   0.0     
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...    734   0.0     
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B            734   0.0     
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751    734   0.0     
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656    733   0.0     
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...    725   0.0     
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...    725   0.0     
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
gb|KDP25449.1|  hypothetical protein JCGZ_20605                         733   0.0     
emb|CDX70485.1|  BnaC03g05690D                                          724   0.0     
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           724   0.0     
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             724   0.0     
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    728   0.0     
emb|CDX67712.1|  BnaA07g17520D                                          724   0.0     
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg             724   0.0     
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                   724   0.0     
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_002970275.1|  hypothetical protein SELMODRAFT_171388             722   0.0     
ref|XP_002878177.1|  C2 domain-containing protein                       723   0.0     
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    723   0.0     
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...    731   0.0     
ref|XP_009795430.1|  PREDICTED: multiple C2 and transmembrane dom...    734   0.0     
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...    733   0.0     
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    722   0.0     
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg             731   0.0     
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_009623389.1|  PREDICTED: uncharacterized protein LOC104114611    732   0.0     
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...    732   0.0     
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    721   0.0     
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
gb|KDP43429.1|  hypothetical protein JCGZ_16716                         730   0.0     
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                721   0.0     
ref|XP_007133848.1|  hypothetical protein PHAVU_011G214100g             724   0.0     
ref|XP_002513446.1|  synaptotagmin, putative                            720   0.0     
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    720   0.0     
ref|XP_006379108.1|  C2 domain-containing family protein                729   0.0     
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g             728   0.0     
ref|XP_004161406.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    730   0.0     
gb|KHN26368.1|  Multiple C2 and transmembrane domain-containing p...    718   0.0     
gb|ACN33768.1|  unknown                                                 717   0.0     
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479    732   0.0     
emb|CDY69710.1|  BnaAnng31280D                                          719   0.0     
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g             720   0.0     
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                    728   0.0     
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    719   0.0     
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726    728   0.0     
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885    719   0.0     
ref|XP_002297795.1|  C2 domain-containing family protein                719   0.0     
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_002978433.1|  hypothetical protein SELMODRAFT_109013             718   0.0     
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_001769977.1|  predicted protein                                  718   0.0     
ref|XP_002513191.1|  synaptotagmin, putative                            728   0.0     
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...    727   0.0     
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...    729   0.0     
ref|XP_002303582.2|  C2 domain-containing family protein                727   0.0     
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                    727   0.0     
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...    718   0.0     
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g             726   0.0     
gb|EYU35083.1|  hypothetical protein MIMGU_mgv1a025230mg                727   0.0     
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    718   0.0     
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...    728   0.0     
ref|XP_004138509.1|  PREDICTED: uncharacterized protein LOC101203632    727   0.0     
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    728   0.0     
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg             717   0.0     
ref|XP_004166328.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    726   0.0     
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       717   0.0     
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             717   0.0     
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           717   0.0     
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892    725   0.0     
ref|XP_001764582.1|  predicted protein                                  724   0.0     
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...    716   0.0     
ref|XP_002871539.1|  C2 domain-containing protein                       716   0.0     
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...    726   0.0     
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    726   0.0     
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724    724   0.0     
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...    716   0.0     
gb|EMT11702.1|  hypothetical protein F775_07618                         716   0.0     
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        716   0.0     
emb|CDP07723.1|  unnamed protein product                                726   0.0     
gb|EPS65173.1|  hypothetical protein M569_09603                         725   0.0     
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g             724   0.0     
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...    715   0.0     
gb|AES87259.2|  calcium-dependent lipid-binding (CaLB domain) fam...    728   0.0     
ref|XP_006592975.1|  PREDICTED: multiple C2 and transmembrane dom...    719   0.0     
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    715   0.0     
emb|CDY47660.1|  BnaC04g23970D                                          717   0.0     
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like           715   0.0     
ref|XP_003605062.1|  Phosphoribosyltransferase                          729   0.0     
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...    716   0.0     
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...    724   0.0     
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    715   0.0     
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187    715   0.0     
ref|XP_010266730.1|  PREDICTED: uncharacterized protein LOC104604169    723   0.0     
ref|XP_001780504.1|  predicted protein                                  713   0.0     
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1       722   0.0     
gb|EYU32100.1|  hypothetical protein MIMGU_mgv1a000762mg                722   0.0     
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g             715   0.0     
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             714   0.0     
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...    724   0.0     
ref|XP_004235089.1|  PREDICTED: multiple C2 and transmembrane dom...    714   0.0     
ref|XP_006366499.1|  PREDICTED: multiple C2 and transmembrane dom...    724   0.0     
ref|XP_006827676.1|  hypothetical protein AMTR_s00009p00255480          722   0.0     
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg             713   0.0     
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432    722   0.0     
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg                714   0.0     
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             713   0.0     
gb|AFN53655.1|  putative synaptotagmin protein                          713   0.0     
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...    714   0.0     
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg             723   0.0     
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg                713   0.0     
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       712   0.0     
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    721   0.0     
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    712   0.0     
gb|KDP24593.1|  hypothetical protein JCGZ_25509                         712   0.0     
emb|CAN79812.1|  hypothetical protein VITISV_018822                     721   0.0     
ref|XP_009399655.1|  PREDICTED: multiple C2 and transmembrane dom...    712   0.0     
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...    721   0.0     
ref|XP_011092017.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    720   0.0     
ref|XP_006375921.1|  C2 domain-containing family protein                719   0.0     
ref|XP_007133849.1|  hypothetical protein PHAVU_011G214100g             724   0.0     
ref|XP_006408277.1|  hypothetical protein EUTSA_v10019972mg             720   0.0     
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    711   0.0     
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    711   0.0     
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    712   0.0     
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg             720   0.0     
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...    712   0.0     
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...    711   0.0     
ref|XP_010672179.1|  PREDICTED: multiple C2 and transmembrane dom...    718   0.0     
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg             711   0.0     
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...    711   0.0     
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B               711   0.0     
gb|KDP20200.1|  hypothetical protein JCGZ_07920                         709   0.0     
gb|KHN29203.1|  Putative Ras GTPase-activating protein 4B               709   0.0     
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    709   0.0     
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                   718   0.0     
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...    723   0.0     
ref|XP_010558697.1|  PREDICTED: uncharacterized protein LOC104827...    717   0.0     
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268    717   0.0     
ref|XP_010513337.1|  PREDICTED: uncharacterized protein LOC104789294    717   0.0     
ref|NP_568175.2|  FT-interacting protein 1                              709   0.0     
ref|XP_010558695.1|  PREDICTED: uncharacterized protein LOC104827...    717   0.0     
ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    708   0.0     
ref|XP_004298740.1|  PREDICTED: uncharacterized protein LOC101313...    716   0.0     
ref|XP_003550034.1|  PREDICTED: uncharacterized protein LOC100783437    715   0.0     
ref|XP_003539651.1|  PREDICTED: multiple C2 and transmembrane dom...    722   0.0     
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    707   0.0     
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...    721   0.0     
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             707   0.0     
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897    716   0.0     
ref|XP_008782890.1|  PREDICTED: multiple C2 and transmembrane dom...    707   0.0     
ref|XP_010485716.1|  PREDICTED: uncharacterized protein LOC104763...    716   0.0     
ref|XP_002894324.1|  C2 domain-containing protein                       706   0.0     
emb|CDY21171.1|  BnaA01g34020D                                          715   0.0     
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...    707   0.0     
ref|XP_011034256.1|  PREDICTED: uncharacterized protein LOC105132448    714   0.0     
ref|XP_001780482.1|  predicted protein                                  706   0.0     
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...    706   0.0     
ref|XP_002532394.1|  synaptotagmin, putative                            706   0.0     
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    706   0.0     
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616             706   0.0     
ref|XP_003599053.1|  Glutathione peroxidase                             707   0.0     
ref|XP_010463827.1|  PREDICTED: uncharacterized protein LOC104744465    714   0.0     
ref|XP_006296890.1|  hypothetical protein CARUB_v10012883mg             714   0.0     
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...    706   0.0     
gb|EPS58331.1|  hypothetical protein M569_16484                         712   0.0     
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like           706   0.0     
ref|XP_009102068.1|  PREDICTED: uncharacterized protein LOC103828206    714   0.0     
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...    706   0.0     
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...    705   0.0     
gb|KEH18888.1|  calcium-dependent lipid-binding (CaLB domain) fam...    712   0.0     
ref|XP_002276331.1|  PREDICTED: uncharacterized protein LOC100253604    712   0.0     
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg             705   0.0     
emb|CDY29951.1|  BnaC01g40570D                                          713   0.0     
emb|CAN63720.1|  hypothetical protein VITISV_009775                     711   0.0     
ref|XP_009798416.1|  PREDICTED: multiple C2 and transmembrane dom...    712   0.0     
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    704   0.0     
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...    704   0.0     
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg             704   0.0     
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...    704   0.0     
ref|XP_011079121.1|  PREDICTED: uncharacterized protein LOC105162719    711   0.0     
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    702   0.0     
ref|XP_010557779.1|  PREDICTED: extended synaptotagmin-1                712   0.0     
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    712   0.0     
gb|KHN28751.1|  Multiple C2 and transmembrane domain-containing p...    701   0.0     
ref|XP_002882301.1|  C2 domain-containing protein                       711   0.0     
ref|XP_003524663.1|  PREDICTED: multiple C2 and transmembrane dom...    709   0.0     
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           702   0.0     
ref|XP_006842117.1|  hypothetical protein AMTR_s00078p00102770          713   0.0     
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...    702   0.0     
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...    702   0.0     
ref|XP_008442044.1|  PREDICTED: uncharacterized protein LOC103486025    709   0.0     
gb|KFK37796.1|  hypothetical protein AALP_AA3G030500                    709   0.0     
ref|NP_187018.1|  C2 and plant phosphoribosyltransferase domain-c...    709   0.0     
ref|XP_006375920.1|  C2 domain-containing family protein                708   0.0     
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    700   0.0     
emb|CDX86328.1|  BnaA06g30450D                                          709   0.0     
ref|XP_004228591.1|  PREDICTED: uncharacterized protein LOC101263238    708   0.0     
ref|XP_009596255.1|  PREDICTED: multiple C2 and transmembrane dom...    707   0.0     
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...    699   0.0     
ref|XP_006348476.1|  PREDICTED: uncharacterized protein LOC102581084    707   0.0     
ref|XP_002525677.1|  conserved hypothetical protein                     706   0.0     
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g             699   0.0     
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...    698   0.0     
ref|XP_006395220.1|  hypothetical protein EUTSA_v10003567mg             707   0.0     
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...    697   0.0     
ref|XP_004489649.1|  PREDICTED: uncharacterized protein LOC101490761    704   0.0     
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...    697   0.0     
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    696   0.0     
ref|XP_004229889.1|  PREDICTED: multiple C2 and transmembrane dom...    704   0.0     
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...    697   0.0     
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    696   0.0     
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...    697   0.0     
ref|XP_010036262.1|  PREDICTED: uncharacterized protein LOC104425302    703   0.0     
ref|XP_009151609.1|  PREDICTED: uncharacterized protein LOC103874926    705   0.0     
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...    696   0.0     
ref|XP_006826321.1|  hypothetical protein AMTR_s00004p00091660          702   0.0     
ref|XP_009782245.1|  PREDICTED: uncharacterized protein LOC104231022    703   0.0     
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...    695   0.0     
ref|XP_004287676.1|  PREDICTED: uncharacterized protein LOC101308411    702   0.0     
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...    694   0.0     
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...    694   0.0     
ref|XP_001783740.1|  predicted protein                                  693   0.0     
ref|NP_001152102.1|  phosphoribosylanthranilate transferase             693   0.0     
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...    692   0.0     
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    692   0.0     
ref|XP_006279938.1|  hypothetical protein CARUB_v10025796mg             702   0.0     
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104    692   0.0     
ref|XP_006339547.1|  PREDICTED: multiple C2 and transmembrane dom...    700   0.0     
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g             692   0.0     



>ref|XP_004229283.1| PREDICTED: uncharacterized protein LOC101268027 [Solanum lycopersicum]
Length=992

 Score =  1459 bits (3777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 760/1002 (76%), Positives = 855/1002 (85%), Gaps = 19/1002 (2%)
 Frame = +2

Query  137   MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
             MGT RKL+VEV EARNLLPKDGHG SSPYVV+DFYGQR+KTR V RDL+PQWNE+LEFN+
Sbjct  1     MGTVRKLVVEVTEARNLLPKDGHGTSSPYVVVDFYGQRRKTRPVTRDLSPQWNEVLEFNV  60

Query  317   SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              K SD+FGDMLELDVYHDK++GPTTRNNFLGR++L+ATQFVKKGEEALIYYPLE+K   S
Sbjct  61    GKPSDVFGDMLELDVYHDKSIGPTTRNNFLGRIRLSATQFVKKGEEALIYYPLEKKYWFS  120

Query  497   WIQGDIGLKIYFVDetvpppppppeteppaeakpgevaaaepppakaegtpegegkegpp  676
             WI G+IGLKIYFV++ + P   P   + P   +P E A     P   E  P  +  E P 
Sbjct  121   WISGEIGLKIYFVEQLLVPEVKPEPKQAPPADQPTEAAPEGEKPNSIEEEPPAQVVENPT  180

Query  677   vpenppaqeeSKDPVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGL---VGPKPLSRT  847
               E  P   E+++P     +    D   ++K SV+  S+PEVK+   +    GP+P+SR 
Sbjct  181   TGEAEPPANEAENPTSVLMDPPQADEITQVKRSVSLGSIPEVKVSNNINIVTGPRPISRA  240

Query  848   PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisR  1027
                SS +   +    +E SSFDLVEKMHYLFV++VKARSLPT G PVVK+VVSGSHV+S+
Sbjct  241   ---SSAIFSDAGSGPIEPSSFDLVEKMHYLFVRVVKARSLPTVGCPVVKMVVSGSHVLSK  297

Query  1028  PARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVS  1207
             PARKT+LFEWDQTFAFGRDAPDSSS+LE+SVWDP S+KS DPTSD AGH FLGGICFDVS
Sbjct  298   PARKTVLFEWDQTFAFGRDAPDSSSLLEVSVWDPSSAKSFDPTSDEAGHVFLGGICFDVS  357

Query  1208  EIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSK  1387
             EIPLRDPPDS LAPQWYRLEGGGAH+GDLMLATWVGTQAD+SFP+AWKTDTA NP S+SK
Sbjct  358   EIPLRDPPDSSLAPQWYRLEGGGAHRGDLMLATWVGTQADDSFPEAWKTDTADNPASKSK  417

Query  1388  VYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKP-ASSATGSPSWNE  1564
             VYQSPKLWYLRSSVIEAQDI    + SK+SS+ IKAQLGFQVQKTK   ++ TGS SWNE
Sbjct  418   VYQSPKLWYLRSSVIEAQDI----SHSKDSSYHIKAQLGFQVQKTKSITTTTTGSQSWNE  473

Query  1565  DLVFVAAEPFTEHYLLFFLIE-HLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             DLVFVAAEPFTE++LLFFLIE     KEQ VL VASIPL +IERRVDDR+V SRWFTFED
Sbjct  474   DLVFVAAEPFTENHLLFFLIETDRTAKEQTVLAVASIPLPTIERRVDDRKVASRWFTFED  533

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
              NEEKR+YKGRVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWK P+GTVELGIIGCKNL
Sbjct  534   PNEEKRIYKGRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKAPIGTVELGIIGCKNL  593

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             LPMK   GKGSTDAYAVAKYG+KWVRTRTISD+L PRWNEQYTWRVYDPSTV+TIGVFD 
Sbjct  594   LPMK---GKGSTDAYAVAKYGNKWVRTRTISDSLEPRWNEQYTWRVYDPSTVLTIGVFDG  650

Query  2102  WEVIDPENSK----DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
                +  E+ +    D R+GKVR+RISTL TGKVYRNTF L+LLS  GLKKMGEIELAVRF
Sbjct  651   CSEVAFESDECMRPDFRIGKVRVRISTLTTGKVYRNTFPLLLLSQTGLKKMGEIELAVRF  710

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
             IR+TPTLDFLHVYSQP+LP+MHH++PLG VQQ+SLR AAVK++ +HL+RSEPPLRREVV 
Sbjct  711   IRATPTLDFLHVYSQPLLPMMHHVKPLGMVQQDSLRIAAVKIVASHLTRSEPPLRREVVT  770

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSHSFSMRKVRANWFRIINVIA VID+VKW DDTR W+NPTAT+LVHALLV+LVW
Sbjct  771   YMLDADSHSFSMRKVRANWFRIINVIAGVIDIVKWVDDTRGWKNPTATLLVHALLVMLVW  830

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             FPDLIIPTFAFYVF+IGAWNYRFRSRD L HFD KISLAES+DRDELDEEFDA+PCTRPN
Sbjct  831   FPDLIIPTFAFYVFVIGAWNYRFRSRDTLPHFDPKISLAESLDRDELDEEFDAMPCTRPN  890

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             ++VRARYDKLRMLG RVQT+LGD ATQGERVQALVTWRDPRATGIFI LCFVVAFILYLV
Sbjct  891   ELVRARYDKLRMLGERVQTILGDFATQGERVQALVTWRDPRATGIFIGLCFVVAFILYLV  950

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             PSKM++MAFGFYYLRHP+FRDRMPSPALNFFRRLPSL+DRML
Sbjct  951   PSKMVSMAFGFYYLRHPIFRDRMPSPALNFFRRLPSLSDRML  992



>ref|XP_009757161.1| PREDICTED: uncharacterized protein LOC104210059 [Nicotiana sylvestris]
Length=1029

 Score =  1326 bits (3432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/808 (82%), Positives = 736/808 (91%), Gaps = 11/808 (1%)
 Frame = +2

Query  713   DPVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsA  892
             DP    P Q  +D    MK S++  S+PEVK+   + GP+P+SR  SVSSFVS+ +   +
Sbjct  226   DPPAELPAQ--SDNFEHMKRSISLGSVPEVKLSN-ITGPRPISRASSVSSFVSEAASDRS  282

Query  893   --MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
               +ERS+FDLVEKMHYLFV++VKARSLPT   PVVK+ VSGSHV+S+PARKT+LFEWDQT
Sbjct  283   GPIERSTFDLVEKMHYLFVRVVKARSLPTVSSPVVKIAVSGSHVVSKPARKTVLFEWDQT  342

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAFGRDAPDSSS+LE+SVWDPLS+KS DPTSDVAGH FLGGICFDVSEIPLRDPPDSPLA
Sbjct  343   FAFGRDAPDSSSLLEVSVWDPLSAKSFDPTSDVAGHVFLGGICFDVSEIPLRDPPDSPLA  402

Query  1247  PQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSS  1426
             PQWYRLEGGGAH+GDLMLATWVGTQADESFP+AWKTDTAGNP+S+SKVYQSPKLWYLRSS
Sbjct  403   PQWYRLEGGGAHRGDLMLATWVGTQADESFPEAWKTDTAGNPSSKSKVYQSPKLWYLRSS  462

Query  1427  VIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHY  1606
             VIEAQDI  LT  SKESS+QIKAQLGFQVQKTK  ++ TGSPSWNEDLVFVAAEPFTEHY
Sbjct  463   VIEAQDISQLTH-SKESSYQIKAQLGFQVQKTKFITTTTGSPSWNEDLVFVAAEPFTEHY  521

Query  1607  LLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLR  1786
             LL FLIE  PPKEQ VL VASIPL++IERRVDDR+V SRWFTFED NEEKRVYKGRVHLR
Sbjct  522   LLIFLIETRPPKEQTVLAVASIPLTTIERRVDDRKVASRWFTFEDPNEEKRVYKGRVHLR  581

Query  1787  LCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAY  1966
             LCFDGGYHV++EAAH+CSDYRPTARQLWK P+GTVELGIIGCKNLLPMKT++GKG TDAY
Sbjct  582   LCFDGGYHVMDEAAHVCSDYRPTARQLWKQPIGTVELGIIGCKNLLPMKTIKGKGYTDAY  641

Query  1967  AVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----  2131
             AVAKYGSKW+RTRTISD+L PRWNEQYTWRVYDPSTV+TIGVFD WEV + +  K     
Sbjct  642   AVAKYGSKWIRTRTISDSLEPRWNEQYTWRVYDPSTVLTIGVFDCWEVFESDGCKESMRP  701

Query  2132  DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYS  2311
             D R+GKVR+RISTL TGKVY+NTF L+LLSPAGLKKMGEIELAVRFIR+TPTLDFLHVYS
Sbjct  702   DFRIGKVRVRISTLTTGKVYKNTFPLLLLSPAGLKKMGEIELAVRFIRATPTLDFLHVYS  761

Query  2312  QPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRK  2491
             QP+LP+MHH++PLG VQQESLRTAAVK++ +HL+RSEPPLRREVV YMLDADSHSFSMRK
Sbjct  762   QPLLPMMHHVKPLGMVQQESLRTAAVKIVASHLTRSEPPLRREVVTYMLDADSHSFSMRK  821

Query  2492  VRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVF  2671
             VRANWFR+INVIA VID+VKW DDTR W+NPTAT+LVHALLV+LVWFPDLIIPTFAFYVF
Sbjct  822   VRANWFRVINVIAGVIDIVKWIDDTRGWKNPTATLLVHALLVMLVWFPDLIIPTFAFYVF  881

Query  2672  MIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLG  2851
             +IGAWNYRFRSRD L HFDTKISLAES+DRDELDEEFDA+PCTRPN++VRARYDKLRMLG
Sbjct  882   VIGAWNYRFRSRDTLPHFDTKISLAESLDRDELDEEFDALPCTRPNELVRARYDKLRMLG  941

Query  2852  ARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYL  3031
             ARVQT+LGD ATQGERVQALVTWRDPRATGIFI LCFVVAFILYLVPSKM+AMAFGFYYL
Sbjct  942   ARVQTILGDFATQGERVQALVTWRDPRATGIFIGLCFVVAFILYLVPSKMVAMAFGFYYL  1001

Query  3032  RHPLFRDRMPSPALNFFRRLPSLADRML  3115
             RHP+FRDRMPSPALNFFRRLPSL+DRML
Sbjct  1002  RHPIFRDRMPSPALNFFRRLPSLSDRML  1029


 Score =   230 bits (586),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT RKLIVEVI+ARNLLPKDGHG SSPYVV DFYGQR+KTRTV+RDL+P WNEMLEF++
Sbjct  1    MGTVRKLIVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRTVIRDLSPVWNEMLEFSV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGD+LELDV+HDK +GPTTRNNFLGRVKL+A QFVKKGEEALIYYPLE+K   S
Sbjct  61   GKPSDVFGDVLELDVFHDKFIGPTTRNNFLGRVKLSAKQFVKKGEEALIYYPLEKKYWFS  120

Query  497  WIQGDIGLKIYF  532
            WI G+IGLKIYF
Sbjct  121  WISGEIGLKIYF  132



>ref|XP_009628258.1| PREDICTED: uncharacterized protein LOC104118664 [Nicotiana tomentosiformis]
Length=1029

 Score =  1318 bits (3411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/807 (82%), Positives = 735/807 (91%), Gaps = 10/807 (1%)
 Frame = +2

Query  719   VDPSPEQLVNDGAVE-MKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsA-  892
             +DP  E  V     E MK SV+  S+PEVK+   + GP+P+SR  SVSSFVS+ +   + 
Sbjct  225   MDPPAELPVQSDDFEHMKRSVSLGSVPEVKLSN-ITGPRPISRASSVSSFVSEAASDRSG  283

Query  893   -MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
              +ERS+FDLVEKMHYLFV++VKARSLPT G PVVK+ VSGSHV+S+PARKT+LFEWDQTF
Sbjct  284   PIERSTFDLVEKMHYLFVRVVKARSLPTVGSPVVKIAVSGSHVVSKPARKTVLFEWDQTF  343

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AFGRDAPDSSS+LE+SVWDPL++KS DPTSDVAGH FLGGICFDVSEIPLRDPPDSPLAP
Sbjct  344   AFGRDAPDSSSLLEVSVWDPLNTKSFDPTSDVAGHVFLGGICFDVSEIPLRDPPDSPLAP  403

Query  1250  QWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSV  1429
             QWYRLEGGGAH+GDLMLATWVGTQADESFP+AWKTDTAGNP+S+SKVYQSPKLWYLRSSV
Sbjct  404   QWYRLEGGGAHRGDLMLATWVGTQADESFPEAWKTDTAGNPSSKSKVYQSPKLWYLRSSV  463

Query  1430  IEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYL  1609
             IEAQDI  LT  SKESS+QIKAQLGFQVQKTK  ++ TGSPSWNEDLVFVAAEPFTEHYL
Sbjct  464   IEAQDISQLTH-SKESSYQIKAQLGFQVQKTKFITTTTGSPSWNEDLVFVAAEPFTEHYL  522

Query  1610  LFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRL  1789
             L FLIE   PKEQ VL VASIPL++IERRVDDR+V SRWFTFED NEEKRVYKGRVHLRL
Sbjct  523   LIFLIETRHPKEQTVLAVASIPLTTIERRVDDRKVASRWFTFEDPNEEKRVYKGRVHLRL  582

Query  1790  CFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYA  1969
             CFDGGYHV++EAAH+CSDYRPTARQLWK P+GTVELGIIGCKNLLPMKT++GKGSTDAY 
Sbjct  583   CFDGGYHVMDEAAHVCSDYRPTARQLWKQPIGTVELGIIGCKNLLPMKTIKGKGSTDAYT  642

Query  1970  VAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----D  2134
             VAKYGSKWVRTRTISD+L PRWNEQYTWRVYDPSTV+TIGVFD WEV + +  K     D
Sbjct  643   VAKYGSKWVRTRTISDSLEPRWNEQYTWRVYDPSTVLTIGVFDCWEVFESDGCKESMRPD  702

Query  2135  VRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQ  2314
              R+GKVR+RISTL TGKVY+NTF L++LSPAGLKKMGEIELAVRFIR+TPTLDFLHVYSQ
Sbjct  703   FRIGKVRVRISTLTTGKVYKNTFPLLMLSPAGLKKMGEIELAVRFIRATPTLDFLHVYSQ  762

Query  2315  PMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKV  2494
             P+LP+MHH++PLG VQQESLRTAAVK++ +HL+RSEPPLRREVV YMLDADSHSFSMRKV
Sbjct  763   PLLPMMHHVKPLGMVQQESLRTAAVKIVASHLTRSEPPLRREVVTYMLDADSHSFSMRKV  822

Query  2495  RANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFM  2674
             RANWFRIINVIA VID+VKW DDTR W+NPTAT+LVHALLV+LVWFPDLIIPTFAFYVF+
Sbjct  823   RANWFRIINVIAGVIDIVKWIDDTRGWKNPTATLLVHALLVMLVWFPDLIIPTFAFYVFV  882

Query  2675  IGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGA  2854
             IGAWNYRFRSRD L HFD KISLAES+DRDELDEEFDA+PCTRPN++V+ARYDKLRMLGA
Sbjct  883   IGAWNYRFRSRDTLPHFDPKISLAESLDRDELDEEFDALPCTRPNELVQARYDKLRMLGA  942

Query  2855  RVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLR  3034
             RVQT+LGD ATQGERVQALVTWRDP+ATGIFI LCFVVAFILYLVPSKM+AMAFGFYYLR
Sbjct  943   RVQTILGDFATQGERVQALVTWRDPQATGIFIGLCFVVAFILYLVPSKMVAMAFGFYYLR  1002

Query  3035  HPLFRDRMPSPALNFFRRLPSLADRML  3115
             HP+FRDRMPSPALNFFRRLPSL+DRML
Sbjct  1003  HPIFRDRMPSPALNFFRRLPSLSDRML  1029


 Score =   231 bits (588),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT RKL+VEVI+ARNLLPKDGHG SSPYVV DFYGQR+KTR V+RDL+P WNEMLEFN+
Sbjct  1    MGTVRKLVVEVIDARNLLPKDGHGTSSPYVVADFYGQRRKTRAVIRDLSPVWNEMLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGDMLELDV+HDK +GPTTRNNFLGRVKL+A QFVKKGEEALIYYPLE+K   S
Sbjct  61   GKPSDVFGDMLELDVFHDKFIGPTTRNNFLGRVKLSARQFVKKGEEALIYYPLEKKYWFS  120

Query  497  WIQGDIGLKIYF  532
            WI G+IGLKIYF
Sbjct  121  WISGEIGLKIYF  132



>emb|CDP10533.1| unnamed protein product [Coffea canephora]
Length=1067

 Score =  1271 bits (3289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/809 (81%), Positives = 724/809 (89%), Gaps = 10/809 (1%)
 Frame = +2

Query  713   DPVDPSPEQLV--NDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdr  886
             DPVD SP+Q V  ++G   M ASVA+ SM EVKI   + GP+P+SR  SVSSF+SD SDR
Sbjct  261   DPVDLSPQQPVQLDNGLDHMMASVASGSMAEVKINN-VNGPQPISRVSSVSSFLSDASDR  319

Query  887   sAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S +ERSSFDLVEKMHYLFV++VKARSLPT GRPVVK+VVSG H+IS+PARKT LFEWDQT
Sbjct  320   STIERSSFDLVEKMHYLFVRVVKARSLPTMGRPVVKIVVSGCHIISKPARKTTLFEWDQT  379

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RDAPD SSILEISVWDP+ + S   ++DVAGHNFLGGICFDVSEIPLRDPPDSPLA
Sbjct  380   FAFSRDAPDCSSILEISVWDPIHAMSGGGSADVAGHNFLGGICFDVSEIPLRDPPDSPLA  439

Query  1247  PQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSS  1426
             PQWYRLEGGGAHKGDLMLATWVGTQADESFP+AWKTDTAGNP S+SKVYQSPKLWYLRS+
Sbjct  440   PQWYRLEGGGAHKGDLMLATWVGTQADESFPEAWKTDTAGNPNSKSKVYQSPKLWYLRST  499

Query  1427  VIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHY  1606
             +IEAQDIF L + SKESSFQ+K QLGFQVQKTK + S+ GSPSWNEDLVFVAAEPFTEH 
Sbjct  500   IIEAQDIFPLMS-SKESSFQVKVQLGFQVQKTKSSVSSNGSPSWNEDLVFVAAEPFTEHP  558

Query  1607  LLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLR  1786
             L+F LIE+  PKEQ +LGVASIPL+SIERRVDDR V+SRW T ED  E KR YKGRVHL+
Sbjct  559   LMFSLIENRQPKEQVMLGVASIPLASIERRVDDRNVVSRWLTLEDPKEAKRAYKGRVHLK  618

Query  1787  LCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAY  1966
             LCFDGGYHV++EAAH+CSDYRPTARQLWKPP+GTVELG+IGC+NLLPMKT++GKGSTDAY
Sbjct  619   LCFDGGYHVMDEAAHVCSDYRPTARQLWKPPIGTVELGVIGCRNLLPMKTIKGKGSTDAY  678

Query  1967  AVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----  2131
             AVAKYGSKWVRTRTISD+L P+WNEQYTWRVYDPSTV+TIGVFDSWEV++ + SK     
Sbjct  679   AVAKYGSKWVRTRTISDSLDPKWNEQYTWRVYDPSTVLTIGVFDSWEVLESDGSKESMRP  738

Query  2132  DVRMGKVRIRISTLATGKVYRNTFSLILLSP-AGLKKMGEIELAVRFIRSTPTLDFLHVY  2308
             D R+GKVRIRISTL TGKVYRNTF L LLS  +GLKKMGEIELAVRF R+TPTLDFLHVY
Sbjct  739   DFRIGKVRIRISTLGTGKVYRNTFPLFLLSNNSGLKKMGEIELAVRFARATPTLDFLHVY  798

Query  2309  SQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMR  2488
             SQP+LP+MHH +PLG VQQE LRT AVK++  HLSRSEPPLRREVV YMLDADSH+FSMR
Sbjct  799   SQPLLPMMHHTKPLGMVQQEVLRTTAVKMVAAHLSRSEPPLRREVVTYMLDADSHAFSMR  858

Query  2489  KVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYV  2668
             KVRANWFRIINVIA V DVVKW DDTR+W+NPTATILVHALLV+LVWFPDLI+PTFAFYV
Sbjct  859   KVRANWFRIINVIAGVTDVVKWLDDTRSWKNPTATILVHALLVMLVWFPDLIVPTFAFYV  918

Query  2669  FMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRML  2848
             F++GAWNYR R RD L HFD K+SLAESIDRDE+DEEFDA+PC R N++VRARYDKLRML
Sbjct  919   FVVGAWNYRVRPRDSLPHFDPKLSLAESIDRDEVDEEFDAMPCARANEVVRARYDKLRML  978

Query  2849  GARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYY  3028
             GARVQT+LGD ATQGER+QALV WRDPRATGIFI LCF V+FIL LVPSKMIAMAFGFYY
Sbjct  979   GARVQTVLGDFATQGERLQALVAWRDPRATGIFIGLCFGVSFILCLVPSKMIAMAFGFYY  1038

Query  3029  LRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LRHP+FRDRMPSPALNFFRRLPSL+DRML
Sbjct  1039  LRHPIFRDRMPSPALNFFRRLPSLSDRML  1067


 Score =   229 bits (584),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT RKLIVEV++ARNL PKDGHG  SPYV++DFYGQRKKTRTV+RDLNP WNE LEFN+
Sbjct  1    MGTVRKLIVEVVDARNLPPKDGHGTCSPYVILDFYGQRKKTRTVIRDLNPAWNETLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+ GDMLEL++YHD+ VGPTTRN+FLGR+KL++ QFV+KGEEALIYYPLE+K L S
Sbjct  61   GKPSDVLGDMLELEMYHDRKVGPTTRNHFLGRLKLSSRQFVRKGEEALIYYPLEKKTLFS  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIYF D
Sbjct  121  WIQGEIGLKIYFAD  134



>ref|XP_011094527.1| PREDICTED: uncharacterized protein LOC105174198 [Sesamum indicum]
Length=1010

 Score =  1270 bits (3287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/808 (79%), Positives = 724/808 (90%), Gaps = 11/808 (1%)
 Frame = +2

Query  719   VDPSP--EQLVNDGAV--EMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdr  886
             VDP+P  E++   G    ++ ASV++  +PEVK+   + GP+P+SR  SVSSF+SD SDR
Sbjct  205   VDPAPHVEEIPPGGQNPDQVMASVSSRFVPEVKVNN-INGPQPISRVSSVSSFMSDQSDR  263

Query  887   sAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S MERSSFDLVEKMHYLFV++VKARSLPTAG PVVK+ VSGSHVIS+PARKT+ FEWDQT
Sbjct  264   STMERSSFDLVEKMHYLFVRVVKARSLPTAGSPVVKIAVSGSHVISKPARKTIFFEWDQT  323

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD+PDSS ILE+SVWDPLS+ S  PT+DVAGH+FLGGICFDV EIPLRDPPDSPLA
Sbjct  324   FAFNRDSPDSSPILEVSVWDPLSAISFGPTNDVAGHDFLGGICFDVGEIPLRDPPDSPLA  383

Query  1247  PQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSS  1426
             PQWYRLEGGGAH+GDLMLATW+GTQADESFPDAWKTDT GNP SRSKVYQSPKLWYLRS+
Sbjct  384   PQWYRLEGGGAHRGDLMLATWIGTQADESFPDAWKTDTTGNPNSRSKVYQSPKLWYLRST  443

Query  1427  VIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHY  1606
             VIEAQDI ++  P KESSFQ+K QLGFQVQKTK   ++ G+PSW+EDL+FVAAEPFTEH 
Sbjct  444   VIEAQDI-SMLIPLKESSFQVKVQLGFQVQKTKSVLTSAGAPSWSEDLMFVAAEPFTEHN  502

Query  1607  LLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLR  1786
             L+FFLIE+  PKEQ ++GVA +PL+SIERRVDDR V SRWFT ED NEEKRVY+GRVHLR
Sbjct  503   LIFFLIENRSPKEQIIVGVARVPLTSIERRVDDRNVASRWFTLEDPNEEKRVYRGRVHLR  562

Query  1787  LCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAY  1966
             LCFDGGYHV++E AH+CSDYRPTARQLWKP VGTVELGIIGCKNLLPMKT++GKGSTDAY
Sbjct  563   LCFDGGYHVMDEGAHVCSDYRPTARQLWKPAVGTVELGIIGCKNLLPMKTIKGKGSTDAY  622

Query  1967  AVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----  2131
             AVAKYG+KWVRTRTISD+L P+WNEQYTWRVYDPSTV+T+GVFDSWEV + +  K     
Sbjct  623   AVAKYGNKWVRTRTISDSLDPKWNEQYTWRVYDPSTVLTVGVFDSWEVFESDGCKESVRP  682

Query  2132  DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYS  2311
             D R+GKVRIRISTLATGKVYR+ F L+LLS AGLKKMGEIELAVRF R+TPTLDFLHVYS
Sbjct  683   DFRVGKVRIRISTLATGKVYRSVFPLLLLSQAGLKKMGEIELAVRFARATPTLDFLHVYS  742

Query  2312  QPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRK  2491
             QP+LP+MHH++PLG VQQE+LR  AVK+++ HLSRSEPPLRREVV Y+LDADS++FSMRK
Sbjct  743   QPLLPMMHHLKPLGMVQQEALRAIAVKIVSAHLSRSEPPLRREVVTYVLDADSNTFSMRK  802

Query  2492  VRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVF  2671
             VRANW RIINVIA ++DV KW D+TR+W+NPTATILVHALLV+LVWFPDLIIPT AFY+F
Sbjct  803   VRANWLRIINVIAGLLDVFKWVDETRSWKNPTATILVHALLVMLVWFPDLIIPTLAFYIF  862

Query  2672  MIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLG  2851
             ++GAWNYRFRSR  L HFD K+SLAESIDRDELDEEFDA+PCTRPN+ VRARYDKLRMLG
Sbjct  863   VVGAWNYRFRSRTTLPHFDPKMSLAESIDRDELDEEFDAMPCTRPNETVRARYDKLRMLG  922

Query  2852  ARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYL  3031
             ARVQT+LGD ATQGER+QALVTWRDPRATGIF+ LC VVAFILYLVPSKM+AMAFGFYYL
Sbjct  923   ARVQTVLGDFATQGERMQALVTWRDPRATGIFVGLCLVVAFILYLVPSKMVAMAFGFYYL  982

Query  3032  RHPLFRDRMPSPALNFFRRLPSLADRML  3115
             RHP+FRDRMPSPALNFFRRLPSL+DRML
Sbjct  983   RHPIFRDRMPSPALNFFRRLPSLSDRML  1010


 Score =   189 bits (480),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 105/134 (78%), Gaps = 22/134 (16%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   RKLIVEV++ARNL PKDGHGASSPYV++DF+GQR+KTRTV+RDLNP          
Sbjct  1    MAVVRKLIVEVVDARNLSPKDGHGASSPYVILDFHGQRRKTRTVIRDLNP----------  50

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
                        LDV+HDKNVGPTTRNNFLGRVKL++ QFVKKGEEALIYYPLE+K+  S
Sbjct  51   ------------LDVFHDKNVGPTTRNNFLGRVKLSSRQFVKKGEEALIYYPLEKKSFFS  98

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIYFVD
Sbjct  99   WIQGEIGLKIYFVD  112



>ref|XP_006344598.1| PREDICTED: uncharacterized protein LOC102579397 [Solanum tuberosum]
Length=1020

 Score =  1258 bits (3254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/793 (80%), Positives = 708/793 (89%), Gaps = 15/793 (2%)
 Frame = +2

Query  764   MKASVATASMPEVKIGGGL---VGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHY  934
             MK SV+  S+PEVK+   +    GP+P+SR    SS +   +    +E SSFDLVEKMHY
Sbjct  234   MKRSVSLGSIPEVKVSNNINIVTGPRPISRA---SSVIFSDAGSGPIEPSSFDLVEKMHY  290

Query  935   LFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEI  1114
             LFV++VKA+SLPT   PVVK+VVSGSHV+S+PARKT+LFEWDQTFAFGRDAPDSSS+LE+
Sbjct  291   LFVRVVKAQSLPTVDCPVVKIVVSGSHVVSKPARKTVLFEWDQTFAFGRDAPDSSSLLEV  350

Query  1115  SVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDL  1294
             SVWDP S+KS DPTSDVAGH FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH+GDL
Sbjct  351   SVWDPSSAKSFDPTSDVAGHVFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHRGDL  410

Query  1295  MLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKE  1474
             MLATWVGTQAD+SFP+AWKTDTAGNP S+SKVYQSPKLWYLRSSVIEAQDI  LT  SKE
Sbjct  411   MLATWVGTQADDSFPEAWKTDTAGNPASKSKVYQSPKLWYLRSSVIEAQDISQLTHNSKE  470

Query  1475  SSFQIKAQLGFQVQKTKPA-SSATGSPSWNEDLVFVAAEPFTEHYLLFFLIE-HLPPKEQ  1648
             SS+ IKAQLG QVQKTK   +++ GSPSWNEDLVFVAAEPFTEH LLFFLIE     K+Q
Sbjct  471   SSYHIKAQLGLQVQKTKSIPTTSIGSPSWNEDLVFVAAEPFTEHCLLFFLIETDRTAKDQ  530

Query  1649  AVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAA  1828
              VL VASIPL++IERRVDDR+V SRWFTFED NEE+R+YKGRVHLRLCFDGGYHV++EAA
Sbjct  531   TVLAVASIPLTTIERRVDDRKVASRWFTFEDPNEERRIYKGRVHLRLCFDGGYHVMDEAA  590

Query  1829  HLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRT  2008
             H+CSDYRPTARQLWK P+GTVELGIIGCKNLLPMK    KGSTDAYAVAKYG+KWVRTRT
Sbjct  591   HVCSDYRPTARQLWKAPIGTVELGIIGCKNLLPMK---DKGSTDAYAVAKYGNKWVRTRT  647

Query  2009  ISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK----DVRMGKVRIRISTLA  2176
             ISD+L PRWNEQYTWRVYDPSTV+TIGVFD    +  E+ +    + R+GKVR+RISTL 
Sbjct  648   ISDSLEPRWNEQYTWRVYDPSTVLTIGVFDGCSEVVFESDECMRPNFRIGKVRVRISTLT  707

Query  2177  TGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGA  2356
             TGKVY+NTF L+LLS AGLKKMGEIELAVRFIR+TPTLDFLHVYSQP+LP+MHH++PLG 
Sbjct  708   TGKVYKNTFPLLLLSQAGLKKMGEIELAVRFIRATPTLDFLHVYSQPLLPMMHHVKPLGM  767

Query  2357  VQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaav  2536
             VQQ+SLR AAVK++ +HL+RSEPPLRREVV YMLDADSHSFSMRKVRANWFRIINVIA V
Sbjct  768   VQQDSLRIAAVKIVASHLTRSEPPLRREVVTYMLDADSHSFSMRKVRANWFRIINVIAGV  827

Query  2537  idvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKL  2716
             ID+VKW DDTR W+NPTAT+LVHALLV+L+WFPDLIIPTFAFYVF+IGAWNYRFRSRD L
Sbjct  828   IDIVKWVDDTRGWKNPTATLLVHALLVMLLWFPDLIIPTFAFYVFVIGAWNYRFRSRDTL  887

Query  2717  NHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGE  2896
              HFD KISLAES+DRDELDEEFD +PCTRPN++VRARYDKLRMLGA VQT+LGD ATQGE
Sbjct  888   PHFDPKISLAESLDRDELDEEFDGLPCTRPNELVRARYDKLRMLGAWVQTILGDFATQGE  947

Query  2897  RVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALN  3076
             RVQALVTWRDPRATGIFI LCFVVAFILYLVPSKM++MAFGFYYLRHP+FRDRMPSPALN
Sbjct  948   RVQALVTWRDPRATGIFIGLCFVVAFILYLVPSKMVSMAFGFYYLRHPIFRDRMPSPALN  1007

Query  3077  FFRRLPSLADRML  3115
             FFRRLPSL+DRML
Sbjct  1008  FFRRLPSLSDRML  1020


 Score =   228 bits (582),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT RKL+VEVIEARNLLPKDGHG SSPYV++DF+GQR+KTRTV RDL+PQWNEMLEFN+
Sbjct  1    MGTVRKLVVEVIEARNLLPKDGHGTSSPYVLVDFHGQRRKTRTVTRDLSPQWNEMLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGDMLELDVYHDK++GPTTRNNFLGR++L+ATQFVKKGEEALIYY LE+K    
Sbjct  61   GKPSDVFGDMLELDVYHDKSIGPTTRNNFLGRIRLSATQFVKKGEEALIYYHLEKKYWFG  120

Query  497  WIQGDIGLKIY  529
            WI G+IGLK Y
Sbjct  121  WISGEIGLKTY  131



>ref|XP_006358735.1| PREDICTED: uncharacterized protein LOC102604455 [Solanum tuberosum]
Length=995

 Score =  1256 bits (3251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/793 (80%), Positives = 708/793 (89%), Gaps = 16/793 (2%)
 Frame = +2

Query  764   MKASVATASMPEVKIGGGL---VGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHY  934
             MK SV+  S+PEVK+   +    GP+P+SR    SS +   +    +E SSFDLVEKMHY
Sbjct  210   MKRSVSLGSIPEVKVSNNINIVTGPRPISRA---SSVIFSDAGSGPIEPSSFDLVEKMHY  266

Query  935   LFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEI  1114
             LFV++VKARSLPT G PVVK+VVSGSHV+S+PARKT+LFEWDQTFAFGRDAPDSSS+LE+
Sbjct  267   LFVRVVKARSLPTVGCPVVKIVVSGSHVVSKPARKTVLFEWDQTFAFGRDAPDSSSLLEV  326

Query  1115  SVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDL  1294
             SVWDP S+KS D TSDVAGH FLGGICFDVSEIPLRDPPDSPLAPQWYRLEG GAH+GDL
Sbjct  327   SVWDPSSAKSFDSTSDVAGHVFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGAGAHRGDL  386

Query  1295  MLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKE  1474
             MLATWVGTQAD+SFPDAWKTDTA NP S+SKVYQSPKLWYLRSSV+EAQDI  LT  SK+
Sbjct  387   MLATWVGTQADDSFPDAWKTDTASNPASKSKVYQSPKLWYLRSSVMEAQDISHLTH-SKD  445

Query  1475  SSFQIKAQLGFQVQKTKPA-SSATGSPSWNEDLVFVAAEPFTEHYLLFFLIE-HLPPKEQ  1648
             SS+ IKAQLGFQVQKTK   +++TGSPSWNEDLVFVAAEPFTEH LLFFLIE     K+Q
Sbjct  446   SSYHIKAQLGFQVQKTKSIPTTSTGSPSWNEDLVFVAAEPFTEHCLLFFLIETDRTAKDQ  505

Query  1649  AVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAA  1828
              VL VASIPL++IERRVDDR+V SRWFTFED NEEKR+YKGRVHLRLCFDGGYHV++EAA
Sbjct  506   TVLAVASIPLTTIERRVDDRKVASRWFTFEDPNEEKRIYKGRVHLRLCFDGGYHVMDEAA  565

Query  1829  HLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRT  2008
             H+CSDYRPTARQLWK P+GTVELGIIGCKNLLPMK   GKGSTDAYAVAKYG+KWV TRT
Sbjct  566   HVCSDYRPTARQLWKAPIGTVELGIIGCKNLLPMK---GKGSTDAYAVAKYGNKWVHTRT  622

Query  2009  ISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK----DVRMGKVRIRISTLA  2176
             ISD+L PRWNEQYTWRVYDPSTV+TIGVFD    +  E+ +    D R+GKVR+RISTL 
Sbjct  623   ISDSLEPRWNEQYTWRVYDPSTVLTIGVFDGCSEVVFESDECMRPDFRIGKVRVRISTLT  682

Query  2177  TGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGA  2356
             TGKVYRNTF LILLS AGLKKMGEIELAVRFIRSTPTLDFLHVYSQP+LP+MHH++PLG 
Sbjct  683   TGKVYRNTFQLILLSQAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPLLPMMHHVKPLGM  742

Query  2357  VQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaav  2536
             VQQ SLR+AAVK++ +HL+RSEPPLRREVV YMLDADSHSFSMR+VRANWFRIINVIA V
Sbjct  743   VQQASLRSAAVKIVASHLTRSEPPLRREVVTYMLDADSHSFSMREVRANWFRIINVIAGV  802

Query  2537  idvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKL  2716
             ID+VKW DDTR W+NPTAT+LVHALLV+LVWFPDLIIPTFAFYVF+IGAWNYRF S+D L
Sbjct  803   IDIVKWVDDTRGWKNPTATLLVHALLVMLVWFPDLIIPTFAFYVFVIGAWNYRFSSQDTL  862

Query  2717  NHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGE  2896
              +FD KISLAES+DRDELDEEFDA+PCTRPN++VRARYDKLRMLGARVQT+LGD ATQGE
Sbjct  863   PNFDPKISLAESLDRDELDEEFDALPCTRPNELVRARYDKLRMLGARVQTILGDFATQGE  922

Query  2897  RVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALN  3076
             RVQALVTW DPRATGIFI LCFVVAFILYLVPSKM++MAFGFYYLRHP+FRDRMPSPALN
Sbjct  923   RVQALVTWHDPRATGIFIGLCFVVAFILYLVPSKMVSMAFGFYYLRHPIFRDRMPSPALN  982

Query  3077  FFRRLPSLADRML  3115
             FFRRLPSL+DR+L
Sbjct  983   FFRRLPSLSDRVL  995


 Score =   240 bits (612),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MG  RKL+VEVIEARNLLPKDGHG SSPYV +DFYGQR+KTRTV RDL+PQWNEMLEFN+
Sbjct  1    MGIVRKLVVEVIEARNLLPKDGHGTSSPYVFVDFYGQRRKTRTVTRDLSPQWNEMLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGDMLELDVYHDK++GPTTRNNFLGR++L+ATQFVKKGEEALIYYPLE+K   S
Sbjct  61   GKPSDVFGDMLELDVYHDKSIGPTTRNNFLGRIRLSATQFVKKGEEALIYYPLEKKYWFS  120

Query  497  WIQGDIGLKIYFVD  538
            WI G+IGLKIYFV+
Sbjct  121  WISGEIGLKIYFVE  134



>emb|CDY38472.1| BnaA10g16860D [Brassica napus]
Length=1003

 Score =  1233 bits (3190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1018 (63%), Positives = 791/1018 (78%), Gaps = 40/1018 (4%)
 Frame = +2

Query  137   MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
             M T RKL+VE+++A++L PKDG G SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1     MATTRKLVVEIVDAKDLTPKDGQGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNESLEFSL  60

Query  317   SKHSD--IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
             +K     +F D+LE+D++HDKN GPT RNNFLGR++L + QFV KGEEALIY+PLE+K+L
Sbjct  61    AKKPSHPVFNDVLEIDMFHDKNFGPTRRNNFLGRIRLGSDQFVAKGEEALIYFPLEKKSL  120

Query  491   LSWIQGDIGLKIYFVDetv-pppppppeteppaeakpgevaaaepppakaegtpegegke  667
              + +QG+IG++IY+ +E   P   P        +       A +         P      
Sbjct  121   FTLVQGEIGIRIYYAEEAAPPASKPANSPAEAPKPNEEASPALQENATAGGEAPPAPEPN  180

Query  668   gppvpenppaqeeSKDPVDPSPEQ---LVNDGAVEMKASVATASMPEVKIGGGLVG----  826
              PP       +  +++P    PE    L+     E   S   + +P V I   + G    
Sbjct  181   PPPESVADGPKLPAEEPPQNQPETEDILLETSDTESWVSAPRSPLPGVTISRSVSGSIPK  240

Query  827   -----PKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPv  988
                  P+PL R+    +S+ S++SD S +ERS+FDLVEKMHY+FV++VKARSLPT+G P+
Sbjct  241   TKTGGPQPLPRSLSETASYTSEISDVSTIERSTFDLVEKMHYVFVRVVKARSLPTSGSPI  300

Query  989   vkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSS--ILEISVWDPLSSKSLDPTSD  1162
              K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD+SS  ILEISVW+  +S        
Sbjct  301   TKISLSGTTIESKPARKTSTFEWDQTFAFLRDSPDTSSSPILEISVWEGTAS--------  352

Query  1163  VAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPD  1342
                 +FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH GDLMLATW GTQADESFPD
Sbjct  353   ----HFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHGDLMLATWTGTQADESFPD  408

Query  1343  AWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQIKAQLGFQVQ  1516
             AWKTDTAGN T+R+KVY SPKLWYLR++V++AQD+    LT   KE+SFQ+KAQLGFQVQ
Sbjct  409   AWKTDTAGNVTARAKVYMSPKLWYLRATVMDAQDLLPPQLTV-FKEASFQLKAQLGFQVQ  467

Query  1517  KTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERR  1696
             KTKPA +  G+PSWNEDL+FVAAEPF +   L F +E+   K    +G+A +PL++IERR
Sbjct  468   KTKPAVTRNGAPSWNEDLLFVAAEPFADQ--LVFTLEYRTSKGPVTVGMARVPLTAIERR  525

Query  1697  VDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKP  1876
             VD+R V SRWF+FED  +EKR  + RVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWKP
Sbjct  526   VDERLVASRWFSFEDPTDEKRGNRSRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKP  585

Query  1877  PVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWR  2056
              VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYGSKWVRTRT+SD+L P+WNEQYTW+
Sbjct  586   AVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGSKWVRTRTVSDSLDPKWNEQYTWK  645

Query  2057  VYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVYRNTFSLILLS  2221
             VYDP TV+TIGVFDSW V + +  K     D+R+GKVRIRISTL TGK YRNT+ L++L 
Sbjct  646   VYDPCTVLTIGVFDSWGVYEIDGGKESTRQDLRIGKVRIRISTLETGKAYRNTYPLLMLV  705

Query  2222  PAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLT  2401
               G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MHHI+PL   Q++ LR  AVK+L 
Sbjct  706   NGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMHHIKPLTLFQEDMLRNTAVKILA  765

Query  2402  THLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRN  2581
              HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A ++DVV+W DDTR WRN
Sbjct  766   VHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMVDVVRWVDDTRFWRN  825

Query  2582  PTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDR  2761
             PTAT+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYRFRSR  L HFD ++SLA++ DR
Sbjct  826   PTATLLVHALVVMLIWFPDLIVPTIAFYLFVIGAWNYRFRSRAALPHFDPRLSLADAADR  885

Query  2762  DELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATG  2941
             +ELDEEFD VP  RP +MVR+RYDKLR +GARVQT+LG++A QGE++QALVTWRDPRATG
Sbjct  886   EELDEEFDVVPSNRPPEMVRSRYDKLRAVGARVQTILGEVAAQGEKMQALVTWRDPRATG  945

Query  2942  IFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             IF+ LC VVA +LYLVP+KM+AMA GFYY RHP+FRDR PSP +NFFRRLPSL+DR++
Sbjct  946   IFVGLCLVVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPMINFFRRLPSLSDRLM  1003



>gb|EYU18176.1| hypothetical protein MIMGU_mgv1a000714mg [Erythranthe guttata]
Length=1009

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/804 (75%), Positives = 683/804 (85%), Gaps = 19/804 (2%)
 Frame = +2

Query  719   VDPSP-EQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsd-rsA  892
             ++P+P  +   D    M +SV+T    EVK+   + GP+P+SR  SVSSF       RS+
Sbjct  220   INPAPGNEKQADSDQVMMSSVSTVPA-EVKVNS-ISGPQPISRVSSVSSFSPSDQSDRSS  277

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +ERSSFDLVEKMHYLFV++VKAR LPTAG PVV+V VSG HV S+PARKT  F+WDQTFA
Sbjct  278   IERSSFDLVEKMHYLFVRVVKARHLPTAGSPVVEVAVSGRHVTSKPARKTAFFDWDQTFA  337

Query  1073  FGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQ  1252
             F RD+PDSS+ILE+SV D  S           G  FLGGICFDV EIPLRDPPDSPLAPQ
Sbjct  338   FSRDSPDSSTILEVSVSDRPS-----------GQGFLGGICFDVGEIPLRDPPDSPLAPQ  386

Query  1253  WYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVI  1432
             WYRLEGGGAH+GDLMLATW+GTQADESFPDAWKTD  GNP SRSKVYQSPKLWYLRS++I
Sbjct  387   WYRLEGGGAHRGDLMLATWIGTQADESFPDAWKTDDVGNPNSRSKVYQSPKLWYLRSTII  446

Query  1433  EAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLL  1612
             EAQDI ++  P +ES FQ+K QLGFQVQKTKP  +ATGSPSWNEDL+FVAAEPFTEH L+
Sbjct  447   EAQDI-SMKMPFRESCFQVKTQLGFQVQKTKPVLTATGSPSWNEDLMFVAAEPFTEHSLV  505

Query  1613  FFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLC  1792
              +L+E+ PPKEQ +LGVA++PL+SIERRVDDR V SRWFT ED  E+KRVYKGRVHLRLC
Sbjct  506   IYLMENRPPKEQVILGVATVPLASIERRVDDRNVASRWFTLEDPKEDKRVYKGRVHLRLC  565

Query  1793  FDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRG-KGSTDAYA  1969
             FDGGYHV++E AH+CSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKT+ G KGSTDAYA
Sbjct  566   FDGGYHVMDEGAHVCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTINGGKGSTDAYA  625

Query  1970  VAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK--DVRM  2143
             VAKYG KWVRTR +SD+L PRWNEQYTWRVYDPSTV+T+GVFDSWEV + + S   D R+
Sbjct  626   VAKYGDKWVRTRAVSDSLNPRWNEQYTWRVYDPSTVLTVGVFDSWEVFESDGSHKPDFRI  685

Query  2144  GKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPML  2323
             GKVRIRISTL TGKVY++ F LILLS  GLKKMGEIELAVRF R+TPTLDFLHVYSQP+L
Sbjct  686   GKVRIRISTLTTGKVYKSVFPLILLSQTGLKKMGEIELAVRFARATPTLDFLHVYSQPLL  745

Query  2324  PVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRAN  2503
             P+MHH++PLG VQQE+LR  AVK +  HLSRSEPPLRREVVA+MLDADSH+FSMRKVRAN
Sbjct  746   PMMHHLKPLGMVQQEALRAVAVKTVAAHLSRSEPPLRREVVAHMLDADSHAFSMRKVRAN  805

Query  2504  WFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGA  2683
             W RIINVI+ VIDV KWADDTR+WRNPTATIL HALL  LVW PDLI+PT A Y F IGA
Sbjct  806   WMRIINVISTVIDVFKWADDTRSWRNPTATILAHALLATLVWVPDLIVPTLALYAFAIGA  865

Query  2684  WNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQ  2863
             WNYR R R  L HFDTK+SLAES+DRDELDEEFD++PC  PN+ VRARYDKLR+LGARVQ
Sbjct  866   WNYRLRPRTPLPHFDTKMSLAESVDRDELDEEFDSMPCAGPNETVRARYDKLRVLGARVQ  925

Query  2864  TLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPL  3043
              +LGD ATQGER+QALVTWRDPRATGIF+ LC VVAF+LYLVPSKM+++A GFYYLRHP+
Sbjct  926   AVLGDFATQGERMQALVTWRDPRATGIFVGLCLVVAFVLYLVPSKMVSVALGFYYLRHPI  985

Query  3044  FRDRMPSPALNFFRRLPSLADRML  3115
             FRDRMPSPALNFFRRLPSL+DRM+
Sbjct  986   FRDRMPSPALNFFRRLPSLSDRMM  1009


 Score =   224 bits (572),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   RKL+VEV++ARNLLPKDG+G SSPY ++DF+GQR+KTRT +RDLNP W+E L+FN 
Sbjct  1    MAIVRKLVVEVVDARNLLPKDGYGTSSPYAILDFHGQRRKTRTAVRDLNPTWHETLDFNA  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++FGDMLE+DV+HDKNVGPTTRNNFLGRVKLN+ QFVKKGEEALIYYPLE+K+  +
Sbjct  61   GKTSEVFGDMLEIDVFHDKNVGPTTRNNFLGRVKLNSRQFVKKGEEALIYYPLEKKSFFT  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIYF D
Sbjct  121  WIQGEIGLKIYFSD  134



>ref|XP_006443454.1| hypothetical protein CICLE_v10018633mg [Citrus clementina]
 gb|ESR56694.1| hypothetical protein CICLE_v10018633mg [Citrus clementina]
Length=1063

 Score =  1168 bits (3022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/771 (75%), Positives = 662/771 (86%), Gaps = 16/771 (2%)
 Frame = +2

Query  824   GPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvv  1003
             GP+P+SRT S +SF SD++D   +ERSSFDLVEKMHYLFV++VKAR LPT G PVVK+ V
Sbjct  302   GPQPISRTMSTASFASDITDNIPIERSSFDLVEKMHYLFVRVVKARFLPTKGSPVVKIAV  361

Query  1004  sgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGH-NF  1180
             + S V S+PAR+T  FEWDQTFAFGRD+P+SSS LE+SVWDP       P  DVA    F
Sbjct  362   ANSRVESKPARRTSCFEWDQTFAFGRDSPESSSFLEVSVWDP-------PRGDVAAPPGF  414

Query  1181  LGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDT  1360
             LGGICFDVSEIPLRDPPDSPLAPQWYR+EGGGA+ GDLMLATWVGTQAD+SFPDAWKTDT
Sbjct  415   LGGICFDVSEIPLRDPPDSPLAPQWYRMEGGGAYSGDLMLATWVGTQADDSFPDAWKTDT  474

Query  1361  AGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSA  1540
             AGN  S++KVY SPKLWYLR++VIEAQDI    A  KE+SF IK QLGFQVQKTK + + 
Sbjct  475   AGNVNSKAKVYVSPKLWYLRATVIEAQDILPPVAALKEASFTIKVQLGFQVQKTKVSVTR  534

Query  1541  TGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVIS  1720
              G+PSWNEDL+FVAAEPFT+   L F +E+   K    LGV  +PL+++ERRVDDR+V S
Sbjct  535   NGTPSWNEDLLFVAAEPFTDQ--LSFTLENRQHKGSVALGVTRVPLTAVERRVDDRKVAS  592

Query  1721  RWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
             RWFTFE+ N+EKR YKGRVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPPVGTVELG
Sbjct  593   RWFTFENTNDEKRAYKGRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPVGTVELG  652

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +IGCKNLLPMKT+ GK +TDAY VAKY SKW+RTRT+SD+L PRWNEQYTW+VYDP TV+
Sbjct  653   VIGCKNLLPMKTVNGKSTTDAYVVAKYASKWIRTRTVSDSLEPRWNEQYTWKVYDPCTVL  712

Query  2081  TIGVFDSWEVIDPENSK------DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
              +GVFDSW + + EN        D R+GKVRIRISTL TGKVYRNT+ L+LL   G+ KM
Sbjct  713   ALGVFDSWGIFEGENGSMETTRPDCRIGKVRIRISTLETGKVYRNTYPLLLLGSNGMTKM  772

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             GEIE+AVRFIR++PTLDFLHVYSQP+LP+MHHI+PLG VQQE LR+ AVK++  HL+RSE
Sbjct  773   GEIEVAVRFIRTSPTLDFLHVYSQPLLPLMHHIKPLGMVQQEMLRSGAVKIIAAHLARSE  832

Query  2423  PPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILV  2602
             PPLRRE+V  MLDADSH+FSMRKVRANWFRIINV+A VID+++WADDTR+W+NPTATILV
Sbjct  833   PPLRREIVLCMLDADSHAFSMRKVRANWFRIINVLAGVIDILRWADDTRSWKNPTATILV  892

Query  2603  HALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEF  2782
             HALLV+LVWFPDLI+PT AFYVF+IG WNYRFR RD L HFD KISLA++I+RDELDEEF
Sbjct  893   HALLVMLVWFPDLIVPTSAFYVFVIGVWNYRFRKRDPLPHFDPKISLADTIERDELDEEF  952

Query  2783  DAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCF  2962
             D VP  RPN++VRARYDKLR LGARVQTLLGD A QGERVQALVTWRDPRATGIF+ LCF
Sbjct  953   DTVPSARPNEIVRARYDKLRTLGARVQTLLGDFAAQGERVQALVTWRDPRATGIFVGLCF  1012

Query  2963  VVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             VVA ILYLVPSKM+AMAFGFYYLRHP+FRDRMPSPALNFFRRLPSL+DR++
Sbjct  1013  VVAMILYLVPSKMVAMAFGFYYLRHPMFRDRMPSPALNFFRRLPSLSDRIM  1063


 Score =   220 bits (560),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   +KLIVEV++ARNLLPKDGHG SSPYVVID+YGQR+KT T +RDLNP WNE LEFN+
Sbjct  1    MAAIQKLIVEVVDARNLLPKDGHGTSSPYVVIDYYGQRRKTHTAVRDLNPTWNEALEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K   +F DM EL+++HDK  GPTTRNNFLGR++L+++QFVKKGEEALIYYPLE+K+LL+
Sbjct  61   GKPPQVFTDMFELNIFHDKAYGPTTRNNFLGRIRLSSSQFVKKGEEALIYYPLEKKSLLT  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIY+VD
Sbjct  121  WIQGEIGLKIYYVD  134



>ref|XP_006479137.1| PREDICTED: uncharacterized protein LOC102628142 [Citrus sinensis]
Length=1065

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/771 (75%), Positives = 662/771 (86%), Gaps = 16/771 (2%)
 Frame = +2

Query  824   GPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvv  1003
             GP+P+SRT S +SF SD++D   +ERSSFDLVEKMHYLFV++VKAR LPT G PVVK+ V
Sbjct  304   GPQPISRTMSTASFASDITDNIPIERSSFDLVEKMHYLFVRVVKARFLPTKGSPVVKIAV  363

Query  1004  sgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGH-NF  1180
             + S V S+PAR+T  FEWDQTFAFGRD+P+SSS LE+SVWDP       P  DVA    F
Sbjct  364   ANSRVESKPARRTSCFEWDQTFAFGRDSPESSSFLEVSVWDP-------PRGDVAAPPGF  416

Query  1181  LGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDT  1360
             LGGICFDVSEIPLRDPPDSPLAPQWYR+EGGGA+ GDLMLATWVGTQAD+SFPDAWKTDT
Sbjct  417   LGGICFDVSEIPLRDPPDSPLAPQWYRMEGGGAYSGDLMLATWVGTQADDSFPDAWKTDT  476

Query  1361  AGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSA  1540
             AGN  S++KVY SPKLWYLR++VIEAQDI    A  KE+SF IK QLGFQVQKTK + + 
Sbjct  477   AGNVNSKAKVYVSPKLWYLRATVIEAQDILPPVAALKEASFTIKVQLGFQVQKTKVSVTR  536

Query  1541  TGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVIS  1720
              G+PSWNEDL+FVAAEPFT+   L F +E+   K    LGV  +PL+++ERRVDDR+V S
Sbjct  537   NGTPSWNEDLLFVAAEPFTDQ--LSFTLENRQHKGSVALGVTRVPLTAVERRVDDRKVAS  594

Query  1721  RWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
             RWFTFE+ N+EKR YKGRVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPPVGTVELG
Sbjct  595   RWFTFENTNDEKRAYKGRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPVGTVELG  654

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +IGCKNLLPMKT+ GK +TDAY VAKY SKW+RTRT+SD+L PRWNEQYTW+VYDP TV+
Sbjct  655   VIGCKNLLPMKTVNGKSTTDAYVVAKYASKWIRTRTVSDSLEPRWNEQYTWKVYDPCTVL  714

Query  2081  TIGVFDSWEVIDPENSK------DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
              +GVFDSW + + EN        D R+GKVRIRISTL TGKVYRNT+ L+LL   G+ KM
Sbjct  715   ALGVFDSWGIFEGENGSMETTRPDCRIGKVRIRISTLETGKVYRNTYPLLLLGSNGMTKM  774

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             GEIE+AVRFIR++PTLDFLHVYSQP+LP+MHHI+PLG VQQE LR+ AVK++  HL+RSE
Sbjct  775   GEIEVAVRFIRTSPTLDFLHVYSQPLLPLMHHIKPLGMVQQEMLRSGAVKIIAAHLARSE  834

Query  2423  PPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILV  2602
             PPLRRE+V  MLDADSH+FSMRKVRANWFRIINV+A VID+++WADDTR+W+NPTATILV
Sbjct  835   PPLRREIVLCMLDADSHAFSMRKVRANWFRIINVLAGVIDILRWADDTRSWKNPTATILV  894

Query  2603  HALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEF  2782
             HALLV+LVWFPDLI+PT AFYVF+IG WNYRFR RD L HFD KISLA++I+RDELDEEF
Sbjct  895   HALLVMLVWFPDLIVPTSAFYVFVIGVWNYRFRKRDPLPHFDPKISLADTIERDELDEEF  954

Query  2783  DAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCF  2962
             D VP  RPN++VRARYDKLR LGARVQTLLGD A QGERVQALVTWRDPRATGIF+ LCF
Sbjct  955   DTVPSARPNEIVRARYDKLRTLGARVQTLLGDFAAQGERVQALVTWRDPRATGIFVGLCF  1014

Query  2963  VVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             VVA ILYLVPSKM+AMAFGFYYLRHP+FRDRMPSPALNFFRRLPSL+DR++
Sbjct  1015  VVAMILYLVPSKMVAMAFGFYYLRHPMFRDRMPSPALNFFRRLPSLSDRIM  1065


 Score =   221 bits (563),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  131  LEMGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEF  310
            ++M   +KLIVEV++ARNLLPKDGHG SSPYVVID+YGQR+KT T +RDLNP WNE LEF
Sbjct  1    MKMAAIQKLIVEVVDARNLLPKDGHGTSSPYVVIDYYGQRRKTHTAVRDLNPTWNEALEF  60

Query  311  NLSKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            N+ K   +F DM EL+++HDK  GPTTRNNFLGR++L+++QFVKKGEEALIYYPLE+K+L
Sbjct  61   NVGKPPQVFTDMFELNIFHDKAYGPTTRNNFLGRIRLSSSQFVKKGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
            L+WIQG+IGLKIY+VD
Sbjct  121  LTWIQGEIGLKIYYVD  136



>gb|KDO54987.1| hypothetical protein CISIN_1g001521mg [Citrus sinensis]
Length=1061

 Score =  1165 bits (3014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/771 (75%), Positives = 662/771 (86%), Gaps = 16/771 (2%)
 Frame = +2

Query  824   GPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvv  1003
             GP+P+SRT S +SF SD++D   +ERSSFDLVEKMHYLFV++VKAR LPT G PVVK+ V
Sbjct  300   GPQPISRTMSTASFASDITDNIPIERSSFDLVEKMHYLFVRVVKARFLPTKGSPVVKIAV  359

Query  1004  sgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGH-NF  1180
             + S V S+PAR+T  FEWDQTFAFGRD+P+SSS LE+SVWDP       P  DVA    F
Sbjct  360   ANSRVESKPARRTSCFEWDQTFAFGRDSPESSSFLEVSVWDP-------PRGDVAAPPGF  412

Query  1181  LGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDT  1360
             LGGICFDV+EIPLRDPPDSPLAPQWYR+EGGGA+ GDLMLATWVGTQAD+SFPDAWKTDT
Sbjct  413   LGGICFDVTEIPLRDPPDSPLAPQWYRMEGGGAYSGDLMLATWVGTQADDSFPDAWKTDT  472

Query  1361  AGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSA  1540
             AGN  S++KVY SPKLWYLR++VIEAQDI    A  KE+SF IKAQLGFQVQKTK + + 
Sbjct  473   AGNVNSKAKVYVSPKLWYLRATVIEAQDILPPVAALKEASFTIKAQLGFQVQKTKVSVTR  532

Query  1541  TGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVIS  1720
              G+PSWNEDL+FVAAEPFT+   L F +E+   K    LGV  +PL+++ERRVDDR+V S
Sbjct  533   NGTPSWNEDLLFVAAEPFTDQ--LSFTLENRQHKGSVALGVTRVPLTAVERRVDDRKVAS  590

Query  1721  RWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
             RWFTFE+ N+EKR YKGRVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPPVGTVELG
Sbjct  591   RWFTFENTNDEKRAYKGRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPVGTVELG  650

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +IGCKNLLPMKT+ GK +TDAY VAKY SKW+RTRT+SD+L PRWNEQYTW+VYDP TV+
Sbjct  651   VIGCKNLLPMKTVNGKSTTDAYVVAKYASKWIRTRTVSDSLEPRWNEQYTWKVYDPCTVL  710

Query  2081  TIGVFDSWEVIDPENSK------DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
              +GVFDSW + + EN        D R+GKVRIRISTL TGKVYRNT+ L+LL   G+ KM
Sbjct  711   ALGVFDSWGIFEGENGSMETTRPDCRIGKVRIRISTLETGKVYRNTYPLLLLGSNGMTKM  770

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             GEIE+AVRFIR++PTLDFLHVYSQP+LP+MHHI+PLG VQQE LR+ AVK++  HL+RSE
Sbjct  771   GEIEVAVRFIRTSPTLDFLHVYSQPLLPLMHHIKPLGMVQQEMLRSGAVKIIAAHLARSE  830

Query  2423  PPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILV  2602
             PPLRRE V  MLDADSH+FSMRKVRANWFRIINV+A VID+++WADDTR+W+NPTATILV
Sbjct  831   PPLRRETVLCMLDADSHAFSMRKVRANWFRIINVLAGVIDILRWADDTRSWKNPTATILV  890

Query  2603  HALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEF  2782
             HALLV+LVWFPDLI+PT AFYVF+IG WNYRFR RD L HFD KISLA++I+RDELDEEF
Sbjct  891   HALLVMLVWFPDLIVPTLAFYVFVIGVWNYRFRKRDPLPHFDPKISLADTIERDELDEEF  950

Query  2783  DAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCF  2962
             D VP  RPN++VRARYDKLR LGARVQTLLGD A QGERVQALVTWRDPRATGIF+ LCF
Sbjct  951   DTVPSARPNEIVRARYDKLRTLGARVQTLLGDFAAQGERVQALVTWRDPRATGIFVGLCF  1010

Query  2963  VVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             VVA ILYLVPSKM+AMAFGFYYLRHP+FRDRMPSPALNFFRRLPSL+DR++
Sbjct  1011  VVAMILYLVPSKMVAMAFGFYYLRHPMFRDRMPSPALNFFRRLPSLSDRIM  1061


 Score =   220 bits (560),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   +KLIVEV++ARNLLPKDGHG SSPYVVID+YGQR+KT T +RDLNP WNE LEFN+
Sbjct  1    MAAIQKLIVEVVDARNLLPKDGHGTSSPYVVIDYYGQRRKTHTAVRDLNPTWNEALEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K   +F DM EL+++HDK  GPTTRNNFLGR++L+++QFVKKGEEALIYYPLE+K+LLS
Sbjct  61   GKPPQVFTDMFELNIFHDKAYGPTTRNNFLGRIRLSSSQFVKKGEEALIYYPLEKKSLLS  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG++GLKIY+VD
Sbjct  121  WIQGEVGLKIYYVD  134



>ref|XP_010279060.1| PREDICTED: uncharacterized protein LOC104613064 [Nelumbo nucifera]
Length=1061

 Score =  1159 bits (2997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/819 (71%), Positives = 677/819 (83%), Gaps = 23/819 (3%)
 Frame = +2

Query  707   SKDPVDPSPEQLV-----NDGA------VEMKASVATASMPEVKIGGGLVGPKPLSRTPs  853
             SK+PVDPSP+Q       N  A       E+ ++  TA+MPEV+        +P+ RT +
Sbjct  250   SKNPVDPSPQQPTQVDSENKSAPEAPLPAEVMSATVTATMPEVR-AAVFNAARPIYRTAT  308

Query  854   vssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA  1033
               +   D  DR  +ERSS+DLVEKMHYLFV++VKARSLPT G PVVK+ V+   V S+PA
Sbjct  309   AENSSRDPPDRIPVERSSYDLVEKMHYLFVKVVKARSLPTNGNPVVKIAVASCQVRSKPA  368

Query  1034  RKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEI  1213
             RK   FEWDQTFAFGRDAP+SSS+LE+SVWDP +S   +PTSD A  NFLGG+CFDV+EI
Sbjct  369   RKATFFEWDQTFAFGRDAPESSSMLEVSVWDPATS---NPTSDAAEGNFLGGVCFDVTEI  425

Query  1214  PLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVY  1393
             PLRDPPDSPLAPQWYRLEGGGAH GDLMLATW+GTQADE+F DAWKTDTAGN +SRSKVY
Sbjct  426   PLRDPPDSPLAPQWYRLEGGGAHNGDLMLATWIGTQADEAFSDAWKTDTAGNVSSRSKVY  485

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
              SPKLWYLR++VIEAQDI   TA ++ESSFQ+KAQLG QV KT+ + S  GSPSWNEDL+
Sbjct  486   LSPKLWYLRATVIEAQDILPSTA-TRESSFQVKAQLGAQVLKTRISVSRNGSPSWNEDLI  544

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEE  1753
             FVAAEPF +H  L F +E+   K   VLGVA IPL++IERRVDDR+V+SRWF+ ED + E
Sbjct  545   FVAAEPFCDH--LVFSLENRQSKVTVVLGVARIPLATIERRVDDRKVVSRWFSLEDADNE  602

Query  1754  KRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMK  1933
             KR YKGR HLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPPVG VELGI+GCKNLLPMK
Sbjct  603   KRAYKGRAHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPVGAVELGIVGCKNLLPMK  662

Query  1934  TMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI  2113
             T+ GKGSTDAYAVAKYG KWVR+RT++D+L P+WNEQYTW+VYDP TV+T+GVFD+W V 
Sbjct  663   TINGKGSTDAYAVAKYGQKWVRSRTVADSLDPKWNEQYTWKVYDPCTVLTVGVFDNWGVY  722

Query  2114  DPENSK-----DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             + +  K     D R+GKVRIRISTL T +VYRNT+ L+LL+P G+KKMG+IELAVRF R+
Sbjct  723   EKDGPKESTRPDFRIGKVRIRISTLETDRVYRNTYPLLLLTPTGVKKMGDIELAVRFTRA  782

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
              PTLD LHVY+QP+LP+MHHIRPLG  QQE LR+ A K++  HLSRSEPPLRREVV YML
Sbjct  783   VPTLDMLHVYTQPLLPLMHHIRPLGIFQQEMLRSTASKIVALHLSRSEPPLRREVVLYML  842

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH+FSMRKVRANWFRIINVIA VIDVV+W DDTR+W+NPTAT+LVHALLV+LVWFPD
Sbjct  843   DADSHAFSMRKVRANWFRIINVIAGVIDVVRWVDDTRSWKNPTATLLVHALLVMLVWFPD  902

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LIIPTF FYVF+IGAWNYRFR+RD       KIS AE IDRDELDEEFD VP TR  +++
Sbjct  903   LIIPTFLFYVFVIGAWNYRFRARDPFPQPCPKISQAEFIDRDELDEEFDTVPSTRSQEII  962

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             RARYDKLR L ARVQT+LGD ATQGERVQALVTWRDPRAT IF+ LCF+VA +LYLVPSK
Sbjct  963   RARYDKLRTLAARVQTVLGDFATQGERVQALVTWRDPRATAIFVGLCFIVAIVLYLVPSK  1022

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFYYLRHP+FRDRM  PALNFFRRLP+L+DR++
Sbjct  1023  MVALASGFYYLRHPMFRDRMSPPALNFFRRLPALSDRIM  1061


 Score =   218 bits (554),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKLI EV++ARNL+PKDG G SSPYVV+D+YGQR++T+TV+RDLNP WNE+LEFN+  
Sbjct  4    TMRKLIAEVVDARNLMPKDGQGTSSPYVVVDYYGQRRRTQTVIRDLNPTWNEVLEFNVGG  63

Query  323  HSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             SD+FGDMLE+DVYHD+ +GPT R+NFLGRV+LN+ QFV+KGEEALIY+PLE+K+  +WI
Sbjct  64   PSDVFGDMLEIDVYHDRRMGPTRRSNFLGRVRLNSAQFVRKGEEALIYFPLEKKSWFTWI  123

Query  503  QGDIGLKIYFVD  538
            QG+IGLKIY++D
Sbjct  124  QGEIGLKIYYID  135



>gb|KDP39681.1| hypothetical protein JCGZ_02701 [Jatropha curcas]
Length=1063

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/798 (72%), Positives = 672/798 (84%), Gaps = 23/798 (3%)
 Frame = +2

Query  761   EMKASVATASMPEVK---IGGGLVGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMH  931
             E+ A+  + S+PEV+   I      P+P++ T   +++  +  +  ++ERSSFDLVEKMH
Sbjct  276   EIMAASVSGSVPEVRVASINDPHHIPRPVAST---TNYALEPQESISIERSSFDLVEKMH  332

Query  932   YLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILE  1111
             YLFV++VKA+ LP+ G P+V++V SGS + SRPARKT  FEWDQTFAFGRDAP+SSSILE
Sbjct  333   YLFVRVVKAQGLPSKGNPIVRIVTSGSRIQSRPARKTAFFEWDQTFAFGRDAPESSSILE  392

Query  1112  ISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGD  1291
             +SVWDP      DP SD+AG  FLGGICFDV+EIPLRDPPDSPLAPQWYRLEGG  H GD
Sbjct  393   VSVWDPPGG---DPKSDLAGAKFLGGICFDVTEIPLRDPPDSPLAPQWYRLEGG-IHIGD  448

Query  1292  -----LMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFAL  1456
                  +MLATWVGTQADE+FPDAWKTD AGN  SR+KVY SPKLWYLR++V+EAQDIF +
Sbjct  449   VLLGNIMLATWVGTQADEAFPDAWKTDAAGNVNSRAKVYLSPKLWYLRATVVEAQDIFPV  508

Query  1457  TAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLP  1636
             T   KE+SFQ+KAQLGFQVQKTK   +  G+PSWNEDL+FVAAEPF++   L F IE+  
Sbjct  509   TH-LKEASFQLKAQLGFQVQKTKTVVTRNGNPSWNEDLLFVAAEPFSDD--LHFTIENRQ  565

Query  1637  PKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVI  1816
              K    +G+A IPL++IERRVDDR+V SRWF+FED N EK  YKGRV L+LCFDGGYHV+
Sbjct  566   SKGPVTVGIARIPLTAIERRVDDRKVASRWFSFEDPNSEKVAYKGRVQLKLCFDGGYHVM  625

Query  1817  EEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWV  1996
             +EAAH+CSDY PTARQLWKPPVGTVELGIIGCKNLLPMKT  GKG TDAY+VAKYG KWV
Sbjct  626   DEAAHVCSDYLPTARQLWKPPVGTVELGIIGCKNLLPMKTKDGKGCTDAYSVAKYGPKWV  685

Query  1997  RTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIR  2161
             RTRT+ D+L P+WNEQYTW+V+DPSTV++IGVFDS EV + +  K     D R+GK+RIR
Sbjct  686   RTRTVCDSLDPKWNEQYTWKVFDPSTVLSIGVFDSREVFERDGDKTASPPDYRIGKIRIR  745

Query  2162  ISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHI  2341
             ISTL TGKVYRN++ LILL+  G+KKMGEIE+AVRFIR+TPTLDFLHVYSQP+LP+MHHI
Sbjct  746   ISTLETGKVYRNSYPLILLTNNGVKKMGEIEVAVRFIRTTPTLDFLHVYSQPLLPLMHHI  805

Query  2342  RPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiin  2521
             +PLG VQQ+ LR+AAV+++ THLSRSEPPLRRE+V YMLDADSH+FSMRKVRANWFRIIN
Sbjct  806   KPLGVVQQDMLRSAAVRIIATHLSRSEPPLRREIVLYMLDADSHAFSMRKVRANWFRIIN  865

Query  2522  viaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFR  2701
             VIA V+D+V+W DDTR WRNPTAT+LVHALLV+LVWFPDLI+PT AFYVF+IGAWNYRFR
Sbjct  866   VIAGVLDIVRWIDDTRVWRNPTATLLVHALLVMLVWFPDLIVPTLAFYVFVIGAWNYRFR  925

Query  2702  SRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDL  2881
             +RD L  FD KISLA+++DR+ELDEEFD +P TR  D +RARYDKLR LG RVQ +LGD 
Sbjct  926   TRDPLPDFDPKISLADTVDREELDEEFDTLPSTRSPDTIRARYDKLRTLGIRVQKVLGDF  985

Query  2882  ATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMP  3061
             ATQGERVQALVTWRDPRATGIF+ LCFVVA ILYLVPSKM+AMAFGFYY RHP+FRDRMP
Sbjct  986   ATQGERVQALVTWRDPRATGIFVGLCFVVAVILYLVPSKMVAMAFGFYYFRHPIFRDRMP  1045

Query  3062  SPALNFFRRLPSLADRML  3115
             SPALNFFRRLPSL+DR++
Sbjct  1046  SPALNFFRRLPSLSDRIM  1063


 Score =   214 bits (545),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   +KL VEV++ARNLLPKDGHG SSP+V +DFYGQRK+T+T +RDLNP WNE+LEFN+
Sbjct  1    MAKNQKLFVEVVDARNLLPKDGHGTSSPFVTVDFYGQRKRTQTAIRDLNPTWNEVLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++FGDMLELD+ HDK  GPT RN  LGR++LN+TQFV+KGEEALIYYPLE+K L S
Sbjct  61   GKPSNVFGDMLELDICHDKTYGPTRRNVHLGRIRLNSTQFVRKGEEALIYYPLEKKYLFS  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIY+ D
Sbjct  121  WIQGEIGLKIYYQD  134



>ref|XP_002525723.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36706.1| conserved hypothetical protein [Ricinus communis]
Length=1074

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/803 (71%), Positives = 667/803 (83%), Gaps = 25/803 (3%)
 Frame = +2

Query  761   EMKASVATASMPEVKIGGGLVGPKPLSR-TPsvssfvsdvsdrsAMERSSFDLVEKMHYL  937
             E+ A+  + S+PE+K+ G +  P P++R     ++++ +  +  ++ERSSFDLVEKMHYL
Sbjct  279   EIMAASVSGSVPEIKVAG-INAPHPITRPAAPTTNYILEPQESISIERSSFDLVEKMHYL  337

Query  938   FVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEIS  1117
             FV++VKA+ LPT G P+VK+V SG+ V+SRPARKT  FEWDQTFAFGRDAP+SSSILE+S
Sbjct  338   FVRVVKAKGLPTNGNPIVKIVASGNRVLSRPARKTGFFEWDQTFAFGRDAPESSSILEVS  397

Query  1118  VWDPLSSKSLDPTS--DVA--GHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHK  1285
             VWDPLS   +DP    D+A  G  FLGGICFDV+EIPLRDPPDSPLAPQWY LEGG  H 
Sbjct  398   VWDPLS---MDPRKQYDLAAEGAKFLGGICFDVTEIPLRDPPDSPLAPQWYMLEGGETHN  454

Query  1286  ----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFA  1453
                 G+LMLATWVGTQADE+FPDAWKTDTAGN  SR+KVY SPKLWYLR++V+EAQDI  
Sbjct  455   SVMLGNLMLATWVGTQADEAFPDAWKTDTAGNVNSRAKVYLSPKLWYLRATVLEAQDIIP  514

Query  1454  LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHL  1633
             + A  KESSFQIKAQLGFQ QKTKP  +  G+PSWNEDL FVAAEPF++H  L F +E+ 
Sbjct  515   V-AHIKESSFQIKAQLGFQAQKTKPTVTRNGNPSWNEDLPFVAAEPFSDH--LIFTLENR  571

Query  1634  PPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHV  1813
              PK    +G+A IPL+++ERRVDDR+V +RWF+FED   EK  YKGR+ L+LCFDGGYHV
Sbjct  572   QPKGHVTIGIARIPLAAVERRVDDRKVAARWFSFEDPKSEKVAYKGRIQLKLCFDGGYHV  631

Query  1814  IEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKW  1993
             ++E A++CSDYRPTARQLWKPPVGTVELGII CKNLLPMKT+ GK  TD+Y VAKYG KW
Sbjct  632   MDETANVCSDYRPTARQLWKPPVGTVELGIIACKNLLPMKTVDGKSCTDSYCVAKYGPKW  691

Query  1994  VRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI---------DPENSKDVRMG  2146
             VRTRT+ D+L P+WNEQYTW+V+DPSTV+TIGVFDSW +                D R+G
Sbjct  692   VRTRTVCDSLDPKWNEQYTWKVFDPSTVLTIGVFDSWGLFESSSSSGGEKTATRPDSRIG  751

Query  2147  KVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLP  2326
             K+RIRISTL TGKVYRN++ L LLS  G+KKMGEIE+AVRF+R+TPTLDFLHVYSQP++P
Sbjct  752   KIRIRISTLETGKVYRNSYPLNLLSSNGVKKMGEIEIAVRFVRTTPTLDFLHVYSQPLMP  811

Query  2327  VMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANW  2506
             +MHHI P+G VQQE LR+  VK+L THLSRSEPPLRREVV YMLDADSH+FSMRKVRANW
Sbjct  812   LMHHINPIGVVQQEMLRSTTVKILATHLSRSEPPLRREVVLYMLDADSHAFSMRKVRANW  871

Query  2507  FRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAW  2686
             FRIINVIA V+D+V+W DDTR W+NPTAT+LVHALLV+LVWFPDLI+PT AFYVF IGAW
Sbjct  872   FRIINVIAGVLDIVRWIDDTRVWKNPTATLLVHALLVMLVWFPDLIVPTLAFYVFAIGAW  931

Query  2687  NYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQT  2866
             NYRFRSRD L HFD KISLA+S+DR+ELDEEFD +P +R  D VRARYDKLR LG RVQ 
Sbjct  932   NYRFRSRDPLPHFDPKISLADSVDREELDEEFDTLPSSRSADTVRARYDKLRTLGVRVQK  991

Query  2867  LLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLF  3046
             +LGDLATQGERVQALVTWRDPRATGIF+ LCF VA ILYLVPSKM+AMAFGFYY RHP+F
Sbjct  992   ILGDLATQGERVQALVTWRDPRATGIFVGLCFAVAMILYLVPSKMVAMAFGFYYFRHPIF  1051

Query  3047  RDRMPSPALNFFRRLPSLADRML  3115
             RD+MPSPALNFFRRLPSL+DR++
Sbjct  1052  RDQMPSPALNFFRRLPSLSDRIM  1074


 Score =   211 bits (537),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   +KLIVEV++ARNLLPKDGHG SSPYV IDFYGQRK+T+T +RDLNP WNE+LEFN+
Sbjct  1    MAKNQKLIVEVVDARNLLPKDGHGTSSPYVTIDFYGQRKRTQTAIRDLNPTWNEVLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++F D+LELDV HDKN GPT RN  LGR++L++ QFV+KGEEALIYYPLE+K L S
Sbjct  61   GKPSNVFDDILELDVCHDKNYGPTRRNVHLGRIRLSSGQFVRKGEEALIYYPLEKKYLFS  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGL+IY+ D
Sbjct  121  WIQGEIGLRIYYQD  134



>ref|XP_007030058.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOY10560.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1045

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/793 (70%), Positives = 656/793 (83%), Gaps = 22/793 (3%)
 Frame = +2

Query  761   EMKASVATASMPEVKIGGGLVGPKPLSR--TPsvssfvsdvsdrsAMERSSFDLVEKMHY  934
             E+ AS  + S+PE+K+      P P++R  TP+  +   D  D + +ERSSFDLVEKMHY
Sbjct  267   EIMASTISGSIPEIKVARTTSAPPPITRPATPTNFASSVDPPDHTPIERSSFDLVEKMHY  326

Query  935   LFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEI  1114
             +FV++VKA SLPT G PVVK+ +SG  V S+PARK + FEWDQTFAF RD P++SS LEI
Sbjct  327   VFVKVVKAGSLPTNGNPVVKIAISGCRVTSKPARKAMYFEWDQTFAFARDTPETSSFLEI  386

Query  1115  SVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDL  1294
             SVW           +D  G NFLGG+CFD +E+PLRDPPDSPLAPQWYRLEGGGAH+GDL
Sbjct  387   SVW-----------ADAGGANFLGGVCFDATEMPLRDPPDSPLAPQWYRLEGGGAHRGDL  435

Query  1295  MLATWVGTQADESFPDAWKTDTAGN-PTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSK  1471
             MLATW+GTQADE+FPD+WK+DTAGN   SR+K+YQSPKLWYLR+SV+EAQDI  LTA  K
Sbjct  436   MLATWIGTQADEAFPDSWKSDTAGNLINSRAKIYQSPKLWYLRASVLEAQDILPLTA-LK  494

Query  1472  ESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQA  1651
             E SFQIK QLGFQVQKTK + S  G+PSWNEDL+FVAAEPF +H  L F +E+   K   
Sbjct  495   EGSFQIKVQLGFQVQKTKVSVSRNGNPSWNEDLMFVAAEPFGDH--LIFYLEYRQSKGPV  552

Query  1652  VLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAH  1831
              LGV  I L++IERRVDDR+VISRWF  ED   EK+ YKGRVHL LCFDGGYHV++EAAH
Sbjct  553   TLGVVGISLTAIERRVDDRKVISRWFNLEDPKNEKKGYKGRVHLSLCFDGGYHVMDEAAH  612

Query  1832  LCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTI  2011
             +CSDYRPTARQLWKP VGT+ELGIIGCKNLLPMKT+  KG TDAY VAKYGSKWVRTRT+
Sbjct  613   VCSDYRPTARQLWKPAVGTLELGIIGCKNLLPMKTINSKGFTDAYTVAKYGSKWVRTRTV  672

Query  2012  SDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLA  2176
             SD+L P+WNEQYTW+VYDP TV+TIGVFDSW  +D +  K     D RMGKVRIRISTL 
Sbjct  673   SDSLDPKWNEQYTWKVYDPCTVLTIGVFDSWGALDIDGGKEATRPDSRMGKVRIRISTLE  732

Query  2177  TGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGA  2356
              GKVY+NT+ L++L   G++KMGE+ELAVRF+R+ PTLDFLHVYSQP+LP+MHHI+PLG 
Sbjct  733   MGKVYKNTYPLVMLGNRGVQKMGELELAVRFVRAAPTLDFLHVYSQPLLPLMHHIKPLGM  792

Query  2357  VQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaav  2536
              QQE LR+  VKLL  HLSRSEPPLR +VV YMLDADSH+FSMRKVRANW RI+NV++ +
Sbjct  793   AQQEMLRSTTVKLLAAHLSRSEPPLRSDVVRYMLDADSHTFSMRKVRANWSRIVNVLSGL  852

Query  2537  idvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKL  2716
             ID+V+W ++TRAW+NPTATILVHALLV+LVWFPDLI+PT AFYVF+IG WNYRFRSRDKL
Sbjct  853   IDIVRWIENTRAWKNPTATILVHALLVMLVWFPDLIVPTIAFYVFVIGVWNYRFRSRDKL  912

Query  2717  NHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGE  2896
              HF  KISLA+++DRDELDEEFD +P TR  +++R RYDKLR +GARVQ +LGD ATQGE
Sbjct  913   PHFCPKISLADTVDRDELDEEFDTMPSTRSPEIIRVRYDKLRAVGARVQNILGDFATQGE  972

Query  2897  RVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALN  3076
             RVQALVTWRDPRATGIF+ LCFVVAF+LYLVP KM+AMAFGFYY RHPLFRDRMPSPA+N
Sbjct  973   RVQALVTWRDPRATGIFVGLCFVVAFMLYLVPPKMVAMAFGFYYFRHPLFRDRMPSPAMN  1032

Query  3077  FFRRLPSLADRML  3115
             FFRRLP+L+DR++
Sbjct  1033  FFRRLPALSDRIM  1045


 Score =   221 bits (563),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T +KL+VEVI+ARNL+PKDGHGASSPYVVID+YGQRK+T TV RD+NP WNE+L+FN+ K
Sbjct  4    TTQKLVVEVIDARNLVPKDGHGASSPYVVIDYYGQRKRTSTVTRDINPTWNEVLQFNVEK  63

Query  323  HSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             SD+F DMLELDVYHDKN GPT R N LGR+KL++ QFVKKGEEALIYYPLE+K LLSW+
Sbjct  64   PSDVFNDMLELDVYHDKNHGPTNRKNSLGRIKLSSGQFVKKGEEALIYYPLEKKYLLSWV  123

Query  503  QGDIGLKIYFVD  538
            QG+IGLKIY+ D
Sbjct  124  QGEIGLKIYYAD  135



>ref|XP_011034404.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
Length=1078

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/803 (70%), Positives = 666/803 (83%), Gaps = 22/803 (3%)
 Frame = +2

Query  725   PSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSR-TPsvssfvsdvsdrsAMER  901
             P+P ++V         S +T S PE+K+ G +  P+P+ R     S++  +  +  ++ER
Sbjct  292   PAPPEIV---------SASTGSFPEIKVSG-INAPQPMIRPVAPTSNYTLEPQESISIER  341

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGR  1081
             S+FDLVEKMHYLFV++VKAR LPT+G PVV++ VS S V S+PARKTL FEWDQTFAFGR
Sbjct  342   SAFDLVEKMHYLFVRVVKARYLPTSGNPVVRIEVSNSRVQSKPARKTLCFEWDQTFAFGR  401

Query  1082  DAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYR  1261
             DAPDSSSI+EISVWDP   +S   +   A  NFLGGICFDV+EIPLRDPPDSPLAPQWYR
Sbjct  402   DAPDSSSIVEISVWDPHDPQS---SEMAAAANFLGGICFDVTEIPLRDPPDSPLAPQWYR  458

Query  1262  LEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQ  1441
             LEGGGA+  DLMLATWVGTQAD+SFPDAWKTDTAGN  SR+KVY SPKLWYLR++V+EAQ
Sbjct  459   LEGGGAYGSDLMLATWVGTQADDSFPDAWKTDTAGNINSRAKVYLSPKLWYLRATVLEAQ  518

Query  1442  DIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFL  1621
             DIF L  P KE++ Q+KAQLGFQVQKTK + S  G+PSWNEDL+FV+AEP ++   L F 
Sbjct  519   DIFPLM-PLKETAVQVKAQLGFQVQKTKTSVSRNGTPSWNEDLLFVSAEPCSDQ--LIFT  575

Query  1622  IEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDG  1801
             +E+  PK    +G+  I LS+IERRVDDR+V SRWF+ ED   EK  Y+GRV LRLCFDG
Sbjct  576   LENRQPKGPVTIGMVRIALSAIERRVDDRKVASRWFSLEDPRSEKEGYRGRVQLRLCFDG  635

Query  1802  GYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKY  1981
             GYHV++EAAH+ SDYRPTARQLWK PVGT ELGIIGCKNL PMKT+ GKG TDAY VAKY
Sbjct  636   GYHVMDEAAHMSSDYRPTARQLWKQPVGTFELGIIGCKNLSPMKTVDGKGCTDAYCVAKY  695

Query  1982  GSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMG  2146
             G KWVRTRT+ D+L P+WNEQYTW+VYDP TV+TIGVFDS  V + +  K     D RMG
Sbjct  696   GPKWVRTRTVCDSLDPKWNEQYTWKVYDPCTVLTIGVFDSSGVYEIDGDKTATRPDFRMG  755

Query  2147  KVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLP  2326
             KVR+R+STL T KVYRN F LILL+  G+KKMGEIE+AV+F+R+TPTLDFLHVY+QP+LP
Sbjct  756   KVRVRLSTLETAKVYRNRFPLILLTNNGVKKMGEIEVAVKFVRATPTLDFLHVYTQPLLP  815

Query  2327  VMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANW  2506
             +MHH++PLG VQQE LR  AVK++ THLSRSEP LRREVV+YMLD D+H+FSMRK+RANW
Sbjct  816   LMHHLKPLGVVQQELLRNTAVKIIATHLSRSEPSLRREVVSYMLDVDTHAFSMRKIRANW  875

Query  2507  FRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAW  2686
              RIINVIA+VID+V+W DDTR W+NPT+TILVHALL++LVWFPDLI+PT AFYVF+IGAW
Sbjct  876   IRIINVIASVIDIVRWIDDTRVWKNPTSTILVHALLIMLVWFPDLIVPTLAFYVFVIGAW  935

Query  2687  NYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQT  2866
             NYRFRS++ L HFD K+SLA+S DRDELDEEFD +P +RP +MVR RYDKLRMLGARVQT
Sbjct  936   NYRFRSKEPLPHFDPKLSLADSADRDELDEEFDPLPSSRPPEMVRTRYDKLRMLGARVQT  995

Query  2867  LLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLF  3046
             +LGD A+QGER+QALVTWRDPRATGIF+ LCFVVA ILY+VPSKM+AMA GFY+ RHP+F
Sbjct  996   VLGDFASQGERLQALVTWRDPRATGIFVGLCFVVAMILYMVPSKMVAMASGFYFFRHPIF  1055

Query  3047  RDRMPSPALNFFRRLPSLADRML  3115
             RDRMPSPALNFFRRLPSL+DR++
Sbjct  1056  RDRMPSPALNFFRRLPSLSDRIM  1078


 Score =   223 bits (567),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T++KLIVEV++ARNLLPKDG G+SSPYVVIDFYGQRK+T++ +RDLNP WNE LEFN+
Sbjct  1    MATKQKLIVEVVDARNLLPKDGRGSSSPYVVIDFYGQRKRTKSAIRDLNPTWNETLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++FGDMLELDVYHDKN GPT R+N LGR++L+++QFV+KGEEALIYYPLE+K LLS
Sbjct  61   GKPSNVFGDMLELDVYHDKNYGPTRRSNHLGRIRLSSSQFVRKGEEALIYYPLEKKYLLS  120

Query  497  WIQGDIGLKIYFVD  538
            W QGDIGL+IY+ D
Sbjct  121  WTQGDIGLRIYYQD  134



>ref|XP_004294491.1| PREDICTED: uncharacterized protein LOC101292876 [Fragaria vesca 
subsp. vesca]
Length=1040

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/799 (69%), Positives = 660/799 (83%), Gaps = 14/799 (2%)
 Frame = +2

Query  746   NDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAME---RSSFDL  916
             ND    M AS  + S+PE+K  GG+ GP+P++R PS     + +    +M     +SFDL
Sbjct  247   NDHIEMMSASSVSKSVPEIKFVGGINGPQPMARRPSGVPSYTQLEPTESMSIDRPTSFDL  306

Query  917   VEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDS  1096
             VEKMHYLFV++VKAR LP  GRPVVK+  S  HV S PARKT  FEWDQTFAFGR +PDS
Sbjct  307   VEKMHYLFVRVVKARYLPANGRPVVKISASNYHVTSTPARKTNCFEWDQTFAFGRQSPDS  366

Query  1097  SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG  1276
             +SILE+SVWDP      DPT   +GHNFLGG+CFDV+EIPLRDPPDSPLAPQWYRLEGGG
Sbjct  367   ASILEVSVWDPPIP---DPTGVASGHNFLGGVCFDVAEIPLRDPPDSPLAPQWYRLEGGG  423

Query  1277  AH-KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFA  1453
             +   GDLMLATW+GTQADESFPDAWKTDTAGNP +R+KVYQSPKLWYLR++V+EAQD+  
Sbjct  424   SRINGDLMLATWMGTQADESFPDAWKTDTAGNPNARAKVYQSPKLWYLRATVVEAQDVVP  483

Query  1454  LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHL  1633
             +T   KE++FQ+KAQLGFQ  KT+ + +  G+PSW++DL+FVAAEPFT+H  L F++E+ 
Sbjct  484   ITTSLKEATFQVKAQLGFQSLKTEASLTRNGTPSWHQDLIFVAAEPFTDH--LVFVLENR  541

Query  1634  PPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHV  1813
              PK    LG A IPL++IERRVDDR+V S+W + ED  +EKR+Y GR+H+RL FDGGYHV
Sbjct  542   QPKGTVTLGFAKIPLTAIERRVDDRKVASKWISLEDPKDEKRMYTGRLHVRLYFDGGYHV  601

Query  1814  IEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKW  1993
             ++EAAH+CSDYRPTARQLWKPPVGTVELGIIGCKNL+P+KT+ GKG TDAY VAKYGSKW
Sbjct  602   MDEAAHVCSDYRPTARQLWKPPVGTVELGIIGCKNLIPVKTVNGKGCTDAYCVAKYGSKW  661

Query  1994  VRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSKDV-----RMGKVRI  2158
             VRTRT+ D+L PRWNEQYT++V+DP TV++IGVFDS  V + +  +D      R+GKVR+
Sbjct  662   VRTRTVCDSLEPRWNEQYTFKVFDPCTVLSIGVFDSSGVFETDGPRDATRLDFRIGKVRV  721

Query  2159  RISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHH  2338
             RISTL TG+VY++T+ L++LSPAGLKKMGE+E+A+RF R +P LD +HVYSQP+LP+MHH
Sbjct  722   RISTLTTGRVYKHTYPLLVLSPAGLKKMGEVEIAIRFARVSPILDLVHVYSQPLLPLMHH  781

Query  2339  IRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRii  2518
             I+PLGA QQE LR AAVK++  HLSRSEPPL RE V YMLDADS  FSMRKVRAN+FRII
Sbjct  782   IKPLGAGQQEMLRRAAVKIVAAHLSRSEPPLGRETVLYMLDADSQGFSMRKVRANYFRII  841

Query  2519  nviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRF  2698
             NV+A V+D+V W +DTR+W+ P ATILVHALLVL VWFPDLIIPT  FYVF IGAWNYRF
Sbjct  842   NVVAGVMDIVGWINDTRSWKKPMATILVHALLVLFVWFPDLIIPTLLFYVFAIGAWNYRF  901

Query  2699  RSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGD  2878
             RSR  L HFD K+SLA+++DRDELDEE D VP +R  ++VRARYDKLR LGARVQT+LGD
Sbjct  902   RSRVPLQHFDPKLSLADTVDRDELDEEIDMVPSSRSYEVVRARYDKLRTLGARVQTVLGD  961

Query  2879  LATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRM  3058
              ATQGERVQALVTWRDPRATGIF+ LCFVVA +LYLVPSKM+AMAFGFYYLRHP+FRDR 
Sbjct  962   FATQGERVQALVTWRDPRATGIFVGLCFVVAMVLYLVPSKMVAMAFGFYYLRHPIFRDRT  1021

Query  3059  PSPALNFFRRLPSLADRML  3115
             PSPALNF RRLPSL+D++L
Sbjct  1022  PSPALNFMRRLPSLSDQLL  1040


 Score =   223 bits (569),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEV++AR+L PKDGHG  SPYV +D+YGQRK+T+TV++DLNP+WNE+LEFN+
Sbjct  1    MATVRKLIVEVVDARDLPPKDGHGTVSPYVQVDYYGQRKRTQTVIKDLNPKWNELLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGD+LELDVYHDKN GPTTRNNFLGR++L ++QFVKKGEEALIY+PL++K+L S
Sbjct  61   GKPSDVFGDVLELDVYHDKNYGPTTRNNFLGRLRLTSSQFVKKGEEALIYFPLQKKSLFS  120

Query  497  WIQGDIGLKIYFVD  538
            +IQGDIGLKIY+VD
Sbjct  121  FIQGDIGLKIYYVD  134



>ref|XP_002319150.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE95073.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1040

 Score =  1126 bits (2912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/803 (70%), Positives = 666/803 (83%), Gaps = 22/803 (3%)
 Frame = +2

Query  725   PSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSR-TPsvssfvsdvsdrsAMER  901
             P+P ++V         + +T S PE+K+ G +  P+P+ R     S++  +  +  ++ER
Sbjct  254   PAPPEIV---------AASTGSFPEIKVSG-INAPQPIIRPVAPTSNYTLEPQESISIER  303

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGR  1081
             S+FDLVEKMHYLFV++VKAR LPT+G PVV++ VS S V S+PARKTL FEWDQTFAFGR
Sbjct  304   SAFDLVEKMHYLFVRVVKARYLPTSGNPVVRIEVSNSRVQSKPARKTLCFEWDQTFAFGR  363

Query  1082  DAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYR  1261
             DAPDSSSI+EISVWDP   KS   +   A  NFLGGICFDV+EIPLRDPPDSPLAPQWYR
Sbjct  364   DAPDSSSIVEISVWDPHDPKS---SEMAAAANFLGGICFDVTEIPLRDPPDSPLAPQWYR  420

Query  1262  LEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQ  1441
             LEGGGA++ DLMLATWVGTQAD+SFPDAWKTDTAGN  SR+KVY SPKLWYLR++V+EAQ
Sbjct  421   LEGGGAYRSDLMLATWVGTQADDSFPDAWKTDTAGNINSRAKVYLSPKLWYLRATVLEAQ  480

Query  1442  DIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFL  1621
             DIF L  P KE++ Q+KAQLGFQVQKTK + S  G+PSWNEDL+FVAAEP ++   L F 
Sbjct  481   DIFPLM-PLKETAVQVKAQLGFQVQKTKTSVSRNGTPSWNEDLLFVAAEPCSDQ--LIFT  537

Query  1622  IEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDG  1801
             +E+  PK    +G+  I LS+ ERRVDDR+V SRWF+ ED   EK  Y+GRV LRLCFDG
Sbjct  538   LENRQPKGPVTIGMVRIALSATERRVDDRKVASRWFSLEDPRSEKAGYRGRVQLRLCFDG  597

Query  1802  GYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKY  1981
             GYHV++EAAH+ SDYRPTARQLWK PVGT ELGIIGCKNL PMKT+ GKG TDAY VAKY
Sbjct  598   GYHVMDEAAHMSSDYRPTARQLWKQPVGTFELGIIGCKNLSPMKTVDGKGCTDAYCVAKY  657

Query  1982  GSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMG  2146
             G KWVRTRT+ D+L P+WNEQYTW+VYDP TV+TIGVFDS  V + +  K     D RMG
Sbjct  658   GPKWVRTRTVCDSLDPKWNEQYTWKVYDPCTVLTIGVFDSSGVYEIDGDKTATRPDFRMG  717

Query  2147  KVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLP  2326
             KVR+R+STL TGKVYRN + LILL+  G+KKMGEIE+AV+F+R+TPTLDFLHVY+QP+LP
Sbjct  718   KVRVRLSTLETGKVYRNRYPLILLTNNGVKKMGEIEVAVKFVRATPTLDFLHVYTQPLLP  777

Query  2327  VMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANW  2506
             +MHH++PLG VQQE LR +AVK++ THLSRSEP LRREVV+YMLD D+H+FSMRK+RANW
Sbjct  778   LMHHLKPLGVVQQELLRNSAVKIIATHLSRSEPSLRREVVSYMLDVDTHAFSMRKIRANW  837

Query  2507  FRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAW  2686
              RIINVIA+VID+V+W DDTR W+NPT+T+LVHALL++LVWFPDLI+PT AFYVF+IGAW
Sbjct  838   IRIINVIASVIDIVRWIDDTRVWKNPTSTVLVHALLIMLVWFPDLIVPTLAFYVFVIGAW  897

Query  2687  NYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQT  2866
             NYRFRSR  L HFD K+SLA+S DRDELDEEFD +P +RP +MVR RYDK+RMLGARVQT
Sbjct  898   NYRFRSRAPLPHFDPKLSLADSADRDELDEEFDPLPSSRPPEMVRTRYDKMRMLGARVQT  957

Query  2867  LLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLF  3046
             +LGD ATQGER+QALVTWRDPRATGIF+ LCFVVA ILY+VPSKM+AMA GFY  RHP+F
Sbjct  958   VLGDFATQGERLQALVTWRDPRATGIFVGLCFVVAMILYMVPSKMVAMASGFYVFRHPIF  1017

Query  3047  RDRMPSPALNFFRRLPSLADRML  3115
             RDRMPSPALNFFRRLPSL+DR++
Sbjct  1018  RDRMPSPALNFFRRLPSLSDRIM  1040


 Score =   223 bits (568),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT++KLIVEV++ARNLLPKDGHG+SSPYVVIDFYGQRK+T++ +RDLNP WNE LEFN+
Sbjct  1    MGTKQKLIVEVVDARNLLPKDGHGSSSPYVVIDFYGQRKRTKSAIRDLNPTWNETLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++FGDMLELDVYHDKN GPT R N LGR++L+++QFV+KGEEALIYYPLE+K L S
Sbjct  61   GKPSNVFGDMLELDVYHDKNYGPTRRINHLGRIRLSSSQFVRKGEEALIYYPLEKKYLFS  120

Query  497  WIQGDIGLKIYFVD  538
            W QG+IGL+IY+ D
Sbjct  121  WTQGEIGLRIYYQD  134



>ref|XP_011034405.1| PREDICTED: uncharacterized protein LOC105132538 isoform X2 [Populus 
euphratica]
Length=1066

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/777 (71%), Positives = 653/777 (84%), Gaps = 12/777 (2%)
 Frame = +2

Query  803   KIGGGLVGPKPLSR-TPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAG  979
             +I  G+  P+P+ R     S++  +  +  ++ERS+FDLVEKMHYLFV++VKAR LPT+G
Sbjct  296   EIVSGINAPQPMIRPVAPTSNYTLEPQESISIERSAFDLVEKMHYLFVRVVKARYLPTSG  355

Query  980   RPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTS  1159
              PVV++ VS S V S+PARKTL FEWDQTFAFGRDAPDSSSI+EISVWDP   +S   + 
Sbjct  356   NPVVRIEVSNSRVQSKPARKTLCFEWDQTFAFGRDAPDSSSIVEISVWDPHDPQS---SE  412

Query  1160  DVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFP  1339
               A  NFLGGICFDV+EIPLRDPPDSPLAPQWYRLEGGGA+  DLMLATWVGTQAD+SFP
Sbjct  413   MAAAANFLGGICFDVTEIPLRDPPDSPLAPQWYRLEGGGAYGSDLMLATWVGTQADDSFP  472

Query  1340  DAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQK  1519
             DAWKTDTAGN  SR+KVY SPKLWYLR++V+EAQDIF L  P KE++ Q+KAQLGFQVQK
Sbjct  473   DAWKTDTAGNINSRAKVYLSPKLWYLRATVLEAQDIFPLM-PLKETAVQVKAQLGFQVQK  531

Query  1520  TKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRV  1699
             TK + S  G+PSWNEDL+FV+AEP ++   L F +E+  PK    +G+  I LS+IERRV
Sbjct  532   TKTSVSRNGTPSWNEDLLFVSAEPCSDQ--LIFTLENRQPKGPVTIGMVRIALSAIERRV  589

Query  1700  DDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPP  1879
             DDR+V SRWF+ ED   EK  Y+GRV LRLCFDGGYHV++EAAH+ SDYRPTARQLWK P
Sbjct  590   DDRKVASRWFSLEDPRSEKEGYRGRVQLRLCFDGGYHVMDEAAHMSSDYRPTARQLWKQP  649

Query  1880  VGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRV  2059
             VGT ELGIIGCKNL PMKT+ GKG TDAY VAKYG KWVRTRT+ D+L P+WNEQYTW+V
Sbjct  650   VGTFELGIIGCKNLSPMKTVDGKGCTDAYCVAKYGPKWVRTRTVCDSLDPKWNEQYTWKV  709

Query  2060  YDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVYRNTFSLILLSP  2224
             YDP TV+TIGVFDS  V + +  K     D RMGKVR+R+STL T KVYRN F LILL+ 
Sbjct  710   YDPCTVLTIGVFDSSGVYEIDGDKTATRPDFRMGKVRVRLSTLETAKVYRNRFPLILLTN  769

Query  2225  AGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTT  2404
              G+KKMGEIE+AV+F+R+TPTLDFLHVY+QP+LP+MHH++PLG VQQE LR  AVK++ T
Sbjct  770   NGVKKMGEIEVAVKFVRATPTLDFLHVYTQPLLPLMHHLKPLGVVQQELLRNTAVKIIAT  829

Query  2405  HLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNP  2584
             HLSRSEP LRREVV+YMLD D+H+FSMRK+RANW RIINVIA+VID+V+W DDTR W+NP
Sbjct  830   HLSRSEPSLRREVVSYMLDVDTHAFSMRKIRANWIRIINVIASVIDIVRWIDDTRVWKNP  889

Query  2585  TATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRD  2764
             T+TILVHALL++LVWFPDLI+PT AFYVF+IGAWNYRFRS++ L HFD K+SLA+S DRD
Sbjct  890   TSTILVHALLIMLVWFPDLIVPTLAFYVFVIGAWNYRFRSKEPLPHFDPKLSLADSADRD  949

Query  2765  ELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGI  2944
             ELDEEFD +P +RP +MVR RYDKLRMLGARVQT+LGD A+QGER+QALVTWRDPRATGI
Sbjct  950   ELDEEFDPLPSSRPPEMVRTRYDKLRMLGARVQTVLGDFASQGERLQALVTWRDPRATGI  1009

Query  2945  FIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             F+ LCFVVA ILY+VPSKM+AMA GFY+ RHP+FRDRMPSPALNFFRRLPSL+DR++
Sbjct  1010  FVGLCFVVAMILYMVPSKMVAMASGFYFFRHPIFRDRMPSPALNFFRRLPSLSDRIM  1066


 Score =   222 bits (566),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T++KLIVEV++ARNLLPKDG G+SSPYVVIDFYGQRK+T++ +RDLNP WNE LEFN+
Sbjct  1    MATKQKLIVEVVDARNLLPKDGRGSSSPYVVIDFYGQRKRTKSAIRDLNPTWNETLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K S++FGDMLELDVYHDKN GPT R+N LGR++L+++QFV+KGEEALIYYPLE+K LLS
Sbjct  61   GKPSNVFGDMLELDVYHDKNYGPTRRSNHLGRIRLSSSQFVRKGEEALIYYPLEKKYLLS  120

Query  497  WIQGDIGLKIYFVD  538
            W QGDIGL+IY+ D
Sbjct  121  WTQGDIGLRIYYQD  134



>ref|XP_010549688.1| PREDICTED: uncharacterized protein LOC104820783 [Tarenaya hassleriana]
Length=1042

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 552/787 (70%), Positives = 655/787 (83%), Gaps = 19/787 (2%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKA  958
             + S+PE KIGG +  P+P+ RT    +S+ S++SD S +ER++FDLVEKMHY+FV++VKA
Sbjct  266   SGSIPETKIGG-IGAPQPIRRTMSETASYTSEISDASTIERTTFDLVEKMHYVFVRVVKA  324

Query  959   RSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSS-ILEISVWDPLS  1135
             RSLP +G PV K+ +SG+ + S+PARKT  FEWDQTFAF RD+PDSSS ILEISVWD  S
Sbjct  325   RSLPISGNPVTKISLSGTQIRSKPARKTTCFEWDQTFAFLRDSPDSSSSILEISVWDSDS  384

Query  1136  SKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVG  1315
                 D  S      FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH GDLMLATW G
Sbjct  385   PAGSDAAS------FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHGDLMLATWTG  438

Query  1316  TQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQI  1489
             TQADESFPDAWKTDT GN  +R+KVY SPKLWYLR++VIEAQD+    LTA  K+++FQ+
Sbjct  439   TQADESFPDAWKTDTVGNVNARAKVYVSPKLWYLRATVIEAQDVLPPQLTA-LKDATFQV  497

Query  1490  KAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVAS  1669
             KAQLGFQVQKTKPA +  G PSWNEDL+FVAAEPFT+   L F +EH  PK    +G   
Sbjct  498   KAQLGFQVQKTKPAVTRNGVPSWNEDLLFVAAEPFTDQ--LIFTLEHRTPKGPVTVGKVR  555

Query  1670  IPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYR  1849
             +PL++IERRVD+R V SRWF FED ++EKR ++ R HLRLCFDGGYHV++EAAH+CSDYR
Sbjct  556   VPLTAIERRVDERHVASRWFGFEDTSDEKRGFRSRAHLRLCFDGGYHVMDEAAHVCSDYR  615

Query  1850  PTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCP  2029
             PTARQLW PPVGT+ELGIIGCKNLLPMKT+ GKGSTDAY VAKYG KWVRTRT+SD+L P
Sbjct  616   PTARQLWTPPVGTMELGIIGCKNLLPMKTVDGKGSTDAYTVAKYGPKWVRTRTVSDSLDP  675

Query  2030  RWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVYR  2194
             +WNEQYT++VYDP TV+TIGVFDSW V + +  K     D+R+GKVRIRISTL TGK YR
Sbjct  676   KWNEQYTFKVYDPCTVLTIGVFDSWGVYENDVGKEATRPDLRIGKVRIRISTLETGKPYR  735

Query  2195  NTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESL  2374
             NT+ L++L   G+K+MGEIELAVRF+RS+  LD LHVY+QP+LP+MHHI+PLG +QQE L
Sbjct  736   NTYPLMMLGNGGVKRMGEIELAVRFVRSSQPLDLLHVYTQPLLPLMHHIKPLGLLQQEML  795

Query  2375  RTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKW  2554
             R  AVK+++ HL RSEPPLR EVV YMLDADSH+FSMRK+RANW RI+NVI  +I++V+W
Sbjct  796   RNNAVKIMSVHLLRSEPPLRPEVVRYMLDADSHAFSMRKIRANWLRIVNVIGGMIELVRW  855

Query  2555  ADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTK  2734
              D+TR W+N TATILVHAL V+LVWFPDLIIPT AFYVF++GAWNYRFRSR  + HFD K
Sbjct  856   VDNTRLWKNSTATILVHALFVMLVWFPDLIIPTLAFYVFVVGAWNYRFRSRAPVPHFDPK  915

Query  2735  ISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALV  2914
             +SLA+++D DELDEEFD VP  RP D VRARYDKLR +GARVQT+LGD+A QGERVQAL+
Sbjct  916   LSLADTVDHDELDEEFDVVPSNRPPDAVRARYDKLRAVGARVQTVLGDMAAQGERVQALL  975

Query  2915  TWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLP  3094
             TWRDPRATGIF+ LCFVVA +LYLVP+KM+AMA GFYY RHP+FRDR PSPALNFFRRLP
Sbjct  976   TWRDPRATGIFVGLCFVVALMLYLVPTKMVAMALGFYYFRHPIFRDRKPSPALNFFRRLP  1035

Query  3095  SLADRML  3115
             SL+DR++
Sbjct  1036  SLSDRIM  1042


 Score =   194 bits (494),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L P+DG G+SSPYVVID+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATTRKLVVEVVDAKDLAPRDGQGSSSPYVVIDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH-SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
            +K  S +  D+LELD++HDKN GP  RN+FLGR++L + QFV KGEEALIYYPLE+K L 
Sbjct  61   AKRPSQVVSDVLELDMFHDKNFGPIRRNSFLGRIRLGSGQFVSKGEEALIYYPLEKKYLF  120

Query  494  SWIQGDIGLKIYFVD  538
            S +QG+IGL+IY+ D
Sbjct  121  SPVQGEIGLRIYYSD  135



>ref|XP_010420533.1| PREDICTED: uncharacterized protein LOC104706100 [Camelina sativa]
Length=1053

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/800 (69%), Positives = 655/800 (82%), Gaps = 27/800 (3%)
 Frame = +2

Query  770   ASVATASMPEVKIGGGL--------VGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVE  922
             AS   + +PEV I   +         GP+PL R+    +S+ S++SD S +ERS+FDLVE
Sbjct  263   ASAPRSPLPEVTISRSVSGSIPENKTGPQPLRRSLSETASYTSEISDVSTIERSTFDLVE  322

Query  923   KMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--S  1096
             KMHY+FV++VKARSLPT+G PV K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD  S
Sbjct  323   KMHYVFVRVVKARSLPTSGSPVTKISLSGTMIQSKPARKTTCFEWDQTFAFLRDSPDLSS  382

Query  1097  SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG  1276
             S ILEISVW+  S      T+ +    FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG
Sbjct  383   SPILEISVWNDSS------TTGIETSQFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG  436

Query  1277  AHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--  1450
             AH  DLMLATW GTQADESFPDAWKTDTAGN T+R+KVY S KLWYLR++VIEAQD+   
Sbjct  437   AHHSDLMLATWTGTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLRATVIEAQDLLPP  496

Query  1451  ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEH  1630
              LTA  KE+SFQ+KAQLGFQVQKTK A +  G+PSWNEDL+FVAAEPF++   L F +E+
Sbjct  497   QLTA-FKEASFQLKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVAAEPFSDQ--LVFTLEY  553

Query  1631  LPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYH  1810
                K    +G+A +PL+ IERRVDDR V SRWF FED NEEKR  + RVHLRLCFDGGYH
Sbjct  554   RTSKGPVTVGMARVPLTEIERRVDDRLVASRWFGFEDPNEEKRGNRARVHLRLCFDGGYH  613

Query  1811  VIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSK  1990
             V++EAAH+CSDYRPTARQLWKP VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYG+K
Sbjct  614   VMDEAAHVCSDYRPTARQLWKPAVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGTK  673

Query  1991  WVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVR  2155
             WVRTRT+SD+L PRWNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVR
Sbjct  674   WVRTRTVSDSLDPRWNEQYTWKVYDPCTVLTIGVFDSWGVFEIDGGKEATRQDLRIGKVR  733

Query  2156  IRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMH  2335
             IRISTL TGK YRNT+ L++L   G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MH
Sbjct  734   IRISTLETGKAYRNTYPLLMLVNGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMH  793

Query  2336  HIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRi  2515
             HI+PL   Q+E LR  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI
Sbjct  794   HIKPLSLFQEEMLRNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRI  853

Query  2516  inviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYR  2695
             +NV+A ++DVV+W DDTR W+NPT+T+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYR
Sbjct  854   VNVVAGMVDVVRWVDDTRYWKNPTSTLLVHALVVMLIWFPDLIVPTLAFYLFVIGAWNYR  913

Query  2696  FRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLG  2875
             FRSR  L HFD ++SLA++ DR+ELDEEFD VP  RP +MVR+RYDKLR +G RVQT+LG
Sbjct  914   FRSRAGLPHFDPRLSLADAADREELDEEFDVVPSNRPPEMVRSRYDKLRGVGVRVQTILG  973

Query  2876  DLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDR  3055
             ++A QGE++QALVTWRDPRATGIF+ LC  VA +LYLVP+KM+AMA GFYY RHP+FRDR
Sbjct  974   EVAAQGEKMQALVTWRDPRATGIFVGLCLFVALVLYLVPTKMVAMASGFYYFRHPIFRDR  1033

Query  3056  MPSPALNFFRRLPSLADRML  3115
              PSP LNFFRRLPSL+DR++
Sbjct  1034  KPSPVLNFFRRLPSLSDRLM  1053


 Score =   202 bits (515),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MTTNRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LELD+YHDKN GPT RNNFLGR++L + QFV KGEEALIYYPLE+K+L
Sbjct  61   AKRPSHQVFTDVLELDMYHDKNFGPTRRNNFLGRIRLGSDQFVGKGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRLYYAD  136



>emb|CDY25472.1| BnaC09g39870D [Brassica napus]
Length=1001

 Score =  1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/788 (69%), Positives = 657/788 (83%), Gaps = 29/788 (4%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKA  958
             + S+P+ K GG    P+PL R+    +S+ S++SD S +ERS+FDLVEKMHY+FV++VKA
Sbjct  233   SGSIPKTKTGG----PQPLPRSMSETASYTSEISDVSTIERSTFDLVEKMHYVFVRVVKA  288

Query  959   RSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSS--ILEISVWDPL  1132
             RSLPT+G P+ K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD+SS  ILEISVW+  
Sbjct  289   RSLPTSGSPITKISLSGTTIESKPARKTSTFEWDQTFAFLRDSPDTSSSPILEISVWE--  346

Query  1133  SSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWV  1312
                         G +FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH GDLMLATW 
Sbjct  347   ---------GTGGTHFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHGDLMLATWT  397

Query  1313  GTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQ  1486
             GTQADESFPDAWKTDTAGN T+R+KVY SPKLWYLR++V++AQD+    LTA  KE+SFQ
Sbjct  398   GTQADESFPDAWKTDTAGNVTARAKVYMSPKLWYLRATVMDAQDLLLPQLTA-FKEASFQ  456

Query  1487  IKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVA  1666
             +KAQLGFQVQKTKPA +  G+PSWNEDL+FVAAEPF +   L F +E+   K    +G+A
Sbjct  457   LKAQLGFQVQKTKPAVTRNGAPSWNEDLLFVAAEPFADQ--LVFTLEYRTSKGPVTVGMA  514

Query  1667  SIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDY  1846
              +PL++IERRVD+R V SRWF FED N+EKR  + RVHLRLCFDGGYHV++EAAH+CSDY
Sbjct  515   RVPLTAIERRVDERLVASRWFGFEDPNDEKRGNRSRVHLRLCFDGGYHVMDEAAHVCSDY  574

Query  1847  RPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLC  2026
             RPTARQLWKP VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYGSKWVRTRT+SD+L 
Sbjct  575   RPTARQLWKPAVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGSKWVRTRTVSDSLD  634

Query  2027  PRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVY  2191
             P+WNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVR+RISTL TGK Y
Sbjct  635   PKWNEQYTWKVYDPCTVLTIGVFDSWGVYEIDGGKEATRQDLRIGKVRLRISTLETGKAY  694

Query  2192  RNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQES  2371
             RNT+ L++L   G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MHHI+PL   Q++ 
Sbjct  695   RNTYPLLMLVNGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMHHIKPLTLFQEDM  754

Query  2372  LRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvK  2551
             LR  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A +IDVV+
Sbjct  755   LRNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMIDVVR  814

Query  2552  WADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDT  2731
             W DDTR WRNPTAT+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYRFRSR  L HFD 
Sbjct  815   WVDDTRFWRNPTATLLVHALVVMLIWFPDLIVPTIAFYLFVIGAWNYRFRSRAGLPHFDP  874

Query  2732  KISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQAL  2911
             ++SLA++ DR+ELDEEFD VP  RP +MVR+RYDKLR  GARVQT+LG++A QGE++QAL
Sbjct  875   RLSLADAADREELDEEFDVVPSNRPPEMVRSRYDKLRA-GARVQTILGEVAAQGEKMQAL  933

Query  2912  VTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRL  3091
             VTWRDPRATGIF+ LCFVVA +LYLVP+KM+AMA GFYY RHP+FRDR PSP +NFFRRL
Sbjct  934   VTWRDPRATGIFVGLCFVVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPMINFFRRL  993

Query  3092  PSLADRML  3115
             PSL+DR++
Sbjct  994   PSLSDRLM  1001


 Score =   196 bits (498),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VE+++A++L PKDG G SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATTRKLVVEIVDAKDLTPKDGQGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNESLEFSL  60

Query  317  SKHSD--IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LE+D++HDKN GPT RNNFLGR++L + QFV KGEEALIY+PLE+K+L
Sbjct  61   AKKPSHPVFNDVLEIDMFHDKNFGPTRRNNFLGRIRLGSDQFVAKGEEALIYFPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IG++IY+ D
Sbjct  121  FNLVQGEIGIRIYYAD  136



>ref|XP_002871792.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48051.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1053

 Score =  1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/788 (69%), Positives = 654/788 (83%), Gaps = 26/788 (3%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKA  958
             + S+PE+K      GP+PL R+    +S+ S++SD S +ERS+FDLVEKMHY+FV++VKA
Sbjct  282   SGSIPEIK-----NGPQPLRRSISETASYTSEISDVSTIERSTFDLVEKMHYVFVRVVKA  336

Query  959   RSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--SSSILEISVWDPL  1132
             RSLPT+G P+ K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD  SS ILEISVWD  
Sbjct  337   RSLPTSGSPITKISLSGTMIQSKPARKTSCFEWDQTFAFLRDSPDLSSSPILEISVWD--  394

Query  1133  SSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWV  1312
             SS   + +       FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH  DLMLATW 
Sbjct  395   SSTGFETS------QFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHNSDLMLATWT  448

Query  1313  GTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQ  1486
             GTQADESFPDAWKTDTAGN T+R+KVY S KLWYLR++VIEAQD+    LT   KE+SFQ
Sbjct  449   GTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLRAAVIEAQDLLPPQLTE-FKEASFQ  507

Query  1487  IKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVA  1666
             +KAQLGFQVQKTK A +  G+PSWNEDL+FVAAEPF++   L F +E+   K    +G+A
Sbjct  508   LKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVAAEPFSDQ--LVFTLEYRTSKGPVTVGMA  565

Query  1667  SIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDY  1846
              +PL+SIERRVDDR V SRWF FED N+EKR  + RVHLRLCFDGGYHV++EA H+CSDY
Sbjct  566   RVPLTSIERRVDDRLVASRWFGFEDPNDEKRGNRSRVHLRLCFDGGYHVMDEAVHVCSDY  625

Query  1847  RPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLC  2026
             RPTARQLWKP VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYG+KWVRTRT+SD+L 
Sbjct  626   RPTARQLWKPAVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGTKWVRTRTVSDSLD  685

Query  2027  PRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVY  2191
             P+WNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVRIRISTL TGK Y
Sbjct  686   PKWNEQYTWKVYDPCTVLTIGVFDSWGVFEIDGGKEATRQDLRIGKVRIRISTLETGKAY  745

Query  2192  RNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQES  2371
             RNT+ L++L   G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MHHI+PL  +Q+E 
Sbjct  746   RNTYPLLMLVNGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMHHIKPLSLIQEEM  805

Query  2372  LRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvK  2551
             LR AAVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A ++D+V+
Sbjct  806   LRNAAVKILAAHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMVDIVR  865

Query  2552  WADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDT  2731
             W DDTR W+NPT+T+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYRFRSR  L HFD 
Sbjct  866   WVDDTRFWKNPTSTLLVHALVVMLIWFPDLIVPTLAFYLFVIGAWNYRFRSRAALPHFDP  925

Query  2732  KISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQAL  2911
             ++SLA++ DR+ELDEEFD VP  RP +MVR RYDKLR +GARVQT+LG++A QGE++QAL
Sbjct  926   RLSLADAADREELDEEFDVVPSNRPPEMVRLRYDKLRNVGARVQTILGEVAAQGEKMQAL  985

Query  2912  VTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRL  3091
             VTWRDPRATGIF+ LC  VA +LYLVP+KM+AMA GFYY RHP+FRDR PSP LNFFRRL
Sbjct  986   VTWRDPRATGIFVGLCLFVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPVLNFFRRL  1045

Query  3092  PSLADRML  3115
             PSL+DR++
Sbjct  1046  PSLSDRLM  1053


 Score =   199 bits (505),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYV++D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATTRKLVVEVVDAKDLTPKDGHGTSSPYVIVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LELD+YHDKN G T RNNFLGR++L   QFV KGEEALIYYPLE+K+L
Sbjct  61   AKRPSHQLFADVLELDMYHDKNFGQTRRNNFLGRIRLGPDQFVGKGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRVYYAD  136



>ref|XP_010677826.1| PREDICTED: uncharacterized protein LOC104893417 [Beta vulgaris 
subsp. vulgaris]
Length=1038

 Score =  1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/795 (70%), Positives = 652/795 (82%), Gaps = 14/795 (2%)
 Frame = +2

Query  758   VEMKASVATASMPEVKIG---GGLVGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKM  928
             VEM AS  + ++PEVK     G    P          S  +   +   +ER++FDLVEKM
Sbjct  249   VEMMASAVSGTIPEVKFADDAGLKPPPSMPPTPAISRSVSTASFESVPIERTTFDLVEKM  308

Query  929   HYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSSIL  1108
             HYLFV++VKARSLPT G PVVK+V S   V+S+PARKT  FEW QTFAF RD+PDSS+IL
Sbjct  309   HYLFVRVVKARSLPTNGCPVVKIVASTHRVVSKPARKTNFFEWGQTFAFARDSPDSSTIL  368

Query  1109  EISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKG  1288
             E+SVWDP   ++ DP   ++   FLGGICFD +EIPLRDPPDSPLAPQWYRLEGGGAH G
Sbjct  369   EVSVWDPPHPEAADPMEGLSMREFLGGICFDTTEIPLRDPPDSPLAPQWYRLEGGGAHSG  428

Query  1289  DLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPS  1468
             DLMLATWVGTQAD+SFPDAWKTDT G+ +SR+KVY SPKLWYLR++++EAQDI      S
Sbjct  429   DLMLATWVGTQADDSFPDAWKTDTTGSVSSRAKVYLSPKLWYLRATILEAQDILF---GS  485

Query  1469  KESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQ  1648
             KES FQ+KAQLGFQ+ KTKP +S  GSP WNEDL+FVAAEPF +  +L   +EH  PK  
Sbjct  486   KESMFQVKAQLGFQIFKTKPTASRNGSPIWNEDLMFVAAEPFGDQLVL--TLEHRGPKGS  543

Query  1649  AVLGVASIPLSSIERRVDDRQVISRWFTFEDQN-EEKRVYKGRVHLRLCFDGGYHVIEEA  1825
              V+GVA + L++IERRVDDR V+ +WFTF+D + +  ++YK RV LRLCFDGGYHV+EEA
Sbjct  544   IVVGVARVALTTIERRVDDRNVLGKWFTFDDPSCDGNKMYKARVQLRLCFDGGYHVMEEA  603

Query  1826  AHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTR  2005
             AH+CSDYRPTARQLWK  VG VELGIIGC+NLLP K + GKGSTDAYA+AKYG KWVRTR
Sbjct  604   AHVCSDYRPTARQLWKAAVGMVELGIIGCRNLLPAKAVNGKGSTDAYAIAKYGPKWVRTR  663

Query  2006  TISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPEN-----SKDVRMGKVRIRIST  2170
             T+SD L P+WNEQYTW+VYDP TV+TIGVFDS  + + E        D+R+GKVR+RIST
Sbjct  664   TVSDCLDPKWNEQYTWKVYDPCTVLTIGVFDSSGIFESEEPLEGMHPDLRIGKVRVRIST  723

Query  2171  LATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPL  2350
             L TG+VYRNT+ L+ L+P GLKKMG+IELAVRF+RS P+LD L+VYSQP+LP+MHHI+PL
Sbjct  724   LQTGRVYRNTYPLLSLTPMGLKKMGDIELAVRFVRSMPSLDVLNVYSQPLLPLMHHIKPL  783

Query  2351  GAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinvia  2530
                QQE LR AAVK+L  HLSRSEPPLR+E+V YMLDADSH+FSMRKVRANWFRIIN++A
Sbjct  784   ALGQQEMLRNAAVKILVVHLSRSEPPLRQEIVRYMLDADSHTFSMRKVRANWFRIINLVA  843

Query  2531  avidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRD  2710
              +ID+VKW +DTR W+NPT+TILVHALLV+LVWFPDLIIPT AFYVF+IGAWNYRFRSRD
Sbjct  844   GMIDIVKWVEDTRTWKNPTSTILVHALLVVLVWFPDLIIPTLAFYVFVIGAWNYRFRSRD  903

Query  2711  KLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQ  2890
              L HFD KISLAE+IDRDELDEEFD +P  RP+++VR RYDKLR LGARVQT+LGDLATQ
Sbjct  904   PLPHFDPKISLAENIDRDELDEEFDIIPSNRPSEIVRTRYDKLRTLGARVQTVLGDLATQ  963

Query  2891  GERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPA  3070
             GERVQALVTWRDPRATGIF+ LCFVVA ILYLVPSKM+A+A GFYYLRHP+FRDR PSPA
Sbjct  964   GERVQALVTWRDPRATGIFVGLCFVVAIILYLVPSKMVALASGFYYLRHPMFRDRAPSPA  1023

Query  3071  LNFFRRLPSLADRML  3115
             +NF RRLPS +DR+L
Sbjct  1024  INFIRRLPSQSDRIL  1038


 Score =   214 bits (544),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEV++A+NLLPKDGHG SSPYVV+DFYGQRK+T+TV+RDLNP WNE LEFN+
Sbjct  1    MATVRKLIVEVVDAKNLLPKDGHGTSSPYVVVDFYGQRKRTQTVVRDLNPAWNEALEFNM  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNAT--QFVKKGEEALIYYPLERKNL  490
               S +FGD LE++VYHDKN GPT R+N LGRV+L++   QFVKKGEEAL+Y+PLE+K L
Sbjct  61   GGPSTVFGDTLEVEVYHDKNYGPTRRHNHLGRVRLSSASFQFVKKGEEALMYFPLEKKYL  120

Query  491  LSWIQGDIGLKIYFVD  538
            LSWIQGDIGLKIY+ D
Sbjct  121  LSWIQGDIGLKIYYSD  136



>ref|XP_003542167.1| PREDICTED: uncharacterized protein LOC100787960 [Glycine max]
Length=1009

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/803 (68%), Positives = 664/803 (83%), Gaps = 28/803 (3%)
 Frame = +2

Query  749   DGAVEMKASVATASMPEVKIGG---GLVGPKPLSRTPsvssfvsdvs------drsAMER  901
             D  +++KA+  + S  E++  G   G   P+P+ R+ S +SF +  +        + MER
Sbjct  221   DPLLDVKAASVSRSNSEIRFNGTNNGPAPPQPMRRSASTASFAASEASSETSSMMTMMER  280

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-gshvisRPARK-TLLFEWDQTFAF  1075
             SSFDLVEKMHYLFV +VKAR LPT G PVVK+ VS   HV S PARK T+LFEW+QTFAF
Sbjct  281   SSFDLVEKMHYLFVHVVKARYLPTNGNPVVKIAVSGQHHVTSMPARKSTVLFEWNQTFAF  340

Query  1076  GRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQW  1255
              RDAPDSSS+LE+S WDP +S++L           LGG+CFDV+EIP+RDPPDSPLAPQW
Sbjct  341   ARDAPDSSSVLEVSAWDPQASEAL-----------LGGVCFDVNEIPVRDPPDSPLAPQW  389

Query  1256  YRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIE  1435
             YRLEGGGA  GDLM+ATW+GTQADESFPDAWK+DT  +  SR+KVYQSPKLWYLR++++E
Sbjct  390   YRLEGGGALHGDLMIATWMGTQADESFPDAWKSDTFAHVNSRAKVYQSPKLWYLRATLLE  449

Query  1436  AQDIFAL-TAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWN-EDLVFVAAEPFTEHYL  1609
             AQD+F L    SKES F++KA+LGFQV K+K   +  G+ SWN ED +FV AEP ++H  
Sbjct  450   AQDVFLLPLTSSKESCFRVKAKLGFQVLKSKTVVTRNGTVSWNNEDFIFVVAEPVSDH--  507

Query  1610  LFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRL  1789
             L F +E+  P     +GV  IPL +IERRVDDR V SRWFTF++++++K   + RVHLRL
Sbjct  508   LMFTLENRQPDAPVTIGVLRIPLLAIERRVDDRSVASRWFTFDNESDDKASSRPRVHLRL  567

Query  1790  CFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYA  1969
             CFDGGYHV++EAAH+CSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKT+ GK S DAY 
Sbjct  568   CFDGGYHVMDEAAHVCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTVNGKSSMDAYC  627

Query  1970  VAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSKDVRMGK  2149
             VAKYGSKWVRTRT+SDN+ P+WNEQYTW+VYDPSTV+TIGVFDS  ++D +N K+  +GK
Sbjct  628   VAKYGSKWVRTRTVSDNMEPKWNEQYTWKVYDPSTVLTIGVFDS-SLLDMDNDKNTLIGK  686

Query  2150  VRIRISTLATGKVYRNTFSLILLSP-AGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLP  2326
             VR+RISTL TG+VY+NT+ L++LSP +GLKKMGEIE+A+RF+R+T  LDFLHVYSQPMLP
Sbjct  687   VRVRISTLHTGRVYKNTYPLLVLSPVSGLKKMGEIEIAIRFVRTTQRLDFLHVYSQPMLP  746

Query  2327  VMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANW  2506
             +MHH++PLG VQQE+LR   V+++  HLSR+EPPLR+EVV YMLDADSH+FSMRKVRANW
Sbjct  747   LMHHVKPLGVVQQEALRNTTVRMVAGHLSRAEPPLRKEVVFYMLDADSHNFSMRKVRANW  806

Query  2507  FRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAW  2686
             +RIINVIAAV+D+V+W + TR WRNPTATILVHALLV+LVWFPDLIIPTF FYVF +GAW
Sbjct  807   YRIINVIAAVVDIVRWIEHTRGWRNPTATILVHALLVMLVWFPDLIIPTFCFYVFAVGAW  866

Query  2687  NYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQT  2866
             NYRFR+RD L HFD KISLAE +DR+ELDEEFD VP  + +++VR RYD+LR LGARVQT
Sbjct  867   NYRFRARDPLPHFDPKISLAEVVDREELDEEFDTVPSNKASEVVRVRYDRLRALGARVQT  926

Query  2867  LLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLF  3046
             +LGDLATQGERVQALVTWRDPRATGIF+ LC  VAF+LYLVPSKM+AMAFGFYYLRHP+F
Sbjct  927   VLGDLATQGERVQALVTWRDPRATGIFVFLCLTVAFMLYLVPSKMVAMAFGFYYLRHPIF  986

Query  3047  RDRMPSPALNFFRRLPSLADRML  3115
             RDR+PSPALNFFRRLPSL+DR++
Sbjct  987   RDRLPSPALNFFRRLPSLSDRIM  1009


 Score =   198 bits (504),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MG+ RKLIVEV++A NL+PKDGHG SSPYVV+DF+GQR+KTRT +RDLNP W E L FN+
Sbjct  1    MGSVRKLIVEVVDAHNLVPKDGHGTSSPYVVVDFHGQRRKTRTAVRDLNPVWKETLSFNV  60

Query  317  ----SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERK  484
                S+ S IFGD LELDVYHDK+ G T R+N LGR++L++ QFV KGEEAL+YY LE+K
Sbjct  61   DNVNSQSSQIFGDTLELDVYHDKSYGSTRRHNSLGRIRLSSAQFVNKGEEALVYYVLEKK  120

Query  485  NLLSWIQGDIGLKIYFVD  538
             LLS IQG+IGLKIY+VD
Sbjct  121  YLLSMIQGEIGLKIYYVD  138



>ref|XP_004489683.1| PREDICTED: uncharacterized protein LOC101501960 [Cicer arietinum]
Length=1022

 Score =  1093 bits (2828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/809 (68%), Positives = 660/809 (82%), Gaps = 24/809 (3%)
 Frame = +2

Query  713   DPVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsA  892
             DPVD  P ++      EM  +  + S  E++  G    P+P+ R+ S++SF S+ S  S 
Sbjct  230   DPVDALPPEVF-----EMATASISRSNSEIRFNG----PQPIRRSASMASFTSEASVDSM  280

Query  893   M-ERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             + ERSSFDLV+KMHYLFV++VKAR LPT G P+VK+ VSG HV S+PARKT LFEW+QTF
Sbjct  281   LIERSSFDLVDKMHYLFVRVVKARYLPTNGNPIVKIAVSGDHVSSKPARKTTLFEWNQTF  340

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF RDA DSS ILEI+VWDP         +DV G + LGG+CFDV+EIP+RDPPDSPLAP
Sbjct  341   AFSRDAHDSSPILEITVWDP------QIVADVDGRDLLGGVCFDVNEIPVRDPPDSPLAP  394

Query  1250  QWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSV  1429
             QWYR+EGGGA  GDLM+ATW+GTQAD+SF DAWK+DT  +  S++KVYQSPKLWYLR ++
Sbjct  395   QWYRMEGGGAQHGDLMIATWIGTQADDSFCDAWKSDTYNHVNSKAKVYQSPKLWYLRVTI  454

Query  1430  IEAQDIFALTAPSKES--SFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEH  1603
             +EAQDI   T P KE+   FQ+KAQ GFQV K+K A +  G  SWNEDL+FVAAEP T  
Sbjct  455   LEAQDITPST-PLKEAWFQFQVKAQFGFQVLKSKTAVTKNGVVSWNEDLLFVAAEPITVS  513

Query  1604  YLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED-QNEEKRVYKGRVH  1780
               + F +E+  PK    +GV  IPL+S+ERRVDDR + SRWFTFED  NE+K  YKGRVH
Sbjct  514   DYIVFSLENRQPKAPVTMGVVRIPLTSVERRVDDRNIGSRWFTFEDPNNEKKNGYKGRVH  573

Query  1781  LRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTD  1960
             LRLCFDGGYHV++EAAH+ SDYRPTARQLWKPPVGT+ELGIIGCKNL+PMKT+ GK STD
Sbjct  574   LRLCFDGGYHVMDEAAHVSSDYRPTARQLWKPPVGTIELGIIGCKNLIPMKTINGKSSTD  633

Query  1961  AYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK---  2131
              Y VAKYGSKWVRTRT+SDNL P+WNEQYTW+V+DPSTV+TIGVFDS+ V + E ++   
Sbjct  634   CYCVAKYGSKWVRTRTVSDNLEPKWNEQYTWKVFDPSTVLTIGVFDSFSVFEFETNESTR  693

Query  2132  -DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVY  2308
              D R+GKVRIRISTL TG+VY+NT+ L+LL+  GLKKMGEIE+A+RF+R+   LDFLHVY
Sbjct  694   PDFRIGKVRIRISTLQTGRVYKNTYPLLLLTHVGLKKMGEIEIAIRFVRTVQRLDFLHVY  753

Query  2309  SQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMR  2488
             SQPMLP+MHHI+PLG + QE LR  AVK++  HL RSEPPLR+EVV YMLDADS +FS+R
Sbjct  754   SQPMLPLMHHIKPLGVIHQEMLRNTAVKMVAGHLLRSEPPLRKEVVFYMLDADSQNFSVR  813

Query  2489  KVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYV  2668
             KVRANW+RIINV+A +I++V+W +DTR WRNPTATILVHALLV+LVWFPDLI+PT AFYV
Sbjct  814   KVRANWYRIINVVAGLIEIVRWIEDTRGWRNPTATILVHALLVMLVWFPDLIVPTLAFYV  873

Query  2669  FMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRML  2848
             F IGAWNYRFR+RD L HFD+KISLA+ +D +ELDEEFD VP TR N++VRARYDKLR L
Sbjct  874   FAIGAWNYRFRARDPLPHFDSKISLADVVDMEELDEEFDMVPSTRSNEVVRARYDKLRTL  933

Query  2849  GARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYY  3028
             GARVQT+LGDLATQGERVQALVTWRDP ATGIFI LC +VA ILYLVPSKM+AMA GFYY
Sbjct  934   GARVQTVLGDLATQGERVQALVTWRDPCATGIFIFLCLIVAMILYLVPSKMVAMACGFYY  993

Query  3029  LRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LRHP+FRDR+PS  LNFFRRLPSL+DR++
Sbjct  994   LRHPIFRDRLPSLGLNFFRRLPSLSDRIM  1022


 Score =   211 bits (538),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            MGT RKLIVEVI+A+NL PKDGHG SSPY+V+DFYGQR+KTRT +RDLNP WNE L FN 
Sbjct  1    MGTIRKLIVEVIDAQNLAPKDGHGTSSPYIVVDFYGQRRKTRTAVRDLNPVWNETLSFNF  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             +H++IFGD+LELDVYHD+  GPT R N LGRV+L +TQFV+KGEEALIYY L++KNL +
Sbjct  61   GEHNEIFGDVLELDVYHDQKYGPTRRENSLGRVRLGSTQFVRKGEEALIYYELKKKNLFN  120

Query  497  WIQGDIGLKIYFVD  538
             +QG +GLKIY+VD
Sbjct  121  MVQGKVGLKIYYVD  134



>ref|XP_010492789.1| PREDICTED: uncharacterized protein LOC104770124 [Camelina sativa]
Length=1051

 Score =  1091 bits (2821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/788 (69%), Positives = 652/788 (83%), Gaps = 24/788 (3%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKA  958
             + S+PE K      GP+PL R+    +S+ S++SD S +ERS+FDLVEKMHY+FV++VK+
Sbjct  278   SGSIPETK-----TGPQPLRRSLSETASYTSEISDVSTIERSTFDLVEKMHYVFVRVVKS  332

Query  959   RSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--SSSILEISVWDPL  1132
             RSLPT+G PV K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD  SS ILEISVW+  
Sbjct  333   RSLPTSGSPVTKISLSGTMIQSKPARKTTCFEWDQTFAFLRDSPDLSSSPILEISVWNDS  392

Query  1133  SSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWV  1312
             S      T+ +    FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH  DLMLATW 
Sbjct  393   S------TTGIETSQFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHSDLMLATWT  446

Query  1313  GTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQ  1486
             GTQADESFPDAWKTDTAGN T+R+KVY S KLWYLR++VIEAQD+    LTA  KE+SFQ
Sbjct  447   GTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLRATVIEAQDLLPPQLTA-FKEASFQ  505

Query  1487  IKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVA  1666
             +KAQLGFQVQKTK A +  G+PSWNEDL+FVAAEPF++   L F +E+   K    +G+A
Sbjct  506   LKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVAAEPFSDQ--LVFTLEYRTSKGPVTVGMA  563

Query  1667  SIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDY  1846
              +PL++IERRVDDR V SRWF FED N+EKR  + RVHLRLCFDGGYHVI+EAAH+CSDY
Sbjct  564   RVPLTAIERRVDDRLVASRWFGFEDPNDEKRGNRSRVHLRLCFDGGYHVIDEAAHVCSDY  623

Query  1847  RPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLC  2026
             RPTARQLWKP VG +ELG+IGCKNLLPMKT+ GKGSTDAY VAKYG+KWVRTRT+SD+L 
Sbjct  624   RPTARQLWKPAVGIIELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGTKWVRTRTVSDSLD  683

Query  2027  PRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVY  2191
             P+WNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVRIRISTL TGK Y
Sbjct  684   PKWNEQYTWKVYDPCTVLTIGVFDSWGVFEIDGGKEATRQDLRIGKVRIRISTLETGKAY  743

Query  2192  RNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQES  2371
             RNT+ L++L   G+KK+GEIE+AVRF+RS P LDFLHVY+QP+LP+MH+I+PL   Q+E 
Sbjct  744   RNTYPLLMLVNGGVKKLGEIEIAVRFVRSAPPLDFLHVYTQPLLPLMHYIKPLSLFQEEM  803

Query  2372  LRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvK  2551
             LR  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A ++DVV+
Sbjct  804   LRNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMVDVVR  863

Query  2552  WADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDT  2731
             W DDTR W+NPT+T+LVHAL+V+L+WFPDLI PT AFY+F+IGAWNYRFRSR  L HFD 
Sbjct  864   WVDDTRYWKNPTSTLLVHALVVMLIWFPDLIGPTLAFYLFVIGAWNYRFRSRAGLPHFDP  923

Query  2732  KISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQAL  2911
             ++SLA++ DR+ELDEEFD VP  RP +MVR+RYDKLR +G RVQT+LG++A QGE++QAL
Sbjct  924   RLSLADAADREELDEEFDVVPSNRPPEMVRSRYDKLRGVGVRVQTILGEVAAQGEKMQAL  983

Query  2912  VTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRL  3091
             VTWRDPRATGIF+ LC  VA +LYLVP+KM+AMA GFYY RHP+FRDR PSP LNFFRRL
Sbjct  984   VTWRDPRATGIFVGLCLFVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPVLNFFRRL  1043

Query  3092  PSLADRML  3115
             PSL+DR++
Sbjct  1044  PSLSDRLM  1051


 Score =   203 bits (517),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATNRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LELD+YHDKN GPT RNNFLGR++L + QFV KGEEALIYYPLE+K+L
Sbjct  61   AKRPSHQVFTDVLELDMYHDKNFGPTRRNNFLGRIRLGSDQFVGKGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRLYYAD  136



>ref|XP_010454018.1| PREDICTED: uncharacterized protein LOC104735852 [Camelina sativa]
Length=1052

 Score =  1089 bits (2817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/800 (68%), Positives = 655/800 (82%), Gaps = 28/800 (4%)
 Frame = +2

Query  770   ASVATASMPEVKIGGGL--------VGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVE  922
             AS   + +PEV I   +         GP+PL R+    +S+ S++SD S +ERS+FDLVE
Sbjct  263   ASAPRSPLPEVTISRSVSGSIPEKKTGPQPLRRSLSETASYTSEISDVSTIERSTFDLVE  322

Query  923   KMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--S  1096
             KMHY+FV++VKARSLPT+G PV K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD  S
Sbjct  323   KMHYVFVRVVKARSLPTSGSPVTKISLSGTMIQSKPARKTTCFEWDQTFAFLRDSPDLSS  382

Query  1097  SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG  1276
             S ILEISVW+       D ++ +    FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG
Sbjct  383   SPILEISVWN-------DSSTGIETSQFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGG  435

Query  1277  AHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--  1450
             AH  DLMLATW GTQADESFPDAWKTDTAGN T+R+KVY S KLWYLR++VIEAQD+   
Sbjct  436   AHHSDLMLATWTGTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLRATVIEAQDLLPP  495

Query  1451  ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEH  1630
              LTA  KE+SFQ+KAQLGFQVQKTK A +  G+PSWNEDL+FVAAEPF++   L F +E+
Sbjct  496   QLTA-FKEASFQLKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVAAEPFSDQ--LVFTLEY  552

Query  1631  LPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYH  1810
                K    +G+A +PL++IERRVDDR V SRWF F+D N+EKR  + RVHLRLCFDGGYH
Sbjct  553   RTSKGPVTVGMARVPLTAIERRVDDRLVASRWFGFDDPNDEKRGNRSRVHLRLCFDGGYH  612

Query  1811  VIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSK  1990
             V++EAAH+CSDYRPTARQLWKP VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYG+K
Sbjct  613   VMDEAAHVCSDYRPTARQLWKPAVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGTK  672

Query  1991  WVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVR  2155
             WVRTRT+SD+L P+WNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVR
Sbjct  673   WVRTRTVSDSLDPKWNEQYTWKVYDPCTVLTIGVFDSWGVFEIDGGKEATRQDLRIGKVR  732

Query  2156  IRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMH  2335
             IRISTL TGK YRNT+ L++L   G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MH
Sbjct  733   IRISTLETGKAYRNTYPLLMLVNGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMH  792

Query  2336  HIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRi  2515
             HI+PL   Q+E LR  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI
Sbjct  793   HIKPLSLFQEEMLRNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRI  852

Query  2516  inviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYR  2695
             +NV+A ++DVV+W +DTR W+NPT+T+LVHAL+V+L+WFPDLI PT AFY+F+IGAWNYR
Sbjct  853   VNVVAGMVDVVRWVEDTRYWKNPTSTLLVHALVVMLIWFPDLIGPTLAFYLFVIGAWNYR  912

Query  2696  FRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLG  2875
             FRSR  L HFD ++SLA++ DR+ELDEEFD VP  RP +MVR+RYDKLR +G RVQT+LG
Sbjct  913   FRSRAGLPHFDPRLSLADAADREELDEEFDVVPSNRPPEMVRSRYDKLRGVGVRVQTILG  972

Query  2876  DLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDR  3055
             ++A QGE++QALVTWRDPRATGIF+ LC  VA +LY+VP+KM+AMA GFYY RHP+FRDR
Sbjct  973   EVAAQGEKMQALVTWRDPRATGIFVGLCLFVALVLYIVPTKMVAMASGFYYFRHPIFRDR  1032

Query  3056  MPSPALNFFRRLPSLADRML  3115
              PSP LNFFRRLPSL+DR++
Sbjct  1033  KPSPVLNFFRRLPSLSDRLM  1052


 Score =   199 bits (506),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATNRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LELD+YHDKN GPT RNNFLGR++L + QFV KGEEALIYY LE+K+L
Sbjct  61   AKRPSHQVFTDVLELDMYHDKNFGPTRRNNFLGRIRLGSDQFVGKGEEALIYYRLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRLYYAD  136



>gb|KEH25590.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=1026

 Score =  1089 bits (2816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/817 (67%), Positives = 658/817 (81%), Gaps = 30/817 (4%)
 Frame = +2

Query  713   DPVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGP--KPLSRTPsvssfvsdvsdr  886
             DP+D +P +     A EM A+  + S  EV+  G + GP  +P+ R+ S +SF S+ S  
Sbjct  224   DPMDANPPE-----AFEMAAASISRSNSEVRFSG-INGPHPQPIRRSASTASFTSEASMD  277

Query  887   sAM-ERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQ  1063
             S + ERS+FDLVEKMHYLF+++VKAR LPT G P+VK+ VSG  V S+PARKT  FEW+Q
Sbjct  278   SMLIERSTFDLVEKMHYLFIRVVKARYLPTNGNPIVKISVSGHDVNSKPARKTTTFEWNQ  337

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             TFAF RD  DSS ILEI+VWDP + +           + LGG+CFDV+EIP+RDPPDS L
Sbjct  338   TFAFARDTHDSSPILEITVWDPQTIEE--------NRSLLGGVCFDVNEIPVRDPPDSSL  389

Query  1244  APQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             APQWYR+EGGGA  GDLM+ATW+GTQADESF DAWK+DT  +  S++KVYQSPKLWYLR 
Sbjct  390   APQWYRMEGGGAQHGDLMIATWIGTQADESFADAWKSDTTNHVNSKAKVYQSPKLWYLRV  449

Query  1424  SVIEAQDIFALTAPSKES--SFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFT  1597
             +++EAQDI  LT   KES   FQI+AQ+GFQV KTK   +  G  SWNEDL+FVAAEP T
Sbjct  450   TILEAQDITPLTPTLKESWFHFQIRAQIGFQVLKTKTTVTKNGIVSWNEDLLFVAAEPLT  509

Query  1598  EHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRV-YKGR  1774
                 + F +E+   K    +GV  IPL+++ERRVDDR V SRWFTF+D N+EKR  YKGR
Sbjct  510   VSDFIVFSLENRQHKAPVTMGVVKIPLTAVERRVDDRNVGSRWFTFDDPNDEKRSGYKGR  569

Query  1775  VHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGS  1954
             +HLRLCFDGGYHV++EAAH+ SDYRPTARQLWKPPVGT+ELGIIGCKNL+PMKT+ GK S
Sbjct  570   LHLRLCFDGGYHVMDEAAHVTSDYRPTARQLWKPPVGTIELGIIGCKNLIPMKTVNGKSS  629

Query  1955  TDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-  2131
             TD Y VAKYG+KWVRTRT+SDNL P+WNEQYTW+V+DPSTV+TIGVFDS+ V + +NSK 
Sbjct  630   TDGYCVAKYGNKWVRTRTVSDNLEPKWNEQYTWKVFDPSTVLTIGVFDSFSVFESDNSKT  689

Query  2132  ---------DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTP  2284
                      D R+GKVRIRISTL TG+VY+NT+ L++L+  GLKKMGEIE+A+RF+R+  
Sbjct  690   EMTNESTRPDFRIGKVRIRISTLQTGRVYKNTYPLLVLTHGGLKKMGEIEIAIRFVRTVQ  749

Query  2285  TLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDA  2464
              LDFLHVYSQPMLP+MHHI+PLG V QE LR  AVK++  HLSRSEPPLR+EVV YMLDA
Sbjct  750   RLDFLHVYSQPMLPLMHHIKPLGVVHQEVLRNTAVKMVAGHLSRSEPPLRKEVVFYMLDA  809

Query  2465  DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLI  2644
             DSH+FS+RKVRANW RIINV+A +I++V+W +DTR W+NPTATILVHALLV+LVWFPDLI
Sbjct  810   DSHNFSIRKVRANWCRIINVVAGLIEIVRWIEDTRGWKNPTATILVHALLVMLVWFPDLI  869

Query  2645  IPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRA  2824
             IPT AFYVF +GAWNYRFR+RD L HFD KISLA+ +DR+ELDEEFD VP TR  + VRA
Sbjct  870   IPTLAFYVFAVGAWNYRFRARDPLPHFDPKISLADVVDREELDEEFDIVPSTRSYEAVRA  929

Query  2825  RYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMI  3004
             RYDKLR LGARVQT+LGDLATQGERVQALVTWRDP ATGIF+ LC VVA ILYLVPSKM+
Sbjct  930   RYDKLRTLGARVQTVLGDLATQGERVQALVTWRDPCATGIFVFLCLVVAMILYLVPSKMV  989

Query  3005  AMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             AMA GFYYLRHP+FRDR+PSP LNFFRRLPSL+DR++
Sbjct  990   AMACGFYYLRHPIFRDRLPSPGLNFFRRLPSLSDRIM  1026


 Score =   195 bits (496),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEVI+A+NL PKDGHG SSPY+VIDF+GQR+KTRT++RDLNP WNE L FN+
Sbjct  1    MATVRKLIVEVIDAQNLAPKDGHGTSSPYIVIDFHGQRRKTRTLVRDLNPVWNETLSFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             + ++I GD+LELDVYH+    PT R N LG+V+L++TQFVKKGEEALIYY L++K+L +
Sbjct  61   GERNEILGDVLELDVYHEMKHSPTRRENSLGQVRLSSTQFVKKGEEALIYYELKKKSLFN  120

Query  497  WIQGDIGLKIYFVD  538
             +QG +GLKIY+VD
Sbjct  121  MVQGKVGLKIYYVD  134



>ref|NP_197299.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal 
domain-containing protein [Arabidopsis thaliana]
 dbj|BAB08397.1| phosphoribosylanthranilate transferase-like protein [Arabidopsis 
thaliana]
 gb|AED92492.1| C2 calcium/lipid-binding and phosphoribosyltransferase C-terminal 
domain-containing protein [Arabidopsis thaliana]
Length=1049

 Score =  1088 bits (2814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/810 (67%), Positives = 657/810 (81%), Gaps = 34/810 (4%)
 Frame = +2

Query  716   PVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsA  892
             P  P PE +++           + S+PE K      GP+PL R+    +S+ S++SD S 
Sbjct  264   PRSPLPEVIISRSV--------SGSIPETK-----NGPQPLRRSVSETASYTSEISDVST  310

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +ERS+FDLVEKMHY+F+++VKARSLPT+G PV K+ +SG+ + S+PARKT  FEWDQTFA
Sbjct  311   IERSTFDLVEKMHYVFIRVVKARSLPTSGSPVTKISLSGTMIQSKPARKTSCFEWDQTFA  370

Query  1073  FGRDAPD--SSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             F RD+PD  SS ILEISVWD         ++ +    FLGGICFDVSEIPLRDPPDSPLA
Sbjct  371   FLRDSPDLSSSPILEISVWDS--------STGIETSQFLGGICFDVSEIPLRDPPDSPLA  422

Query  1247  PQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSS  1426
             PQWYRLEGGGAH  DLMLATW GTQADESFPDAWKTDTAGN T+R+KVY S KLWYLR++
Sbjct  423   PQWYRLEGGGAHNSDLMLATWTGTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLRAT  482

Query  1427  VIEAQDIF--ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTE  1600
             VIEAQD+    LTA  KE+SFQ+KAQLG QVQKTK A +  G+PSWNEDL+FVAAEPF++
Sbjct  483   VIEAQDLLPPQLTA-FKEASFQLKAQLGSQVQKTKSAVTRNGAPSWNEDLLFVAAEPFSD  541

Query  1601  HYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVH  1780
                L F +E+   K    +G+A +PLS+IERRVDDR V SRW   ED N+EKR  + RVH
Sbjct  542   Q--LVFTLEYRTSKGPVTVGMARVPLSAIERRVDDRLVASRWLGLEDPNDEKRGNRSRVH  599

Query  1781  LRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTD  1960
             +RLCFDGGYHV++EAAH+CSDYRPTARQLWKP VG VELGIIGCKNLLPMKT+ GKGSTD
Sbjct  600   IRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPAVGIVELGIIGCKNLLPMKTVNGKGSTD  659

Query  1961  AYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK---  2131
             AY VAKYGSKWVRTRT+SD+L P+WNEQYTW+VYDP TV+TIGVFDSW V + +  K   
Sbjct  660   AYTVAKYGSKWVRTRTVSDSLDPKWNEQYTWKVYDPCTVLTIGVFDSWGVYEVDGGKEAT  719

Query  2132  --DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHV  2305
               D+R+GKVRIRISTL TGK YRNT+ L++L   G+KK+GEIELAVRF+R+ P LDFLHV
Sbjct  720   RQDLRIGKVRIRISTLETGKAYRNTYPLLMLVNGGVKKLGEIELAVRFVRTAPPLDFLHV  779

Query  2306  YSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSM  2485
             Y+QP+LP+MHHI+PL   Q++ LR  AVK+L  HLSRSEPPLR E+V YMLDAD+H+FSM
Sbjct  780   YTQPLLPLMHHIKPLSLFQEDMLRNTAVKILAAHLSRSEPPLRPEIVRYMLDADTHTFSM  839

Query  2486  RKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFY  2665
             RKVRANW RI+NV+A ++DVV+W DDTR W+NPT+T+LVHAL+V+L+WFPDLI+PT AFY
Sbjct  840   RKVRANWLRIVNVVAGMVDVVRWVDDTRFWKNPTSTLLVHALVVMLIWFPDLIVPTLAFY  899

Query  2666  VFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRM  2845
             +F+IGAWNYRFRSR  L HFD ++SLA++ DRDELDEEFD VP  RP +MVR RYDKLR 
Sbjct  900   LFVIGAWNYRFRSRAALPHFDPRLSLADAADRDELDEEFDVVPSNRPPEMVRLRYDKLRN  959

Query  2846  LGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFY  3025
             +GARVQT+LG++A QGE++QALVTWRDPRATGIF+ LCF VA +LYLVP+KM+AMA GFY
Sbjct  960   VGARVQTILGEVAAQGEKMQALVTWRDPRATGIFVGLCFFVALVLYLVPTKMVAMASGFY  1019

Query  3026  YLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y RHP+FRDR PSP LNFFRRLPSL+DR++
Sbjct  1020  YFRHPIFRDRKPSPVLNFFRRLPSLSDRLM  1049


 Score =   197 bits (502),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATTRKLVVEVVDAKDLTPKDGHGTSSPYVVLDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LELD+YHDKN G T RNNFLGR++L + QFV +GEEALIYYPLE+K+L
Sbjct  61   AKRPSHQLFTDVLELDMYHDKNFGQTRRNNFLGRIRLGSDQFVGQGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRVYYAD  136



>ref|XP_006400340.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum]
 gb|ESQ41793.1| hypothetical protein EUTSA_v10012529mg [Eutrema salsugineum]
Length=1064

 Score =  1085 bits (2806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/788 (70%), Positives = 656/788 (83%), Gaps = 22/788 (3%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRT-PsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKA  958
             + S+PE  IGG + GP+PL R+    +S+ S++SD S +ERS+FDLVEKMHY+FV++VKA
Sbjct  289   SGSIPETNIGG-IGGPQPLRRSVSETASYTSEISDVSTIERSAFDLVEKMHYVFVRVVKA  347

Query  959   RSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--SSSILEISVWDPL  1132
             RSL T+G P+ K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD  SS ILEISVWDP 
Sbjct  348   RSLSTSGSPITKISLSGTMIQSKPARKTSTFEWDQTFAFLRDSPDLSSSPILEISVWDP-  406

Query  1133  SSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWV  1312
                    ++ +   +FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH GDLMLATW 
Sbjct  407   -------STGIDTSHFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHGDLMLATWT  459

Query  1313  GTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQ  1486
             GTQADESFPDAWKTDTAGN T+R+KVY SPKLWYLR++VIEAQD+    LTA  KE+SFQ
Sbjct  460   GTQADESFPDAWKTDTAGNVTARAKVYMSPKLWYLRATVIEAQDLLPPQLTA-FKEASFQ  518

Query  1487  IKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVA  1666
             +KAQLGFQVQKTK A +  G+PSWNEDL+FVAAEPF +   L F +E+   K    +G+A
Sbjct  519   LKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVAAEPFADQ--LVFTLEYRTSKGPVTVGMA  576

Query  1667  SIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDY  1846
              +PL +IERRVDDR V SRWF FED N+EKR  + RVHLRLCFDGGYHV++EAAH+CSDY
Sbjct  577   RVPLGAIERRVDDRLVASRWFGFEDPNDEKRGNRSRVHLRLCFDGGYHVMDEAAHVCSDY  636

Query  1847  RPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLC  2026
             R TARQLWKP VG VELG+I CKNLLPMKT+ GKGSTDAY VAKYG+KWVRTRT+SD+L 
Sbjct  637   RATARQLWKPAVGIVELGVISCKNLLPMKTVNGKGSTDAYTVAKYGTKWVRTRTVSDSLD  696

Query  2027  PRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVY  2191
             P+WNEQYTW+VYDP TV++IGVFDSW V + +  K     D+R+GKVRIR+STL TGK Y
Sbjct  697   PKWNEQYTWKVYDPCTVLSIGVFDSWGVYENDGGKEATRQDLRIGKVRIRVSTLETGKAY  756

Query  2192  RNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQES  2371
             RNT+ L++L   G+KKMGEIELAVRF+RS P LDFLHVYSQP+LP+MH+I+PL   Q+E 
Sbjct  757   RNTYPLLMLVNGGVKKMGEIELAVRFVRSAPPLDFLHVYSQPLLPLMHYIKPLTLFQEEM  816

Query  2372  LRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvK  2551
             LR  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A +IDVV+
Sbjct  817   LRNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMIDVVR  876

Query  2552  WADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDT  2731
             W DDTR W+NPT+T+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYRFRSR  L HFD 
Sbjct  877   WVDDTRFWKNPTSTLLVHALVVMLIWFPDLIVPTLAFYLFVIGAWNYRFRSRVSLPHFDP  936

Query  2732  KISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQAL  2911
             K+SLA++ DRDELDEEFD VP  RP +MVR+RYDKLR +GARVQT+LG++A QGE++QAL
Sbjct  937   KLSLADAADRDELDEEFDVVPSNRPPEMVRSRYDKLRAVGARVQTILGEVAAQGEKMQAL  996

Query  2912  VTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRL  3091
             VTWRDPRATGIF+ +C VVA +LYLVP+KM+AMA GFYY RHP+FRDR PSP LNFFRRL
Sbjct  997   VTWRDPRATGIFVGMCLVVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPVLNFFRRL  1056

Query  3092  PSLADRML  3115
             PSL+DR++
Sbjct  1057  PSLSDRLM  1064


 Score =   200 bits (509),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MAVTRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LE+D+YHDKN GPT RNNFLGR++L + QFV KGEEALIYYPLE+K+L
Sbjct  61   AKRPSHQVFTDVLEIDMYHDKNFGPTRRNNFLGRIRLGSDQFVGKGEEALIYYPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IG++IY+ D
Sbjct  121  FNLVQGEIGIRIYYAD  136



>ref|XP_008240499.1| PREDICTED: uncharacterized protein LOC103339006 [Prunus mume]
Length=1064

 Score =  1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/757 (72%), Positives = 643/757 (85%), Gaps = 20/757 (3%)
 Frame = +2

Query  890   AMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             +M+R SFDLVEKMHYLFV++VKAR LP  G P+VK+  +  H+ S+PARKT  FEWDQTF
Sbjct  313   SMDRPSFDLVEKMHYLFVRVVKARFLPANGSPIVKISTANYHITSKPARKTHCFEWDQTF  372

Query  1070  AFGRDAPDSS--SILEISVWDPLSSKSLDPT--SDVA-GHNFLGGICFDVSEIPLRDPPD  1234
             AF R +PD S  SILE+SVWDP      DP+  S+VA GH FLGGICFDV EIPLRDPPD
Sbjct  373   AFARQSPDQSDASILEVSVWDP---PVFDPSAASEVASGHQFLGGICFDVMEIPLRDPPD  429

Query  1235  SPLAPQWYRLEGGGAH-KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             SPLAPQWYRLEGGGA   GDLMLATW+GTQAD+SFPDAWKTDTA NP +R+KVYQSPKLW
Sbjct  430   SPLAPQWYRLEGGGARINGDLMLATWMGTQADDSFPDAWKTDTAKNPNARAKVYQSPKLW  489

Query  1412  YLRSSVIEAQDIFALTAPS--KESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAA  1585
             YLR++V+EAQD+  +TA    KE++ Q+KAQLGFQ  KT+P  +  G PSWN+DL+FVAA
Sbjct  490   YLRATVLEAQDVLPVTASLNLKEATLQVKAQLGFQFLKTEPTVTRNGVPSWNQDLMFVAA  549

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN-EEKRV  1762
             EPF++H  L F IEH  PK    LGV  IPLS++ERRVDDR+V SRWF+FE+ + +EKR+
Sbjct  550   EPFSDH--LIFTIEHRLPKGPVTLGVLRIPLSAVERRVDDRKVASRWFSFENPDGDEKRM  607

Query  1763  YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMR  1942
             Y+GR+HLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPP+GTVELG+IGCKNL+P+KT+ 
Sbjct  608   YRGRMHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPLGTVELGVIGCKNLIPVKTVN  667

Query  1943  GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD-SWEVIDP  2119
             GKG TDAY VAKYG KWVRTRT+ D+L P+WNEQYT++VYDP TV++IGVFD S    + 
Sbjct  668   GKGCTDAYCVAKYGPKWVRTRTVCDSLEPKWNEQYTFKVYDPCTVLSIGVFDNSGSGFEI  727

Query  2120  ENSKDV-----RMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTP  2284
             E SKD      R+GK+R+RISTLATGKVY+NT+ L++LSP GLKKMGE+E+AVRF+R +P
Sbjct  728   EGSKDATRPDFRIGKLRVRISTLATGKVYKNTYPLLVLSPTGLKKMGEVEIAVRFVRVSP  787

Query  2285  TLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDA  2464
             TLD +HVYSQP LP+MHHI+PLG VQQ+ LR AAVK++  HLSRSEPPL R+VV YMLDA
Sbjct  788   TLDLVHVYSQPSLPLMHHIKPLGPVQQDVLRRAAVKIVAAHLSRSEPPLGRDVVLYMLDA  847

Query  2465  DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLI  2644
             DS  FSMRKVRAN+FRIINV+A V+DVV W +DTR+W+NP ATILVHALL LLVW+PDLI
Sbjct  848   DSQGFSMRKVRANYFRIINVVAGVMDVVGWINDTRSWKNPMATILVHALLALLVWYPDLI  907

Query  2645  IPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRA  2824
             +PT AFYVF+IGAWNYRFRSR  L HFD K+SLAE++DRDELDEEFD+VP TR  ++VRA
Sbjct  908   VPTLAFYVFVIGAWNYRFRSRAPLQHFDPKLSLAENVDRDELDEEFDSVPSTRSFEVVRA  967

Query  2825  RYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMI  3004
             RYDKLRMLGARVQT+LGD ATQGERVQALVTWRDPRATGIF+ LCFVVA ILY+VPSKM+
Sbjct  968   RYDKLRMLGARVQTVLGDFATQGERVQALVTWRDPRATGIFVLLCFVVAVILYMVPSKMV  1027

Query  3005  AMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             AMAFGFYYLRHP+FRDRMP PALNF RRLPSL+DR+L
Sbjct  1028  AMAFGFYYLRHPIFRDRMPPPALNFIRRLPSLSDRLL  1064


 Score =   214 bits (544),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T  KLIVEV++ARNL PKDG GASSPYVV+D+ GQR++T+T L DLNP WNE+L+F+L
Sbjct  1    MATLHKLIVEVVDARNLSPKDGRGASSPYVVVDYRGQRRRTQTKLSDLNPVWNELLDFDL  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            S+ +D+FGD+LELDVYHDKN GPTTRNNFLGR++L+++QFVKKGEEALIY+PL++K+  +
Sbjct  61   SRPADVFGDVLELDVYHDKNYGPTTRNNFLGRIRLSSSQFVKKGEEALIYFPLQKKSWFT  120

Query  497  WIQGDIGLKIYFVD  538
            WI+GDIGLKIY+VD
Sbjct  121  WIRGDIGLKIYYVD  134



>ref|XP_010036234.1| PREDICTED: uncharacterized protein LOC104425281 [Eucalyptus grandis]
 gb|KCW47758.1| hypothetical protein EUGRSUZ_K01506 [Eucalyptus grandis]
Length=1077

 Score =  1080 bits (2794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/751 (72%), Positives = 633/751 (84%), Gaps = 22/751 (3%)
 Frame = +2

Query  896   ERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQT  1066
             ERSSFDLVEKMHYLFV++VKAR LPT G PVVK+VVSG+HV+S+PAR+   T  FEWDQT
Sbjct  338   ERSSFDLVEKMHYLFVRVVKARHLPTNGSPVVKIVVSGAHVMSKPARRSASTAFFEWDQT  397

Query  1067  FAFGRDAP-DSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             FAFGRDAP +SS+ILE+SVWDP       P++DVAGH F GGICFD +EI LRDPPDSPL
Sbjct  398   FAFGRDAPGESSAILEVSVWDP-------PSADVAGHKFFGGICFDAAEILLRDPPDSPL  450

Query  1244  APQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             APQWYRLEGGG +  DLMLATW+GTQADESFPDAWKTDTAG+  +R+KVYQSPKLWYLR+
Sbjct  451   APQWYRLEGGGVNYADLMLATWIGTQADESFPDAWKTDTAGDVNARAKVYQSPKLWYLRA  510

Query  1424  SVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFT  1597
             +VIEAQ +   T  A  +++SFQIKAQLGFQ+QKTK + +  GSPSWNEDL+FVAAEPF 
Sbjct  511   TVIEAQGVLPSTPGAALRDTSFQIKAQLGFQMQKTKVSVAHDGSPSWNEDLLFVAAEPFG  570

Query  1598  EHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRV  1777
             ++  L F IE+  P+    +G A +PL +IERRVDDRQV S+WFTF D   E  ++KGRV
Sbjct  571   DN--LIFTIENRLPRGPVEIGRAPVPLMAIERRVDDRQVASQWFTFMDG--ETNMFKGRV  626

Query  1778  HLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGST  1957
             HLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPP+G VELGIIGCK+LLPMKT+ GKGST
Sbjct  627   HLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPIGMVELGIIGCKHLLPMKTVNGKGST  686

Query  1958  DAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENS---  2128
             DAY VAKYG KWVRTRT+ D L P+WNEQYTWRVYDP TV+TIGVFDS    +P+     
Sbjct  687   DAYCVAKYGPKWVRTRTVCDTLDPKWNEQYTWRVYDPCTVLTIGVFDSRGASEPDGPLEA  746

Query  2129  --KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLH  2302
                D R+GKVRIRISTL   +VYRN + L++LS AGLKKMGE+E+A+RF R+ PTLD LH
Sbjct  747   PPPDCRIGKVRIRISTLQANRVYRNLYPLLVLSNAGLKKMGEVEIAIRFARTAPTLDVLH  806

Query  2303  VYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFS  2482
             VYSQP+LP+MHH++PLG VQQE LR+AA +++  HLSRSEPP++REVV YMLDADS +FS
Sbjct  807   VYSQPLLPLMHHVKPLGVVQQELLRSAAARIMAAHLSRSEPPVKREVVLYMLDADSQAFS  866

Query  2483  MRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAF  2662
             MRKVRANW RIINV+A +IDVV+W +DTR W+NPTAT LVHALL++LVWFPDLI+PT AF
Sbjct  867   MRKVRANWLRIINVLAGLIDVVRWIEDTRGWKNPTATPLVHALLIMLVWFPDLIVPTIAF  926

Query  2663  YVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLR  2842
             YVF+IGAWNYRFR R  + HFD ++SLA++ DR+ELDEEFD VP   P ++VR RYDKLR
Sbjct  927   YVFVIGAWNYRFRGRYPVPHFDPRMSLADTADREELDEEFDQVPSNSPPEVVRVRYDKLR  986

Query  2843  MLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGF  3022
              +GARVQT+LGDLATQGERVQALVTWRDPRATGIFI LCF+VA ILYLVP+KM+AMA GF
Sbjct  987   AIGARVQTMLGDLATQGERVQALVTWRDPRATGIFILLCFMVAVILYLVPTKMVAMASGF  1046

Query  3023  YYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             YY RHP+FRDRMP+PALNFFRRLPSL+DRM+
Sbjct  1047  YYFRHPIFRDRMPAPALNFFRRLPSLSDRMM  1077


 Score =   180 bits (456),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV+EA +L PKDG G SSPYVV +F+GQRK+TRT ++DL P+W E+LEF +
Sbjct  1    MATVRKLVVEVVEAVSLSPKDGQGTSSPYVVANFHGQRKRTRTAVKDLCPRWKEVLEF-V  59

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             +  D +G+ LE+DV HDK  GPTTRNNFLGRV+L+++QFV KGEEALIYY L  K   S
Sbjct  60   VRSPDSYGNALEIDVLHDKAHGPTTRNNFLGRVRLSSSQFVWKGEEALIYYTLRGKGWFS  119

Query  497  WIQGDIGLKIYFV  535
            W+QGD+GLKIY+ 
Sbjct  120  WVQGDLGLKIYYT  132



>ref|XP_008391703.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103453887 
[Malus domestica]
Length=1057

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/802 (68%), Positives = 663/802 (83%), Gaps = 22/802 (3%)
 Frame = +2

Query  758   VEMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdv-sdrsAMERSSFDLVEKMHY  934
             +EM  +  + S+P+VK  G + GP+P+ R P ++       ++  +M+R SFDLVEKMHY
Sbjct  262   IEMIGAAVSKSVPDVKFHG-INGPQPMPRPPVMNYTSQLEPTESMSMDRPSFDLVEKMHY  320

Query  935   LFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSS--SIL  1108
             LFV++VKAR +P++G P+VK+  +  H+ S+PARKT  FEWDQTFAF R +PD S  SIL
Sbjct  321   LFVRVVKARFIPSSGSPIVKISTANHHITSKPARKTQCFEWDQTFAFARQSPDQSDASIL  380

Query  1109  EISVWDPLSSKSLDP-TSDVA-GHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH  1282
             EISVWDP      DP T+ VA GH+FLGGICFDV+EIPLRDPPDSPLAPQWYRLEGGGA 
Sbjct  381   EISVWDP---PMFDPATASVASGHHFLGGICFDVTEIPLRDPPDSPLAPQWYRLEGGGAR  437

Query  1283  -KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALT  1459
               GDLMLATW+GTQAD+SFPDAWKTDTAGNP +R+KVYQSPKLWYLR++V+EAQD+  +T
Sbjct  438   MNGDLMLATWMGTQADDSFPDAWKTDTAGNPNARAKVYQSPKLWYLRATVLEAQDVLPMT  497

Query  1460  APSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPP  1639
                 ESS Q+KAQLGFQ  KT PA +  G+ SWN+DL+FVAAEPF++   L F +E+   
Sbjct  498   PSLTESSVQVKAQLGFQSLKTDPAVTQNGTLSWNQDLMFVAAEPFSDR--LIFTVENRLA  555

Query  1640  KEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEE----KRVYKGRVHLRLCFDGGY  1807
             K    LGVA+IPL++IERRVDDR+V SRWF+ E   EE    + VY+GR+HLRLCFDGGY
Sbjct  556   KGPVTLGVATIPLTAIERRVDDRKVASRWFSLESPGEEDQKKRTVYRGRMHLRLCFDGGY  615

Query  1808  HVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGS  1987
             HV++EAA++CSDYRPTARQLWKPP+GTVELG+IGCKNL+P+KT+ GKG TDAY VAKYGS
Sbjct  616   HVMDEAAYVCSDYRPTARQLWKPPLGTVELGVIGCKNLIPVKTVSGKGCTDAYCVAKYGS  675

Query  1988  KWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS----WEVIDPENSK--DVRMGK  2149
             KWVRTR + D+L P+WNEQYT++VYDP TV++IGVFDS    +++    ++   D R+GK
Sbjct  676   KWVRTRAVCDSLEPKWNEQYTFKVYDPCTVLSIGVFDSSGPGFKIDGSTDATRPDFRIGK  735

Query  2150  VRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPV  2329
             +R+RISTLATG+VYRNT+ L+LLSPAG +KMGE+E+A+RF+R  PTLD +H YSQP LP+
Sbjct  736   LRLRISTLATGRVYRNTYPLLLLSPAGXEKMGEVEVAIRFVRVCPTLDLIHAYSQPSLPL  795

Query  2330  MHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWF  2509
             MHHI+PLG +QQ+ LR AAVK++  HLSRSEPPL REVV YMLDADS  FSMRKVRAN+F
Sbjct  796   MHHIKPLGVMQQDLLRRAAVKIVAAHLSRSEPPLGREVVIYMLDADSQGFSMRKVRANYF  855

Query  2510  RiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWN  2689
             RIINV+A V+DVV W +DTR+W+ P ATILVHALLVLLVWFPDLI+PT  FYVF+IGAWN
Sbjct  856   RIINVVAGVVDVVAWINDTRSWKKPMATILVHALLVLLVWFPDLIVPTLLFYVFVIGAWN  915

Query  2690  YRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTL  2869
             YRFRSR  L HFD K+SLA+++DRDELDEEFDAVP  RP ++VRARYDKLRMLGARVQT+
Sbjct  916   YRFRSRAPLQHFDPKLSLADNVDRDELDEEFDAVPSNRPYEVVRARYDKLRMLGARVQTV  975

Query  2870  LGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFR  3049
             LGD ATQGERVQALVTW+DPRATGIF+ LC VVA ILY+VPSKM+AMAFGFYYLRHP+FR
Sbjct  976   LGDFATQGERVQALVTWQDPRATGIFVVLCLVVAMILYVVPSKMVAMAFGFYYLRHPIFR  1035

Query  3050  DRMPSPALNFFRRLPSLADRML  3115
             DRMPSPALNF RRLPSL+DR+L
Sbjct  1036  DRMPSPALNFIRRLPSLSDRLL  1057


 Score =   227 bits (578),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEV++ARNL PKDGHG SSPYVV+D+YGQRK+T+T +RDLNP WNE+LEFN+
Sbjct  1    MATVRKLIVEVVDARNLSPKDGHGTSSPYVVMDYYGQRKRTQTKIRDLNPVWNELLEFNV  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             K SD+FGD+LELDV+HDKN GPT RNNFLGR++L++TQFVKKGEEALIY+PLE+K+  S
Sbjct  61   GKPSDVFGDVLELDVHHDKNYGPTRRNNFLGRIRLSSTQFVKKGEEALIYFPLEKKSFFS  120

Query  497  WIQGDIGLKIYFVD  538
            WIQG+IGLKIY+VD
Sbjct  121  WIQGEIGLKIYYVD  134



>ref|XP_010088028.1| C2 and GRAM domain-containing protein [Morus notabilis]
 gb|EXB31247.1| C2 and GRAM domain-containing protein [Morus notabilis]
Length=1045

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/805 (68%), Positives = 651/805 (81%), Gaps = 38/805 (5%)
 Frame = +2

Query  764   MKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFV  943
             M ASV   SMPEVK  GG+ GP+P+ R P        +S  ++ME SSFDLVEKMHYLFV
Sbjct  258   MAASVCKNSMPEVKFTGGINGPRPIRR-PFSGDLQFGISSVASMECSSFDLVEKMHYLFV  316

Query  944   QIVKARSLPT-AGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPD--SSSILEI  1114
             ++VKARSLPT  G P+VK+ VS +HV S+PARKT+ FEWDQTFAF R++P+  SSSILE+
Sbjct  317   RVVKARSLPTNIGNPIVKIAVSNNHVRSKPARKTIFFEWDQTFAFPRESPEYSSSSILEV  376

Query  1115  SVWDPLSSKSLDPTSDVAGH--NFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKG  1288
             SVWDP         SD+ GH  NFLGGICFD +EI LRDPPDSPLAPQWYRLEGGGAH G
Sbjct  377   SVWDP---------SDM-GHEQNFLGGICFDTTEILLRDPPDSPLAPQWYRLEGGGAHHG  426

Query  1289  DLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPS  1468
             DLMLATW+GTQADESF +AWK+DT     +R+KVYQSPKLWYLR +V+EAQDI  +T   
Sbjct  427   DLMLATWIGTQADESFHEAWKSDT----NARAKVYQSPKLWYLRVTVLEAQDILPITTSL  482

Query  1469  KESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQ  1648
             KE +FQ+KAQLGFQ  KTKP+ +  G+  WNED+VFVAAEPFTEH  L F +E   PK  
Sbjct  483   KEYTFQLKAQLGFQTLKTKPSVTKNGTAFWNEDMVFVAAEPFTEH--LEFTLEIRQPKGP  540

Query  1649  AVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYK--------GRVHLRLCFDGG  1804
               LG A +PLS++ERRVDDR+V SRWF+ E+ N + ++ K         RVHLRLCFDGG
Sbjct  541   NPLGNAVVPLSAVERRVDDRKVASRWFSLENNNIDDKIMKRKSFTNNRARVHLRLCFDGG  600

Query  1805  YHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTM--RGKGSTDAYAVAK  1978
             YHV++EAAH+ SD+RPTARQLWKPPVGTVELGIIGC+NL+P+KT    G+G TDAY VAK
Sbjct  601   YHVMDEAAHVASDFRPTARQLWKPPVGTVELGIIGCRNLVPVKTSVPDGRGCTDAYCVAK  660

Query  1979  YGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSKDV-----RM  2143
             YG KWVRTRT+SD+  P+WNEQYT++V+DP TV+TIGVFDS+E  + +  KD      R+
Sbjct  661   YGPKWVRTRTVSDSQDPKWNEQYTFQVFDPCTVLTIGVFDSFESCEMDGWKDATRPDFRI  720

Query  2144  GKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPML  2323
             GKVR+RISTLA G+VYRN + L+LLSPAG+KKMGE+E+A+RF+R  PT+D LHVYSQP+L
Sbjct  721   GKVRVRISTLAAGRVYRNVYPLLLLSPAGMKKMGEVEIAMRFVRVRPTMDLLHVYSQPLL  780

Query  2324  PVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRAN  2503
             P+MHHI+PLG VQQ++LR A VK++T HLSRSEPPLRRE V YMLDADSH+FSMRKVR N
Sbjct  781   PLMHHIKPLGVVQQDALRNATVKIVTEHLSRSEPPLRREAVLYMLDADSHTFSMRKVRVN  840

Query  2504  WFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGA  2683
             +FRIINVI  V+D+  W D TR W+NPTAT+LVHAL+V+LVWFPDLIIPT AFYVF+IG 
Sbjct  841   YFRIINVIGNVMDIFNWVDKTRTWKNPTATVLVHALMVMLVWFPDLIIPTLAFYVFVIGV  900

Query  2684  WNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQ  2863
             WNYRFRSRD+L HFD K+S  E++D +ELDEEFDA+P  RP + VRARYDKLRMLGA+VQ
Sbjct  901   WNYRFRSRDRLPHFDPKLSFVETVDGEELDEEFDALPSVRPPNAVRARYDKLRMLGAKVQ  960

Query  2864  TLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPL  3043
             T+LGD+ATQGER+QALVTWRDPRAT IF+ LCF+VA ILYLVPSK+  MAFGFYY RHP+
Sbjct  961   TVLGDVATQGERIQALVTWRDPRATAIFVGLCFIVAMILYLVPSKLGMMAFGFYYFRHPI  1020

Query  3044  FRDR-MPSPALNFFRRLPSLADRML  3115
             FRDR  PSPALNFFRRLPSL+DR++
Sbjct  1021  FRDRNSPSPALNFFRRLPSLSDRII  1045


 Score =   189 bits (480),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            +KLIVEV++ARNL P+DGHG SSPY++ D+YGQRK+T+T +RDLNP WNE+LEFN  K S
Sbjct  6    QKLIVEVVDARNLSPRDGHGTSSPYMMADYYGQRKRTKTAVRDLNPTWNEVLEFNAGKPS  65

Query  329  DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW-IQ  505
            ++F D+LE++V+HDK  GPT R+NFLG ++L+++QFVKKGEEALIY+PL++K   ++ IQ
Sbjct  66   EVFQDVLEINVFHDKIHGPTRRSNFLGMLRLSSSQFVKKGEEALIYFPLDKKRFFNFGIQ  125

Query  506  GDIGLKIYFVD  538
            GDIGLKIYF D
Sbjct  126  GDIGLKIYFAD  136



>ref|XP_009121034.1| PREDICTED: uncharacterized protein LOC103845885 [Brassica rapa]
Length=1050

 Score =  1072 bits (2772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/787 (69%), Positives = 656/787 (83%), Gaps = 26/787 (3%)
 Frame = +2

Query  782   TASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKAR  961
             + S+P+ K GG    P+ LS T   +S+ S++SD S +ERS+FDLVEKMHY+FV++VKAR
Sbjct  281   SGSIPKTKTGGPQPLPRSLSET---ASYTSEISDVSTIERSTFDLVEKMHYVFVRVVKAR  337

Query  962   SLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGRDAPDSSS--ILEISVWDPLS  1135
             SLPT+G P+ K+ +SG+ + S+PARKT  FEWDQTFAF RD+PD+SS  ILEISVW+   
Sbjct  338   SLPTSGTPITKISLSGTTIESKPARKTSTFEWDQTFAFLRDSPDTSSSPILEISVWE---  394

Query  1136  SKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLMLATWVG  1315
                        G +FLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAH GDLMLATW G
Sbjct  395   --------GSGGTHFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHHGDLMLATWTG  446

Query  1316  TQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIF--ALTAPSKESSFQI  1489
             TQADESFPDAWKTDTAGN T+R+KVY SPKLWYLR++V++A+D+    LT   KE+SFQ+
Sbjct  447   TQADESFPDAWKTDTAGNVTARAKVYMSPKLWYLRATVMDAKDLLPPQLTV-FKEASFQL  505

Query  1490  KAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVAS  1669
             KAQLGFQVQKTKPA +  G+PSWNEDL+FVAAEPF +   L F +E+   K    +G+A 
Sbjct  506   KAQLGFQVQKTKPAVTRNGAPSWNEDLLFVAAEPFADQ--LVFTLEYRTSKGPVTVGMAR  563

Query  1670  IPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYR  1849
             +PL++IERRVD+R V SRWF+F+D N+EKR  + RVHLRLCFDGGYHV++EAAH+CSDYR
Sbjct  564   VPLTAIERRVDERLVASRWFSFDDPNDEKRGNRSRVHLRLCFDGGYHVMDEAAHVCSDYR  623

Query  1850  PTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCP  2029
             PTARQLWKP VG VELG+IGCKNLLPMKT+ GKGSTDAY VAKYGSKWVRTRT+SD+L P
Sbjct  624   PTARQLWKPAVGIVELGVIGCKNLLPMKTVNGKGSTDAYTVAKYGSKWVRTRTVSDSLDP  683

Query  2030  RWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLATGKVYR  2194
             +WNEQYTW+VYDP TV+TIGVFDSW V + +  K     D+R+GKVRIRISTL TGK YR
Sbjct  684   KWNEQYTWKVYDPCTVLTIGVFDSWGVYEIDGGKESTRQDLRIGKVRIRISTLETGKAYR  743

Query  2195  NTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESL  2374
             NT+ L++L   G+KK+GEIELAVRF+RS P LDFLHVY+QP+LP+MHHI+PL   Q++ L
Sbjct  744   NTYPLLMLVNGGVKKLGEIELAVRFVRSAPPLDFLHVYTQPLLPLMHHIKPLTLFQEDML  803

Query  2375  RTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKW  2554
             R  AVK+L  HLSRSEPPLR E+V YMLDADSH+FSMRKVRANW RI+NV+A +IDVV+W
Sbjct  804   RNTAVKILAVHLSRSEPPLRPEIVRYMLDADSHTFSMRKVRANWLRIVNVVAGMIDVVRW  863

Query  2555  ADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTK  2734
              DDTR WRNPTAT+LVHAL+V+L+WFPDLI+PT AFY+F+IGAWNYRFRSR  L HFD +
Sbjct  864   VDDTRFWRNPTATLLVHALVVMLIWFPDLIVPTIAFYLFVIGAWNYRFRSRAALPHFDPR  923

Query  2735  ISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALV  2914
             +SLA++ DR+ELDEEFD VP  RP +MVR+RYDKLR +GARVQT+LG++A QGE++QALV
Sbjct  924   LSLADAADREELDEEFDVVPSNRPPEMVRSRYDKLRAVGARVQTILGEVAAQGEKMQALV  983

Query  2915  TWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLP  3094
             TWRDPRATGIF+ LC VVA +LYLVP+KM+AMA GFYY RHP+FRDR PSP +NFFRRLP
Sbjct  984   TWRDPRATGIFVGLCLVVALVLYLVPTKMVAMASGFYYFRHPIFRDRKPSPMINFFRRLP  1043

Query  3095  SLADRML  3115
             SL+DR++
Sbjct  1044  SLSDRLM  1050


 Score =   195 bits (495),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VE+++A++L PKDG G SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATTRKLVVEIVDAKDLTPKDGQGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNESLEFSL  60

Query  317  SKHSD--IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D+LE+D++HDKN GPT RNNFLGR++L + QFV KGEEALIY+PLE+K+L
Sbjct  61   AKKPSHPVFNDVLEIDMFHDKNFGPTRRNNFLGRIRLGSDQFVAKGEEALIYFPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IG++IY+ +
Sbjct  121  FNLVQGEIGIRIYYAE  136



>ref|XP_007204671.1| hypothetical protein PRUPE_ppa000623mg [Prunus persica]
 gb|EMJ05870.1| hypothetical protein PRUPE_ppa000623mg [Prunus persica]
Length=1064

 Score =  1071 bits (2771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/757 (71%), Positives = 640/757 (85%), Gaps = 20/757 (3%)
 Frame = +2

Query  890   AMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             +M+R SFDLVEKMHYLFV++VKAR LP  G P+VK+  +  H+ S+PARKT  FEWDQTF
Sbjct  313   SMDRPSFDLVEKMHYLFVRVVKARFLPANGSPIVKISTANYHITSKPARKTHCFEWDQTF  372

Query  1070  AFGRDAPDSS--SILEISVWDPLSSKSLDPT--SDVA-GHNFLGGICFDVSEIPLRDPPD  1234
             AF R +PD S  SILE+SVWDP      DP+  S+VA GH FLGGICFDV EIPLRDPPD
Sbjct  373   AFARQSPDQSDASILEVSVWDP---PVFDPSAASEVASGHQFLGGICFDVMEIPLRDPPD  429

Query  1235  SPLAPQWYRLEGGGAH-KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             SPLAPQWYRLEGGGA   GDLMLATW+GTQAD+SFPDAWKTDTA NP +R+KVYQSPKLW
Sbjct  430   SPLAPQWYRLEGGGARINGDLMLATWMGTQADDSFPDAWKTDTAKNPNARAKVYQSPKLW  489

Query  1412  YLRSSVIEAQDIFALTAPS--KESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAA  1585
             YLR++V+EAQD+  +TA    KE++FQ+KAQLGFQ  KT+P  +  G PSWN+DL+FVAA
Sbjct  490   YLRATVLEAQDVLPVTASLNLKEATFQVKAQLGFQFLKTEPTVTRNGVPSWNQDLMFVAA  549

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN-EEKRV  1762
             EPF++H  L F IEH  PK    LGV  IPLS++ERRVDDR+V SRWF+FE+ + +EKR+
Sbjct  550   EPFSDH--LIFTIEHRLPKGPVTLGVLRIPLSAVERRVDDRKVASRWFSFENPDGDEKRM  607

Query  1763  YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMR  1942
             Y GR+HLRLCFDGGYHV++EAAH+CSDYRPTARQLWKPP+GTVELG+IGCKNL+P+KT+ 
Sbjct  608   YSGRMHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPPLGTVELGVIGCKNLIPVKTVN  667

Query  1943  GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD-SWEVIDP  2119
             GKG +DAY VAKYG KWVRTRT+ D+L P+WNEQYT++VYDP TV++IGVFD S    + 
Sbjct  668   GKGCSDAYCVAKYGPKWVRTRTVCDSLEPKWNEQYTFKVYDPCTVLSIGVFDNSGSGFEI  727

Query  2120  ENSKDV-----RMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTP  2284
             E SKD      R+GK+R+RISTLATGKVY+NT+ L++LSP GLKKMGE+E+AVRF+  +P
Sbjct  728   EGSKDATRPDFRIGKLRVRISTLATGKVYKNTYPLLVLSPTGLKKMGEVEIAVRFVPVSP  787

Query  2285  TLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDA  2464
             TLD +HVYSQP LP+MHHI+PLG VQQ+ LR AAVK++  HLSRSEPPL R+VV YMLDA
Sbjct  788   TLDLVHVYSQPSLPLMHHIKPLGPVQQDVLRRAAVKIVAAHLSRSEPPLGRDVVLYMLDA  847

Query  2465  DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLI  2644
             DS  FSMRKVRAN+FRIINV+A V+DVV W +DTR+W+NP ATILVHALL LLVW+PDLI
Sbjct  848   DSQGFSMRKVRANYFRIINVVAGVMDVVGWINDTRSWKNPMATILVHALLALLVWYPDLI  907

Query  2645  IPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRA  2824
             +PT AFYVF+IGAWNYRFRS+  L H+D K+SLAE++DRDELDEEFD+VP TR  ++VRA
Sbjct  908   VPTLAFYVFVIGAWNYRFRSQAPLQHYDPKLSLAENVDRDELDEEFDSVPSTRSFEVVRA  967

Query  2825  RYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMI  3004
             RYDKLRMLGARVQT+LGD ATQGERVQALVTWRDPRATGIF+ LCFVVA ILY+VPSKM+
Sbjct  968   RYDKLRMLGARVQTVLGDFATQGERVQALVTWRDPRATGIFVLLCFVVAMILYMVPSKMV  1027

Query  3005  AMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             AM FGFYYLRHP+FRDRMP  ALNF RRLPSL+DR+L
Sbjct  1028  AMVFGFYYLRHPIFRDRMPPAALNFIRRLPSLSDRLL  1064


 Score =   215 bits (548),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T  KLIVEV++ARNL PKDG GASSPYVV+D+ GQR++T+T L DLNP WNE+L+F+L
Sbjct  1    MATLHKLIVEVVDARNLSPKDGRGASSPYVVVDYRGQRRRTQTKLSDLNPVWNELLDFDL  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            S+ SD+FGD+LELDVYHDKN GPTTRNNFLGR++L+++QFVKKGEEALIY+PL++K+  +
Sbjct  61   SRPSDVFGDVLELDVYHDKNYGPTTRNNFLGRIRLSSSQFVKKGEEALIYFPLQKKSWFT  120

Query  497  WIQGDIGLKIYFVD  538
            WI+GDIGLKIY+VD
Sbjct  121  WIRGDIGLKIYYVD  134



>ref|XP_006286355.1| hypothetical protein CARUB_v10000107mg [Capsella rubella]
 gb|EOA19253.1| hypothetical protein CARUB_v10000107mg [Capsella rubella]
Length=1055

 Score =  1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/816 (67%), Positives = 660/816 (81%), Gaps = 30/816 (4%)
 Frame = +2

Query  725   PSPEQLVNDGAVEMK-ASVATASMPEVKIGGGL--------VGPKPLSRT-Psvssfvsd  874
             P+ E +V +    M  AS   + +PEV I   +         GP+PL R     +S+ S+
Sbjct  251   PNGEDIVLESDDSMSWASAPRSPLPEVTISRSISGSIPETKTGPQPLRRNVSETASYASE  310

Query  875   vsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFE  1054
             +SD S +ERS+FDLVEKMHY+FV++VKARSLPT+G PV K+ +SG+ + S+PARKT  FE
Sbjct  311   ISDVSTIERSTFDLVEKMHYVFVRVVKARSLPTSGSPVTKISLSGTMIQSKPARKTSCFE  370

Query  1055  WDQTFAFGRDAPD--SSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDP  1228
             WDQTFAF RD+PD  SS ILEISVWD         ++ +    FLGGICFDVSEIPLRDP
Sbjct  371   WDQTFAFLRDSPDLSSSPILEISVWDS--------STGIETSQFLGGICFDVSEIPLRDP  422

Query  1229  PDSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             PDSPLAPQWYRLEGGGA+  DLMLATW GTQADESFPDAWKTDTAGN T+R+KVY S KL
Sbjct  423   PDSPLAPQWYRLEGGGAYHSDLMLATWTGTQADESFPDAWKTDTAGNVTARAKVYMSSKL  482

Query  1409  WYLRSSVIEAQDIF--ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             WYLR++VIEAQD+    LTA  KE+SFQ+KAQLGFQVQKTK A +  G+PSWNEDL+FVA
Sbjct  483   WYLRATVIEAQDLLPPQLTA-FKEASFQLKAQLGFQVQKTKSAVTRNGAPSWNEDLLFVA  541

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRV  1762
             AEPF++   L F +E+   K    +G+A + L++IERRVDDR V SRWF FED N+EKR 
Sbjct  542   AEPFSDQ--LVFTLEYRTSKGPVTVGMARVALTAIERRVDDRLVASRWFGFEDPNDEKRG  599

Query  1763  YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMR  1942
              + RVHLRLCFDGGYHV++EAAH+CSDYRPTARQLWKP VG VELGIIGCKNLLPMKT+ 
Sbjct  600   NRSRVHLRLCFDGGYHVMDEAAHVCSDYRPTARQLWKPAVGIVELGIIGCKNLLPMKTVN  659

Query  1943  GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPE  2122
             GKGSTDAY VAKYG+KWVRTRT+SD+L P+WNEQYTW+VYDP TV+TIGVFDSW V + +
Sbjct  660   GKGSTDAYTVAKYGTKWVRTRTVSDSLDPKWNEQYTWKVYDPCTVLTIGVFDSWGVFEID  719

Query  2123  NSK-----DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPT  2287
               K     D+R GKVRIRISTL TGK YRNT+ L++L   G+KK+GEIELAVRF+RS P 
Sbjct  720   GGKEATRQDLRFGKVRIRISTLETGKAYRNTYPLLMLVNGGVKKLGEIELAVRFVRSAPP  779

Query  2288  LDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDAD  2467
             LDFLHVY+QP+LP+MHHI+PL   Q+E LR  AVK+L  HLSRSEPPLR E+V YMLDAD
Sbjct  780   LDFLHVYTQPLLPLMHHIKPLSLFQEEMLRNIAVKILAVHLSRSEPPLRPEIVRYMLDAD  839

Query  2468  SHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLII  2647
             SH+FSMRKVRANW RI+NV+A ++DVV+W DDTR W+NPT+T+LVHAL+V+L+WFPDLI+
Sbjct  840   SHTFSMRKVRANWLRIVNVVAGMVDVVRWVDDTRFWKNPTSTLLVHALVVMLIWFPDLIV  899

Query  2648  PTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRAR  2827
             PT AFY+FMIGAWNYRFRSR  L HFD ++SLA++ DR+ELDEEFD VP  RP +MVR+R
Sbjct  900   PTLAFYLFMIGAWNYRFRSRAALPHFDPRLSLADAADREELDEEFDVVPSNRPPEMVRSR  959

Query  2828  YDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIA  3007
             YDKLR +G RVQT+LG++A QGE++QALVTWRDPRATGIF+ LC +VA +LYLVP+KM+A
Sbjct  960   YDKLRGVGVRVQTILGEVAAQGEKMQALVTWRDPRATGIFVGLCLLVALVLYLVPTKMVA  1019

Query  3008  MAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             MA GFYY RHP+FRDR PSP LNFFRRLPSL+DR++
Sbjct  1020  MASGFYYFRHPIFRDRKPSPVLNFFRRLPSLSDRLM  1055


 Score =   201 bits (512),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKL+VEV++A++L PKDGHG SSPYVV+D+YGQR++TRT++RDLNP WNE LEF+L
Sbjct  1    MATNRKLVVEVVDAKDLTPKDGHGTSSPYVVVDYYGQRRRTRTIVRDLNPVWNETLEFSL  60

Query  317  SKH--SDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            +K     +F D LELD+YHDKN GPT RNNFLGR++L + QFV KGEEALIY+PLE+K+L
Sbjct  61   AKRPSHQLFTDALELDMYHDKNFGPTRRNNFLGRIRLGSDQFVGKGEEALIYFPLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             + +QG+IGL++Y+ D
Sbjct  121  FNLVQGEIGLRVYYAD  136



>ref|XP_007145964.1| hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris]
 gb|ESW17958.1| hypothetical protein PHAVU_006G001700g [Phaseolus vulgaris]
Length=1013

 Score =  1059 bits (2738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/822 (65%), Positives = 653/822 (79%), Gaps = 39/822 (5%)
 Frame = +2

Query  713   DPVDPSPEQLVNDGAVEMKASVATASMPEVKIGGGLVGPKPLSRTPsvs----sfvsdvs  880
             D V+P P     D  +++KA+  + S  E++ GG    P P  R  + +    +  +   
Sbjct  210   DQVNPLPA----DVDLDVKAASVSRSNSEIRFGGSNTPPPPAMRRSTSAGSFAASEASSE  265

Query  881   drsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-gshvisRPARKTLLFEW  1057
                 MERSSFDLVEKMHYLFV +VKAR LPT G PV K+ VS    V SRPARKT +FEW
Sbjct  266   ISMLMERSSFDLVEKMHYLFVHVVKARYLPTNGNPVAKIAVSGQHEVTSRPARKTTVFEW  325

Query  1058  DQTFAFGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPD  1234
             +QTFAF R+APDS SS+LE+SVWDP +S++L           LGG+CFDV+EIP+RDPPD
Sbjct  326   NQTFAFARNAPDSTSSVLEVSVWDPPASQAL-----------LGGVCFDVNEIPVRDPPD  374

Query  1235  SPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             SPLAPQWYRLEGGGA  GDLM+ATW+GTQADESFPDAWK+DT  N  SR+KVYQSPKLWY
Sbjct  375   SPLAPQWYRLEGGGALHGDLMIATWMGTQADESFPDAWKSDTFANVNSRAKVYQSPKLWY  434

Query  1415  LRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSATGSPSWN-EDLVFVAAE  1588
             LR++++EAQD+ +L   S KE+ FQ+KA+LGFQV K+K   + TG+ SWN ED +FV  E
Sbjct  435   LRATLLEAQDLLSLPFNSPKEACFQVKAKLGFQVLKSKTVLTRTGNVSWNTEDFIFVVTE  494

Query  1589  PFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYK  1768
             P ++H  L   +E+      A +GV  IPL +IERRVDDR V SRWFTF++ NE K   K
Sbjct  495   PVSDH--LELTLENRQSVAPATMGVLRIPLHAIERRVDDRIVQSRWFTFDNPNE-KEENK  551

Query  1769  GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGK  1948
              RVHLRLCFDGGYHV++EA +LCSDYRPTARQLWK PVGT ELGIIGCKNL+ MKT+ GK
Sbjct  552   PRVHLRLCFDGGYHVMDEAVNLCSDYRPTARQLWKAPVGTCELGIIGCKNLVSMKTVNGK  611

Query  1949  GSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEV---IDP  2119
              ST+AY VAKYG+KWVRTRT+SD+  P+WNEQYTW+VYDPSTV+T+GVFDSW V   ID 
Sbjct  612   SSTNAYCVAKYGNKWVRTRTVSDSTEPKWNEQYTWKVYDPSTVLTVGVFDSWTVPFIIDN  671

Query  2120  ENSK---------DVRMGKVRIRISTLATGKVYRNTFSLILLSP-AGLKKMGEIELAVRF  2269
             +N K         D R+GKVR+RISTL TGKVYRNT+ L++L+P AGL+KMGEIE+A+RF
Sbjct  672   DNDKNSDQNPGEPDFRIGKVRVRISTLQTGKVYRNTYPLLVLTPNAGLRKMGEIEIAIRF  731

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
             + +T  LD LHVY QPMLP+MHHI+PLG VQQE+LR+ AV+++  HL+R+EPPLR+EVV 
Sbjct  732   VCTTQRLDLLHVYLQPMLPLMHHIKPLGVVQQEALRSTAVRMVAGHLARAEPPLRKEVVF  791

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH+FSMRKVRANW+RIINV+  VID+V+W +DTR WRNPTAT+LVHALLV+LVW
Sbjct  792   YMLDADSHNFSMRKVRANWYRIINVVTGVIDIVRWVEDTRGWRNPTATVLVHALLVMLVW  851

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             FPDLII TF FYVF++GAWNYRFR+RD L HFD KIS+AE ++R+ELDEEFDA P  R +
Sbjct  852   FPDLIILTFCFYVFVVGAWNYRFRARDLLPHFDPKISMAEVVEREELDEEFDAAPSLRAS  911

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             ++VR RY++LR LGARVQT+LGDLATQGERVQA+VTWRDP ATG+F+ +C VVA +LYLV
Sbjct  912   EVVRVRYERLRTLGARVQTVLGDLATQGERVQAVVTWRDPHATGMFVFMCLVVAMVLYLV  971

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             PSKM+AMA GFYYLRHP+FRDR+PSPALNFFRRLPS++DR++
Sbjct  972   PSKMVAMACGFYYLRHPVFRDRLPSPALNFFRRLPSMSDRIM  1013


 Score =   201 bits (512),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEV++A +L+PKDGHG+SSPYVV+D YGQR+KTRT +R LNP WNE L FN+
Sbjct  1    MATVRKLIVEVVDAHHLVPKDGHGSSSPYVVVDIYGQRRKTRTAVRGLNPVWNEKLSFNV  60

Query  317  SKHSD--IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
              HS   IFGDMLELDVYHDK  G T RNN LGR++L+++QFV KGEEAL+YY LE+K+L
Sbjct  61   HAHSQHHIFGDMLELDVYHDKKYGATRRNNSLGRIRLSSSQFVNKGEEALVYYELEKKHL  120

Query  491  LSWIQGDIGLKIYFVD  538
            LS IQG+IGLKIY+V+
Sbjct  121  LSMIQGEIGLKIYYVN  136



>ref|XP_004149122.1| PREDICTED: uncharacterized protein LOC101222743 [Cucumis sativus]
 gb|KGN53925.1| Phosphoribosylanthranilate transferase-like protein [Cucumis 
sativus]
Length=1057

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/768 (65%), Positives = 620/768 (81%), Gaps = 8/768 (1%)
 Frame = +2

Query  827   PKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs  1006
             P+P+ R+  + S+  + ++   ME+S+FDLVEKMHYLFV++VKARSL T   P+V++   
Sbjct  293   PQPIKRSMPIPSYTLEATESRTMEQSTFDLVEKMHYLFVRVVKARSLATNSHPIVQIEAF  352

Query  1007  gshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLG  1186
             G  + S PARK+ +FEWDQTFAF R A DS+S++EISVWD   + ++ PT DV G NFLG
Sbjct  353   GKRIKSNPARKSNVFEWDQTFAFSRGAADSASMMEISVWDGKVNDAVSPT-DVDGRNFLG  411

Query  1187  GICFDVSEIPLRDPPDSPLAPQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTD  1357
             G+C DVS+I LRDPPDSPLAPQWYRLE      A  G LMLATW+GTQAD++FP+AWKTD
Sbjct  412   GLCLDVSDILLRDPPDSPLAPQWYRLERERNDAAFGGYLMLATWIGTQADDAFPNAWKTD  471

Query  1358  TAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASS  1537
               GN  SR+K+YQSPK+WYLR++VIEAQD+  +TA  KE+ FQ+KAQLGFQV  TKP  +
Sbjct  472   AGGNFNSRAKIYQSPKMWYLRATVIEAQDVVPITA-VKEALFQVKAQLGFQVSVTKPVVT  530

Query  1538  ATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI  1717
               G+PSWN+DL FVAAEP T+H L+F +      K   V+GV  IPL+ IERRVDDR+V 
Sbjct  531   RNGAPSWNQDLFFVAAEPMTDH-LIFTVESPRSSKSPTVIGVVKIPLTDIERRVDDRKVT  589

Query  1718  SRWFTFEDQNEEK-RVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVE  1894
             +RW T     +EK   Y GR+ LRLCFDGGYHV++EAAH+ SDYRPTARQLWKPPVG +E
Sbjct  590   ARWCTLAGVVDEKGSSYTGRIQLRLCFDGGYHVMDEAAHVSSDYRPTARQLWKPPVGVIE  649

Query  1895  LGIIGCKNLLPMK-TMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPS  2071
             +G+IGC++L+PMK T  GKGSTDAY VAKYGSKWVRTRT+S+N  P+WNEQYTW+VYDP 
Sbjct  650   IGVIGCRDLVPMKSTATGKGSTDAYCVAKYGSKWVRTRTVSNNFDPKWNEQYTWQVYDPC  709

Query  2072  TVVTIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             TV+TIGVFDS E  +  +  D R+GK+RIRISTL TGKVYRN + L+LL+ AG KKMGE+
Sbjct  710   TVLTIGVFDSMEESENGDRPDSRIGKIRIRISTLKTGKVYRNFYPLLLLTTAGTKKMGEL  769

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             E+AVRF+RS P LDFLHVYSQP+LP+MHH++PLG  QQ+ LR AAV+ +  H SRSEPPL
Sbjct  770   EIAVRFVRSAPPLDFLHVYSQPLLPLMHHVKPLGVRQQDLLRGAAVETVVGHFSRSEPPL  829

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
             RRE+V +MLDA+SHSFSMRK+R NW+R+INV + +I  VKW DDTR+WRNPTATILVHAL
Sbjct  830   RREIVVFMLDAESHSFSMRKIRVNWYRVINVASTIIAAVKWIDDTRSWRNPTATILVHAL  889

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
             LV+L+WFPDLIIPT +FYVF+ GAWNY+ RS + +  FD+K+S+ + ++RDELDEEFD V
Sbjct  890   LVILIWFPDLIIPTISFYVFVTGAWNYKLRSSEHIPSFDSKLSMTDIVERDELDEEFDDV  949

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P TR  ++VR RYDKLR++G RVQ+LLGDLATQGERVQALVTWRDPRATGIF  +CF VA
Sbjct  950   PSTRSAEVVRMRYDKLRVIGTRVQSLLGDLATQGERVQALVTWRDPRATGIFTGICFAVA  1009

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +LY+V  +M+A+AFGFYYLRHP+FRDR+PSPALNF RRLPSL+DR++
Sbjct  1010  VVLYVVSLRMVAVAFGFYYLRHPVFRDRLPSPALNFLRRLPSLSDRLM  1057


 Score =   216 bits (551),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  131  LEMGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEF  310
            +  G  RKLIVEV++ARNLLPKDGHG+SSPY+V+D+YGQRK+TRT++ DLNP WNE+LEF
Sbjct  1    MATGQLRKLIVEVVDARNLLPKDGHGSSSPYIVVDYYGQRKRTRTIVHDLNPTWNEVLEF  60

Query  311  NLSKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            N+   S +FGD+LELDV HD++ GPT RNNFLGR++L++TQFVKKGEEALIY+ LE+K+L
Sbjct  61   NVGPPSSVFGDVLELDVIHDRSYGPTRRNNFLGRIRLSSTQFVKKGEEALIYFRLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             SWIQG+IGLKIY+ D
Sbjct  121  FSWIQGEIGLKIYYSD  136



>ref|XP_004166136.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101227141 
[Cucumis sativus]
Length=1043

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/768 (65%), Positives = 619/768 (81%), Gaps = 8/768 (1%)
 Frame = +2

Query  827   PKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs  1006
             P+P+ R+  + S+  + ++   ME+S+FDLVEKMHYLFV++VKARSL T   P+V++   
Sbjct  279   PQPIKRSMPIPSYTLEATESRTMEQSTFDLVEKMHYLFVRVVKARSLATNSHPIVQIEAF  338

Query  1007  gshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLG  1186
             G  + S PARK+ +FEWDQTFAF R A DS+S++EISVWD   + ++ PT DV G NFLG
Sbjct  339   GKRIKSNPARKSNVFEWDQTFAFSRGAADSASMMEISVWDGKVNDAVSPT-DVDGRNFLG  397

Query  1187  GICFDVSEIPLRDPPDSPLAPQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTD  1357
             G+C DVS+I LRDPPDSPLAPQWYRLE      A  G LMLATW+GTQAD++FP+AWKTD
Sbjct  398   GLCLDVSDILLRDPPDSPLAPQWYRLERERNDAAFGGYLMLATWIGTQADDAFPNAWKTD  457

Query  1358  TAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASS  1537
               GN  SR+K+YQSPK+WYLR++VIEAQD+  +TA  KE+ FQ+KAQLGFQV  TKP  +
Sbjct  458   AGGNFNSRAKIYQSPKMWYLRATVIEAQDVVPITA-VKEALFQVKAQLGFQVSVTKPVVT  516

Query  1538  ATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI  1717
               G+PSWN+DL FVAAEP T+H L+F +      K   V+GV  IPL+ IERRVDDR+V 
Sbjct  517   RNGAPSWNQDLFFVAAEPMTDH-LIFTVESPRSSKSPTVIGVVKIPLTDIERRVDDRKVT  575

Query  1718  SRWFTFEDQNEEK-RVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVE  1894
             +RW T     +EK   Y GR+ LRLCFDGGYHV++EAAH+ SDYRPTARQLWKPPVG +E
Sbjct  576   ARWCTLAGVVDEKGSSYTGRIQLRLCFDGGYHVMDEAAHVSSDYRPTARQLWKPPVGVIE  635

Query  1895  LGIIGCKNLLPMK-TMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPS  2071
             +G+IGC++L+PMK T  GKGSTDAY VAKYGSKWVRTRT+S+N  P+WNEQYTW+VYDP 
Sbjct  636   IGVIGCRDLVPMKSTATGKGSTDAYCVAKYGSKWVRTRTVSNNFDPKWNEQYTWQVYDPC  695

Query  2072  TVVTIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             TV+TIGVFDS E  +  +  D R+GK+RIRISTL TGKVYRN + L+LL+ AG KKMGE+
Sbjct  696   TVLTIGVFDSMEESENGDRPDSRIGKIRIRISTLKTGKVYRNFYPLLLLTTAGTKKMGEL  755

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             E+AVRF+RS P LDFLHVYSQP+LP+MHH++PLG  QQ+ LR AAV+ +  H SRSEPPL
Sbjct  756   EIAVRFVRSAPPLDFLHVYSQPLLPLMHHVKPLGVRQQDLLRGAAVETVVGHFSRSEPPL  815

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
             RRE+V +MLDA+SHSFSMRK+R NW+R+INV + +I  VKW DDTR+WRNPTATILVHAL
Sbjct  816   RREIVVFMLDAESHSFSMRKIRVNWYRVINVASTIIAAVKWIDDTRSWRNPTATILVHAL  875

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
             LV+L+WFPDLIIPT + YVF+ GAWNY+ RS + +  FD+K+S+ + ++RDELDEEFD V
Sbjct  876   LVILIWFPDLIIPTISXYVFVTGAWNYKLRSSEHIPSFDSKLSMTDIVERDELDEEFDDV  935

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P TR  ++VR RYDKLR++G RVQ+LLGDLATQGERVQALVTWRDPRATGIF  +CF VA
Sbjct  936   PSTRSAEVVRMRYDKLRVIGTRVQSLLGDLATQGERVQALVTWRDPRATGIFTGICFAVA  995

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +LY+V  +M+A+AFGFYYLRHP+FRDR+PSPALNF RRLPSL+DR++
Sbjct  996   VVLYVVSLRMVAVAFGFYYLRHPVFRDRLPSPALNFLRRLPSLSDRLM  1043


 Score =   216 bits (551),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  131  LEMGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEF  310
            +  G  RKLIVEV++ARNLLPKDGHG+SSPY+V+D+YGQRK+TRT++ DLNP WNE+LEF
Sbjct  1    MATGQLRKLIVEVVDARNLLPKDGHGSSSPYIVVDYYGQRKRTRTIVHDLNPTWNEVLEF  60

Query  311  NLSKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            N+   S +FGD+LELDV HD++ GPT RNNFLGR++L++TQFVKKGEEALIY+ LE+K+L
Sbjct  61   NVGPPSSVFGDVLELDVIHDRSYGPTRRNNFLGRIRLSSTQFVKKGEEALIYFRLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             SWIQG+IGLKIY+ D
Sbjct  121  FSWIQGEIGLKIYYSD  136



>ref|XP_002266956.1| PREDICTED: uncharacterized protein LOC100249668 [Vitis vinifera]
Length=1052

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/793 (68%), Positives = 647/793 (82%), Gaps = 17/793 (2%)
 Frame = +2

Query  761   EMKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLF  940
             ++ AS+   S P+VK        +P+ R  S  +F +D+    ++ER+SFDLVEKMHY+F
Sbjct  269   QVMASIENRSAPQVKFAPF----EPVHRPLSSGNFKADLRGTVSIERTSFDLVEKMHYIF  324

Query  941   VQIVKARSLPTAGRPvvkvvvsgshvisRPARK-TLLFEWDQTFAFGRDAPDSSSILEIS  1117
             V++VKARSLPT G PVV + VSGSHV S+PA K T  FEWDQTFAFGR+ P+S+S+LE+S
Sbjct  325   VRVVKARSLPTKGNPVVTIAVSGSHVSSKPALKSTSFFEWDQTFAFGRETPESTSLLEVS  384

Query  1118  VWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGGGAHKGDLM  1297
             VWDP  S      SDVAG  FLGGICFDV+EIPLRDPPDSPLAPQWYR+EGG A  G LM
Sbjct  385   VWDPRPSNP----SDVAGDGFLGGICFDVAEIPLRDPPDSPLAPQWYRIEGGAADNGVLM  440

Query  1298  LATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKES  1477
             LATW+GTQADESFP+AW TD AG+  S+SKVYQSPKLWYLR +V+EAQD+  LT+  K+ 
Sbjct  441   LATWIGTQADESFPEAWITDAAGSVHSKSKVYQSPKLWYLRITVMEAQDVLPLTS-LKDL  499

Query  1478  SFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVL  1657
             S Q+  +LGFQ+QKTK + +  G+P WN+DL+FVAAEPFT  +L+F L       + A L
Sbjct  500   SLQLTVKLGFQIQKTKVSVTRNGTPLWNQDLMFVAAEPFTHEHLIFTLESQQTKGKVATL  559

Query  1658  GVASIPLSSIERRVDDRQVISRWFTFEDQN--EEKRVYKGRVHLRLCFDGGYHVIEEAAH  1831
             GVA +PL++IERRVDDR  +S WF+F++ N  EE+  YKGRVHLRLCFDGGYHV++EAAH
Sbjct  560   GVARVPLTAIERRVDDRTPVSHWFSFQNPNKEEERSSYKGRVHLRLCFDGGYHVMDEAAH  619

Query  1832  LCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTI  2011
             +CSD+RPTARQLWKPP+GTVELGII CKNLLPMKT+ G+GSTDAYAVAKYG KWVRTRT+
Sbjct  620   VCSDFRPTARQLWKPPIGTVELGIIACKNLLPMKTIDGRGSTDAYAVAKYGPKWVRTRTV  679

Query  2012  SDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK-----DVRMGKVRIRISTLA  2176
             S++L P+WNEQYTW+VYDP TV+++GVFDS      E SK     D RMGKVRIRISTL 
Sbjct  680   SESLDPKWNEQYTWKVYDPCTVLSVGVFDSSAAFQIEGSKEATHPDFRMGKVRIRISTLQ  739

Query  2177  TGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGA  2356
             TG+VY+N + L+LLSPAG K+MGEIELAVRF+R+  TLD LHVYSQP+LP+MHHI+PLG 
Sbjct  740   TGRVYKNRYPLLLLSPAGKKQMGEIELAVRFVRAVHTLDILHVYSQPLLPLMHHIKPLGV  799

Query  2357  VQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaav  2536
             VQQE LR  A K++  HLSRSEPPLRRE+V YMLDAD+ +FSMRKVRANW RIINV+A V
Sbjct  800   VQQEILRNTAAKIVAEHLSRSEPPLRREIVLYMLDADTQAFSMRKVRANWIRIINVVAGV  859

Query  2537  idvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKL  2716
             ID+V+W DDTR+W+NPTATILVHALLVLLVWFPDLI PT +FYVF IGAWNYRF+SR+ L
Sbjct  860   IDIVRWVDDTRSWKNPTATILVHALLVLLVWFPDLIFPTLSFYVFAIGAWNYRFKSREPL  919

Query  2717  NHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGE  2896
              HF  KIS+ E++DR+ELDEEFD VP +R  + V ARYDKLR LGARVQT+LGD ATQGE
Sbjct  920   PHFCPKISMVEAVDREELDEEFDTVPSSRSPERVLARYDKLRTLGARVQTVLGDAATQGE  979

Query  2897  RVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALN  3076
             RVQALV WRDPRATGIF+ LC VVA +LYLVPSKM+AMA GFYY+RHP+FRDR PSPA N
Sbjct  980   RVQALVMWRDPRATGIFVGLCLVVAVVLYLVPSKMVAMAGGFYYMRHPMFRDRAPSPAFN  1039

Query  3077  FFRRLPSLADRML  3115
             FFRRLPSL+DRM+
Sbjct  1040  FFRRLPSLSDRMM  1052


 Score =   204 bits (518),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M T RKLIVEV++ RNLLPKDG G SSPY ++DF GQRK+T+TV+RDLNP WNE+LEFN+
Sbjct  1    MATIRKLIVEVVDGRNLLPKDGQGTSSPYAIVDFCGQRKRTKTVVRDLNPTWNEVLEFNV  60

Query  317  SKHS-DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
            +  + ++FGD +E+DV HD+N GPT RNN LGR++L++ QFVKKGEEALIY+PLE+K+  
Sbjct  61   ASGALELFGDTIEVDVLHDRNYGPTRRNNCLGRIRLSSRQFVKKGEEALIYFPLEKKSFF  120

Query  494  SWIQGDIGLKIYFVD  538
            SW QGDIG KIY+VD
Sbjct  121  SWTQGDIGFKIYYVD  135



>ref|XP_008441994.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Cucumis melo]
Length=1069

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/768 (65%), Positives = 619/768 (81%), Gaps = 8/768 (1%)
 Frame = +2

Query  827   PKPLSRTPsvssfvsdvsdrsAMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs  1006
             P+P+ R+  + S+  + ++   ME S+FDLVEKMHYLFV++VKARSL T   P+V++   
Sbjct  305   PQPIKRSMPIPSYRLESTESQTMEGSTFDLVEKMHYLFVRVVKARSLATNSHPIVQIEAF  364

Query  1007  gshvisRPARKTLLFEWDQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLG  1186
             G  + S PARK+ +FEWDQTFAF RD  DS+S++EISVWD     ++ P SDV   NFLG
Sbjct  365   GKRITSNPARKSHVFEWDQTFAFSRDGADSASMMEISVWDGKKDDAVSP-SDVDRRNFLG  423

Query  1187  GICFDVSEIPLRDPPDSPLAPQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTD  1357
             G+CFDVS+I LRDPPDSPLAPQWY+LE      A  G LMLATW+GTQAD++F +AWKTD
Sbjct  424   GLCFDVSDILLRDPPDSPLAPQWYKLERERNDVAFGGYLMLATWLGTQADDAFANAWKTD  483

Query  1358  TAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASS  1537
               GN  SR+K+YQSPK+WYLR++VIEAQD+  +TA  KE+SFQ+KAQLGFQV  TKP  +
Sbjct  484   AGGNFHSRAKIYQSPKMWYLRATVIEAQDVVPITA-VKEASFQVKAQLGFQVSVTKPVVT  542

Query  1538  ATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI  1717
               G+PSWNEDL FVAAEP T+H L+F +      K   V+GV  IPL+ IERRVDDR+V 
Sbjct  543   RNGAPSWNEDLFFVAAEPMTDH-LIFTVESRRSSKSSTVIGVVKIPLTEIERRVDDRKVT  601

Query  1718  SRWFTFEDQNEEK-RVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVE  1894
             +RW T     +EK   YKGR+ +RLCFDGGYHV++EAAH+ SDYRPTARQLWKP VG +E
Sbjct  602   ARWCTLAGVVDEKGSSYKGRIQVRLCFDGGYHVMDEAAHVSSDYRPTARQLWKPSVGVIE  661

Query  1895  LGIIGCKNLLPMK-TMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPS  2071
             +G+IGCK+L+PMK T  GKGSTDAY VAKYGSKWVRTRT+S+N  P+WNEQYTW+VYDP 
Sbjct  662   IGVIGCKDLVPMKSTATGKGSTDAYCVAKYGSKWVRTRTVSNNFDPKWNEQYTWQVYDPC  721

Query  2072  TVVTIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             TV+TIGVFDS E  +  +  D R+GK+RIRISTL TGKVYRN + L+LL+ AG KKMGE+
Sbjct  722   TVLTIGVFDSMEGSENGDRPDSRIGKIRIRISTLKTGKVYRNFYPLLLLTTAGTKKMGEL  781

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             E+AVRF+RS P LDF+HVY+QP+LP+MHH++PLG  QQ+ LR AAV+ +  H SRSEPPL
Sbjct  782   EIAVRFVRSAPPLDFIHVYTQPLLPLMHHVKPLGVGQQDLLRGAAVETVVGHFSRSEPPL  841

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
             RRE++ +MLDA+SH+FSMRK+R NW+R+INV + +I  VKW DDTR+WRNPTATILVHAL
Sbjct  842   RREIIVFMLDAESHNFSMRKIRVNWYRVINVASTIIAAVKWIDDTRSWRNPTATILVHAL  901

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
             LV+L+WFPDLIIPT +FYVF+ GAWNY+ RS + +  FD+K+S+ + ++RDELDEEFD V
Sbjct  902   LVILIWFPDLIIPTVSFYVFVTGAWNYKLRSSELIPSFDSKLSMTDIVERDELDEEFDDV  961

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P TR  ++VR RYDKLR++G RVQ LLGDLATQGERVQALVTWRDPRATGIF  +CF+VA
Sbjct  962   PSTRSAEVVRMRYDKLRVIGTRVQGLLGDLATQGERVQALVTWRDPRATGIFTGICFMVA  1021

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +LY+VP +M+A+AFGFYYLRHP+FRDR+PSPALNF RRLPSL+DR++
Sbjct  1022  VVLYVVPLRMVAVAFGFYYLRHPVFRDRLPSPALNFLRRLPSLSDRLM  1069


 Score =   216 bits (551),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  131  LEMGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEF  310
            +  G  RKLIVEV++ARNLLPKDGHG+SSPYVV+D+YGQRK+TRTV++DLNP WNE+LEF
Sbjct  1    MATGQLRKLIVEVVDARNLLPKDGHGSSSPYVVVDYYGQRKRTRTVVQDLNPTWNEVLEF  60

Query  311  NLSKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            N+   S +FGD+LELDV HD+N GPT RN FLGR++L++TQFVKKGEEALIY+ LE+K+L
Sbjct  61   NVGPPSSVFGDVLELDVNHDRNYGPTRRNYFLGRIRLSSTQFVKKGEEALIYFHLEKKSL  120

Query  491  LSWIQGDIGLKIYFVD  538
             SWIQG+IGLKIY+ D
Sbjct  121  FSWIQGEIGLKIYYSD  136



>ref|XP_008778854.1| PREDICTED: uncharacterized protein LOC103698601 [Phoenix dactylifera]
Length=1037

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/753 (59%), Positives = 545/753 (72%), Gaps = 24/753 (3%)
 Frame = +2

Query  890   AMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             A ERS+FDLV+KM YLFV++V+ARSLP   +P V+V   G HV +R AR+   FEW+QTF
Sbjct  298   ARERSTFDLVDKMQYLFVRVVRARSLPGGAKPHVRVAAFGRHVSTRTARRAAFFEWEQTF  357

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF RD    SS LE+SVWD      L+   D    +FLGGICFDVSE+P+RDPPDSPLAP
Sbjct  358   AFARDPLADSSTLEVSVWDLPPESGLNADDD---KHFLGGICFDVSEVPMRDPPDSPLAP  414

Query  1250  QWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDT-AGNPTSRSKVYQSPKLWYLRSS  1426
             QWYRLEGG     DLM+ATW GTQADESF  +WK DT A + +SRSKVY SPKLWYLR++
Sbjct  415   QWYRLEGGRVRGADLMVATWTGTQADESFASSWKADTPASHASSRSKVYVSPKLWYLRAT  474

Query  1427  VIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPFTEHY  1606
             VIEAQD   LT   KES   ++  L FQV +T+ A S  G+PSWNEDL+FVAAEP  E  
Sbjct  475   VIEAQDT--LTVQPKESGISVRVSLAFQVLRTRNAVSRNGAPSWNEDLIFVAAEPLGEDQ  532

Query  1607  LLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTF------EDQNEEKRVYK  1768
              L   +E    K+  V+G A IPLSS+ERRVDDR+V SRW             + + +  
Sbjct  533   KLVLSLEIRHGKDTVVVGTAEIPLSSVERRVDDRKVASRWLDVLPVEVTRKGRKSRHMTS  592

Query  1769  GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGK  1948
              R+H+R+C DGGYHV +E  H  SD+RP+ARQLW+PPVG VELGIIGC+ LLPM+T+ GK
Sbjct  593   SRLHVRVCLDGGYHVADEPPHSSSDFRPSARQLWRPPVGLVELGIIGCRGLLPMRTVDGK  652

Query  1949  GSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENS  2128
             GSTDA+AVAKYG KW RTRT++D+  P WNEQYTW VYDP TV+T+ VFD         S
Sbjct  653   GSTDAFAVAKYGPKWARTRTMADSFDPAWNEQYTWPVYDPCTVLTVAVFD--------GS  704

Query  2129  KDVR---MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFL  2299
              D     MGK+RIRISTL T + YR ++ L+LL P+G+K+MGEIELAVRF  +  TLD L
Sbjct  705   MDAACRPMGKIRIRISTLETDRAYRGSYPLLLLLPSGVKRMGEIELAVRFTPARSTLDLL  764

Query  2300  HVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDA-DSHS  2476
             H+Y QPM P++HH+RP+   Q+E LR AA  ++  HLSRSEP L+REVV +MLDA +   
Sbjct  765   HMYGQPMQPLIHHLRPIRGPQREPLRLAAASIIAGHLSRSEPSLKREVVMWMLDAAEPRG  824

Query  2477  FSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTF  2656
             FSMRKVRANW RI+  +  V D  +W +DTR WRNPT+T+L H +LVLLVW+P+L  PT 
Sbjct  825   FSMRKVRANWHRIVVALGWVADTARWVEDTRTWRNPTSTMLAHGVLVLLVWYPELAGPTL  884

Query  2657  AFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDK  2836
             A + F +GAW YR+R+R    H   + S AE  DR+E+DEE D VP  R  ++VRARYD+
Sbjct  885   ALHAFAVGAWRYRWRARGPAPHPCVRSSQAEGADREEIDEEMDPVPSVRGTEVVRARYDR  944

Query  2837  LRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAF  3016
             LR + ARVQT+LGD+A Q ERVQALVTWRDPRATGIF+ALCF+V+ +LYLVP K++A   
Sbjct  945   LRGVAARVQTMLGDVAAQAERVQALVTWRDPRATGIFVALCFLVSMVLYLVPVKLVAAVV  1004

Query  3017  GFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             GFYYLRHP+FRD  P  A+NFFRRLPSL+DR++
Sbjct  1005  GFYYLRHPMFRDCKPPTAINFFRRLPSLSDRII  1037


 Score =   197 bits (500),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKLIVEV+EARNLLPKDG G SSP+V IDF GQRKKTRT+LRDLNP WNE+L FN++   
Sbjct  6    RKLIVEVVEARNLLPKDGMGTSSPFVTIDFDGQRKKTRTILRDLNPVWNEVLGFNVTGAL  65

Query  329  DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            D+  + LE  VYHD+ VGP+ RNNFLGRV+L+  QFVKKGEEALI++PLE+K+   WI+G
Sbjct  66   DVASEPLEAIVYHDQKVGPSRRNNFLGRVRLDPRQFVKKGEEALIHFPLEKKSFFGWIRG  125

Query  509  DIGLKIYFVD  538
            DIGL+IY+VD
Sbjct  126  DIGLRIYYVD  135



>ref|XP_008437583.1| PREDICTED: uncharacterized protein LOC103482952 [Cucumis melo]
Length=1035

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/759 (56%), Positives = 544/759 (72%), Gaps = 43/759 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR+L    RP +++  SG  V S     RP   T   EW++ FA
Sbjct  297   YDLVEPMQYLFIRIVKARNLAPNERPYLQIRTSGHFVKSDPANHRPGEPTESPEWNRVFA  356

Query  1073  FGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                   D++ + LEI+VWD             A   FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  357   LRHSRLDTANTTLEIAVWD------------TASEQFLGGVCFDLSDVPVRDPPDSPLAP  404

Query  1250  QWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             QWYRLEGG   +      GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  405   QWYRLEGGAGDQQPSKISGDIQLSVWIGTQADDAFPEAWCSDAPHVAHTRSKVYQSPKLW  464

Query  1412  YLRSSVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR SVIEAQD+        LTAP      ++KAQL FQ  +T+  S    S S  WNED
Sbjct  465   YLRVSVIEAQDLHIASNLPPLTAPE----IRVKAQLSFQSARTRRGSMNNHSASFHWNED  520

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             LVFVA+EP  +   L  L+E    KE  +LG   IP+ ++E+R D+R V ++W++ E  N
Sbjct  521   LVFVASEPLEDS--LILLVEDRTSKEAVLLGHVMIPVDTVEQRFDERYVAAKWYSLEGGN  578

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
               +  Y GR++LRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLP
Sbjct  579   GGE-TYSGRIYLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLP  637

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             MKT   GKGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  638   MKTKDPGKGSTDAYCVAKYGKKWVRTRTMTDSFDPRWNEQYTWQVYDPCTVLTIGVFDNW  697

Query  2105  EVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     E+  D  +GKVRIR+STL + K+Y N++ L++L   GLKKMGEIELAVRF   
Sbjct  698   RMYSDASEDKPDYHIGKVRIRVSTLESNKIYTNSYPLLVLQRTGLKKMGEIELAVRFACP  757

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
                 D   VY QP+LP MH++RPLG  QQE+LR AA K++ T L RSEPPL  EVV YML
Sbjct  758   ALLPDTCAVYGQPLLPRMHYLRPLGVAQQEALRRAATKMVATWLGRSEPPLGSEVVRYML  817

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  T+LVH L ++LVW+PD
Sbjct  818   DADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPITTMLVHILYLVLVWYPD  877

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D++
Sbjct  878   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRLSHAEAVDPDELDEEFDTIPSSKPPDII  936

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGDLATQGERVQALV+WRDPRAT +FI +CF +  ILY VP K
Sbjct  937   RVRYDRLRILAARVQTVLGDLATQGERVQALVSWRDPRATKLFIGVCFAITLILYAVPPK  996

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFYYLRHP+FRD MPS +LNFFRRLPSL+DR++
Sbjct  997   MVAVALGFYYLRHPMFRDPMPSASLNFFRRLPSLSDRLM  1035


 Score =   155 bits (393),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV +ARNLLPKDG G+SSPYVV DF GQRK+T T  R+LNP WNE LEF +S 
Sbjct  29   TVRKLVVEVADARNLLPKDGQGSSSPYVVADFDGQRKRTATKFRELNPVWNEPLEFIVSD  88

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + L+++V++DK  G  +  +N+FLGRVKL  +QF K+G+E L+YY LE+K++ S
Sbjct  89   PDNMDYEELDIEVFNDKRYGNGSGRKNHFLGRVKLYGSQFAKRGDEGLVYYQLEKKSVFS  148

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+I + D
Sbjct  149  WIRGEIGLRICYYD  162



>ref|XP_010029047.1| PREDICTED: uncharacterized protein LOC104419173 [Eucalyptus grandis]
Length=1063

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/761 (56%), Positives = 538/761 (71%), Gaps = 41/761 (5%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR L     P          V     + RP   T   EW Q FA
Sbjct  319   YDLVEPMQYLFIRIVKARGLAHNDSPYVKVGTATHRVRSKPAVHRPGEPTDSPEWHQVFA  378

Query  1073  FGRDAPDS-SSILEISVWD-PLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
              G + P+S SS LEISVWD PL S             FLGG+CFD+S++P+RDPPDSPLA
Sbjct  379   LGHNKPESTSSTLEISVWDSPLES-------------FLGGVCFDLSDVPVRDPPDSPLA  425

Query  1247  PQWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             PQWYRLEGG A +     GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  426   PQWYRLEGGDAAERSRVSGDIQLSVWIGTQADDAFPEAWSSDAPHVAHTRSKVYQSPKLW  485

Query  1412  YLRSSVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDLVFV  1579
             YLR +VIEAQD+   +   P      ++KAQLGFQ  +T+  S +   PS  WNEDLV V
Sbjct  486   YLRVTVIEAQDLHIASNLPPLTAPEVRVKAQLGFQSVRTRRGSMSNNVPSFHWNEDLVLV  545

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR  1759
             A EP  +   L  L+E    KE  +LG   IP++SIE+R+D+R V ++WF  E       
Sbjct  546   ACEPLEDS--LILLVEDRSNKETLLLGHILIPVASIEQRIDERHVAAKWFPLEGGAGGGC  603

Query  1760  V-----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y GR++LRLC +GGYHV++EAAH+CSD+RPTA+QLWKPP+G +ELGI+G + LL
Sbjct  604   GAGPGPYLGRLYLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPIGILELGILGARGLL  663

Query  1925  PMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+   GKGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+T GVFD+
Sbjct  664   PMKSKGPGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTAGVFDN  723

Query  2102  WEVI-DPENSK--DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             W +  DP   +  D  MGK+RIR+STL + KVY N++ L++L+  GLKKMGEIELAVRF 
Sbjct  724   WRMFADPSTDERPDCCMGKIRIRVSTLESNKVYTNSYPLLVLTRTGLKKMGEIELAVRFA  783

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               +   D   VY QP+LP MH++RPLG  QQE+LR AA K++   L+RSEPPL  EVV  
Sbjct  784   CPSLLPDTCIVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAAWLARSEPPLGPEVVRC  843

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLDADSH++SMRK +ANWFRI+ V+A  I + KW DD R WRNP  T+LVH L ++LVW+
Sbjct  844   MLDADSHTWSMRKSKANWFRIVAVLAWAIGLAKWLDDIRRWRNPVTTVLVHILYLVLVWY  903

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             PDLI+PT   YVF+IG W YRFR +      DT++S AES+D DELDEEFD +P ++P D
Sbjct  904   PDLIVPTGFLYVFLIGIWYYRFRPKIPAG-MDTRLSQAESVDPDELDEEFDTIPSSKPPD  962

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             ++R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C  +  ILY VP
Sbjct  963   LIRQRYDRLRLLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLAITLILYTVP  1022

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1023  PKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1063


 Score =   146 bits (368),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEVI+AR+LLPKDG G+SSPYV+++F  Q+++T T  R+LNP W+E LEF +S   
Sbjct  21   RKLLVEVIDARDLLPKDGQGSSSPYVIVEFDNQKRRTSTQYRNLNPAWHEALEFVVSDPE  80

Query  329  DIFGDMLELDVYHDKNV---GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
            ++  + L+++V++DK     G   +N+FLGRVKL  +QF ++GEE L+Y+ LE+K++ SW
Sbjct  81   NMAYEELDVEVFNDKRYAAGGGGRKNHFLGRVKLYGSQFQRRGEEGLVYHQLEKKSVFSW  140

Query  500  IQGDIGLKIYFVD  538
            I+G+IGL+I + D
Sbjct  141  IRGEIGLRICYYD  153



>gb|KCW83529.1| hypothetical protein EUGRSUZ_B00432 [Eucalyptus grandis]
Length=1087

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/761 (56%), Positives = 538/761 (71%), Gaps = 41/761 (5%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR L     P          V     + RP   T   EW Q FA
Sbjct  343   YDLVEPMQYLFIRIVKARGLAHNDSPYVKVGTATHRVRSKPAVHRPGEPTDSPEWHQVFA  402

Query  1073  FGRDAPDS-SSILEISVWD-PLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
              G + P+S SS LEISVWD PL S             FLGG+CFD+S++P+RDPPDSPLA
Sbjct  403   LGHNKPESTSSTLEISVWDSPLES-------------FLGGVCFDLSDVPVRDPPDSPLA  449

Query  1247  PQWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             PQWYRLEGG A +     GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  450   PQWYRLEGGDAAERSRVSGDIQLSVWIGTQADDAFPEAWSSDAPHVAHTRSKVYQSPKLW  509

Query  1412  YLRSSVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDLVFV  1579
             YLR +VIEAQD+   +   P      ++KAQLGFQ  +T+  S +   PS  WNEDLV V
Sbjct  510   YLRVTVIEAQDLHIASNLPPLTAPEVRVKAQLGFQSVRTRRGSMSNNVPSFHWNEDLVLV  569

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR  1759
             A EP  +   L  L+E    KE  +LG   IP++SIE+R+D+R V ++WF  E       
Sbjct  570   ACEPLEDS--LILLVEDRSNKETLLLGHILIPVASIEQRIDERHVAAKWFPLEGGAGGGC  627

Query  1760  V-----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y GR++LRLC +GGYHV++EAAH+CSD+RPTA+QLWKPP+G +ELGI+G + LL
Sbjct  628   GAGPGPYLGRLYLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPIGILELGILGARGLL  687

Query  1925  PMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+   GKGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+T GVFD+
Sbjct  688   PMKSKGPGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTAGVFDN  747

Query  2102  WEVI-DPENSK--DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             W +  DP   +  D  MGK+RIR+STL + KVY N++ L++L+  GLKKMGEIELAVRF 
Sbjct  748   WRMFADPSTDERPDCCMGKIRIRVSTLESNKVYTNSYPLLVLTRTGLKKMGEIELAVRFA  807

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               +   D   VY QP+LP MH++RPLG  QQE+LR AA K++   L+RSEPPL  EVV  
Sbjct  808   CPSLLPDTCIVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAAWLARSEPPLGPEVVRC  867

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLDADSH++SMRK +ANWFRI+ V+A  I + KW DD R WRNP  T+LVH L ++LVW+
Sbjct  868   MLDADSHTWSMRKSKANWFRIVAVLAWAIGLAKWLDDIRRWRNPVTTVLVHILYLVLVWY  927

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             PDLI+PT   YVF+IG W YRFR +      DT++S AES+D DELDEEFD +P ++P D
Sbjct  928   PDLIVPTGFLYVFLIGIWYYRFRPKIPAG-MDTRLSQAESVDPDELDEEFDTIPSSKPPD  986

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             ++R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C  +  ILY VP
Sbjct  987   LIRQRYDRLRLLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLAITLILYTVP  1046

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1047  PKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1087


 Score =   146 bits (368),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEVI+AR+LLPKDG G+SSPYV+++F  Q+++T T  R+LNP W+E LEF +S   
Sbjct  19   RKLLVEVIDARDLLPKDGQGSSSPYVIVEFDNQKRRTSTQYRNLNPAWHEALEFVVSDPE  78

Query  329  DIFGDMLELDVYHDKNV---GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
            ++  + L+++V++DK     G   +N+FLGRVKL  +QF ++GEE L+Y+ LE+K++ SW
Sbjct  79   NMAYEELDVEVFNDKRYAAGGGGRKNHFLGRVKLYGSQFQRRGEEGLVYHQLEKKSVFSW  138

Query  500  IQGDIGLKIYFVD  538
            I+G+IGL+I + D
Sbjct  139  IRGEIGLRICYYD  151



>ref|XP_004152538.1| PREDICTED: uncharacterized protein LOC101219043 [Cucumis sativus]
Length=1028

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 542/759 (71%), Gaps = 43/759 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR+L    RP +++  SG  V S     RP   T   EW++ FA
Sbjct  290   YDLVEPMQYLFIRIVKARNLAPNERPYLQIRTSGHFVKSDPANHRPGEPTESPEWNRVFA  349

Query  1073  FGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                   D++ + LEI+VWD             +   FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  350   LRHSRLDTANTTLEIAVWD------------TSSEQFLGGVCFDLSDVPVRDPPDSPLAP  397

Query  1250  QWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             QWYRLEGG   +      GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  398   QWYRLEGGAGDQQPSKISGDIQLSVWIGTQADDAFPEAWCSDAPHVAHTRSKVYQSPKLW  457

Query  1412  YLRSSVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR SVIEAQD+        LTAP      ++KAQL FQ  +T+  S    S S  WNED
Sbjct  458   YLRVSVIEAQDLHIASNLPPLTAPE----IRVKAQLSFQSARTRRGSMNNHSASFHWNED  513

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             LVFVA EP  +   L  L+E    KE  +LG   IP+ ++E+R D+R V ++W++ E  N
Sbjct  514   LVFVAGEPLEDS--LILLVEDRTSKEAILLGHVMIPVDTVEQRFDERYVAAKWYSLEGGN  571

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
               +  Y GR++LRLC +GGYHV++EAAH+CSD+RPTA+QLWK  VG +ELGI+G + LLP
Sbjct  572   GGE-TYSGRIYLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKSAVGILELGILGARGLLP  630

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             MKT   GKGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  631   MKTKDPGKGSTDAYCVAKYGKKWVRTRTMTDSFDPRWNEQYTWQVYDPCTVLTIGVFDNW  690

Query  2105  EVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     E+  D  +GKVRIR+STL + K+Y N++ L++L   GLKKMGEIELAVRF   
Sbjct  691   RMYSDASEDKPDYHIGKVRIRVSTLESNKIYTNSYPLLVLQRTGLKKMGEIELAVRFACP  750

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
                 D   VY QP+LP MH++RPLG  QQE+LR AA K++ T L RSEPPL  EVV YML
Sbjct  751   ALLPDTCAVYGQPLLPRMHYLRPLGVAQQEALRRAATKMVATWLGRSEPPLGSEVVRYML  810

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  T+LVH L ++LVW+PD
Sbjct  811   DADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPITTMLVHILYLVLVWYPD  870

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D++
Sbjct  871   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRLSHAEAVDPDELDEEFDTIPSSKPPDII  929

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGDLATQGERVQALV+WRDPRAT +FI +CF +  ILY VP K
Sbjct  930   RVRYDRLRILAARVQTVLGDLATQGERVQALVSWRDPRATKLFIGVCFAITLILYAVPPK  989

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFYYLRHP+FRD MPS +LNFFRRLPSL+DR++
Sbjct  990   MVAVALGFYYLRHPMFRDPMPSASLNFFRRLPSLSDRLM  1028


 Score =   155 bits (393),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV +ARNLLPKDG G+SSPYVV DF GQRK+T T  R+LNP WNE LEF +S 
Sbjct  22   TVRKLVVEVADARNLLPKDGQGSSSPYVVADFDGQRKRTATKFRELNPVWNEPLEFIVSD  81

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + L+++V++DK  G  +  +N+FLGRVKL  +QF K+G+E L+YY LE+K++ S
Sbjct  82   PDNMDYEELDIEVFNDKRYGNGSGRKNHFLGRVKLYGSQFAKRGDEGLVYYQLEKKSVFS  141

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+I + D
Sbjct  142  WIRGEIGLRICYYD  155



>ref|XP_004171482.1| PREDICTED: uncharacterized LOC101219043 [Cucumis sativus]
 gb|KGN64254.1| hypothetical protein Csa_1G045520 [Cucumis sativus]
Length=1033

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 542/759 (71%), Gaps = 43/759 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR+L    RP +++  SG  V S     RP   T   EW++ FA
Sbjct  295   YDLVEPMQYLFIRIVKARNLAPNERPYLQIRTSGHFVKSDPANHRPGEPTESPEWNRVFA  354

Query  1073  FGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                   D++ + LEI+VWD             +   FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  355   LRHSRLDTANTTLEIAVWD------------TSSEQFLGGVCFDLSDVPVRDPPDSPLAP  402

Query  1250  QWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             QWYRLEGG   +      GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  403   QWYRLEGGAGDQQPSKISGDIQLSVWIGTQADDAFPEAWCSDAPHVAHTRSKVYQSPKLW  462

Query  1412  YLRSSVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR SVIEAQD+        LTAP      ++KAQL FQ  +T+  S    S S  WNED
Sbjct  463   YLRVSVIEAQDLHIASNLPPLTAPE----IRVKAQLSFQSARTRRGSMNNHSASFHWNED  518

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             LVFVA EP  +   L  L+E    KE  +LG   IP+ ++E+R D+R V ++W++ E  N
Sbjct  519   LVFVAGEPLEDS--LILLVEDRTSKEAILLGHVMIPVDTVEQRFDERYVAAKWYSLEGGN  576

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
               +  Y GR++LRLC +GGYHV++EAAH+CSD+RPTA+QLWK  VG +ELGI+G + LLP
Sbjct  577   GGE-TYSGRIYLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKSAVGILELGILGARGLLP  635

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             MKT   GKGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  636   MKTKDPGKGSTDAYCVAKYGKKWVRTRTMTDSFDPRWNEQYTWQVYDPCTVLTIGVFDNW  695

Query  2105  EVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     E+  D  +GKVRIR+STL + K+Y N++ L++L   GLKKMGEIELAVRF   
Sbjct  696   RMYSDASEDKPDYHIGKVRIRVSTLESNKIYTNSYPLLVLQRTGLKKMGEIELAVRFACP  755

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
                 D   VY QP+LP MH++RPLG  QQE+LR AA K++ T L RSEPPL  EVV YML
Sbjct  756   ALLPDTCAVYGQPLLPRMHYLRPLGVAQQEALRRAATKMVATWLGRSEPPLGSEVVRYML  815

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  T+LVH L ++LVW+PD
Sbjct  816   DADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPITTMLVHILYLVLVWYPD  875

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D++
Sbjct  876   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRLSHAEAVDPDELDEEFDTIPSSKPPDII  934

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGDLATQGERVQALV+WRDPRAT +FI +CF +  ILY VP K
Sbjct  935   RVRYDRLRILAARVQTVLGDLATQGERVQALVSWRDPRATKLFIGVCFAITLILYAVPPK  994

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFYYLRHP+FRD MPS +LNFFRRLPSL+DR++
Sbjct  995   MVAVALGFYYLRHPMFRDPMPSASLNFFRRLPSLSDRLM  1033


 Score =   155 bits (393),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV +ARNLLPKDG G+SSPYVV DF GQRK+T T  R+LNP WNE LEF +S 
Sbjct  27   TVRKLVVEVADARNLLPKDGQGSSSPYVVADFDGQRKRTATKFRELNPVWNEPLEFIVSD  86

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + L+++V++DK  G  +  +N+FLGRVKL  +QF K+G+E L+YY LE+K++ S
Sbjct  87   PDNMDYEELDIEVFNDKRYGNGSGRKNHFLGRVKLYGSQFAKRGDEGLVYYQLEKKSVFS  146

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+I + D
Sbjct  147  WIRGEIGLRICYYD  160



>ref|XP_004508771.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=1029

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/760 (56%), Positives = 549/760 (72%), Gaps = 48/760 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTF  1069
             +DLVE M YLFV+IVK R L P    P VKV  S  +V S+PA           EW+Q F
Sbjct  294   YDLVEPMQYLFVRIVKVRGLNPPTESPFVKVRTSSHYVRSKPASYRPNEPNDSPEWNQVF  353

Query  1070  AFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A G +  DS+ + LEISVWD        PT       FLGG+CFD+S++P+RD PDSPLA
Sbjct  354   ALGYNKTDSNGATLEISVWD-------SPT-----EQFLGGVCFDLSDVPVRDSPDSPLA  401

Query  1247  PQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             PQWYRLEGG A +      GD+ L+ W+GTQ+D++FP+AW +D      +RSKVYQSPKL
Sbjct  402   PQWYRLEGGAAEQNSGRVSGDVQLSVWIGTQSDDAFPEAWSSDAPYVAHTRSKVYQSPKL  461

Query  1409  WYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             WYLR +V+EAQD+        LTAP      ++K QLGFQ Q+T+  S    S S  W+E
Sbjct  462   WYLRVTVMEAQDLNLTPNLPPLTAPE----IRVKVQLGFQSQRTRRGSMNHHSMSFHWHE  517

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVA EP  +  +L  L+E    KE A+LG   IPL+SIE+R+DDR V ++WF  E  
Sbjct  518   DLLFVAGEPLEDSMVL--LMEDRTTKEAALLGHVVIPLTSIEQRIDDRHVPAKWFPLEGG  575

Query  1745  NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +     Y GRVHLRLC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGI+G + LL
Sbjct  576   S-----YCGRVHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGILELGILGARGLL  630

Query  1925  PMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+   GKGSTD+Y VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+GVFD+
Sbjct  631   PMKSKGPGKGSTDSYCVAKYGKKWVRTRTVTDSFDPRWNEQYTWQVYDPCTVLTVGVFDN  690

Query  2102  WEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +     E   D R+GKVRIR+STL + K+Y +++ L++L+  GLKKMGEIELAVRF  
Sbjct  691   WRMFADVSEEKPDCRIGKVRIRVSTLESNKIYTSSYPLLVLTRTGLKKMGEIELAVRFAC  750

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
              +   D   VY QP+LP MH+IRPLG  ++E+LR AA K++   L+RSEPP+  EVV YM
Sbjct  751   PSLLPDTCAVYGQPLLPRMHYIRPLGXAKREALRGAATKMVAQWLARSEPPMGHEVVRYM  810

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSH++SMRK ++NWFRI++V++  + + KW DD R W+NP  T+L+H L ++LVW+P
Sbjct  811   LDADSHAWSMRKSKSNWFRIVSVLSWAVGLAKWLDDIRRWKNPVTTVLLHILYLVLVWYP  870

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DL++PT   YV +IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D+
Sbjct  871   DLVVPTGFLYVVLIGIWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEFDTMPSSKPPDL  929

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +CFV+A ILY VP 
Sbjct  930   VRVRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCFVIAIILYSVPP  989

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MP   LNFFRRLPSL+DR++
Sbjct  990   KMVAVALGFYYLRHPMFRNPMPPATLNFFRRLPSLSDRLM  1029


 Score =   164 bits (416),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R+L+VEVI+ARNLLPKDG G+SSPYVV DF GQRK+T T  ++LNP WNE LEF +S 
Sbjct  15   TVRRLVVEVIDARNLLPKDGQGSSSPYVVADFDGQRKRTTTRFKELNPVWNESLEFIVSD  74

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK  G  +  +N+FLGRVKL  TQF  +GEEAL+YY LE+K++ S
Sbjct  75   PDNMEFEELEVEVYNDKKFGNGSGRKNHFLGRVKLYGTQFSGRGEEALVYYTLEKKSVFS  134

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGLKIY+ D
Sbjct  135  WIRGEIGLKIYYYD  148



>ref|XP_010538085.1| PREDICTED: uncharacterized protein LOC104812557 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538086.1| PREDICTED: uncharacterized protein LOC104812557 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010538087.1| PREDICTED: uncharacterized protein LOC104812557 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010538089.1| PREDICTED: uncharacterized protein LOC104812557 isoform X5 [Tarenaya 
hassleriana]
Length=1054

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/766 (56%), Positives = 540/766 (70%), Gaps = 46/766 (6%)
 Frame = +2

Query  896   ERSS-FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvs----gshvisRPARKTLLFEW  1057
             ERS  +DLVE M YLFV+I KAR L P+ G  V     +        I RP   T   EW
Sbjct  309   ERSRPYDLVEPMQYLFVKIEKARGLAPSDGAYVKVRTSNHFKRTKPAIYRPGEPTDSPEW  368

Query  1058  DQTFAFGRDAPDSS---SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDP  1228
              Q FA G +  DS+     LEISVWD  S             +FLGG+CFD+SE+P+RDP
Sbjct  369   KQVFALGHNRADSAVSGETLEISVWDAPS------------ESFLGGVCFDLSEVPVRDP  416

Query  1229  PDSPLAPQWYRLEGG------GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKV  1390
             PDSPLAPQWYRLEG       G   GD+ L+ W+GTQADE+FP+AW +D      +RSKV
Sbjct  417   PDSPLAPQWYRLEGSATDQSSGRVSGDIQLSVWIGTQADEAFPEAWSSDVPHVVHTRSKV  476

Query  1391  YQSPKLWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATG  1546
             YQSPKLWYLR++V+EAQD+        LTAP      ++KAQLGFQ  +T   S  + +G
Sbjct  477   YQSPKLWYLRATVVEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTSRGSMNNHSG  532

Query  1547  SPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRW  1726
             S  WNEDL+FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W
Sbjct  533   SFHWNEDLIFVAGEPLED--CLILVVEDRTTKETQLLGHAMIPVSSIEQRIDERHVPSKW  590

Query  1727  FTFEDQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
              T  D       Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKP +G +ELGI+
Sbjct  591   HTL-DGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPAIGILELGIL  649

Query  1907  GCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+T
Sbjct  650   GARGLLPMKAKDGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLT  709

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             IGVFD+W +     +N  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEIE+
Sbjct  710   IGVFDNWRMFSDISDNRPDTRIGKIRIRVSTLESNKVYTNSYPLVVLLPSGLKKMGEIEV  769

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF   +   D   VY QP+LP MH++RPLG  QQE+LR AA K++   L+R+EPPL  
Sbjct  770   AIRFACPSLLPDICAVYGQPLLPRMHYVRPLGVAQQEALRGAATKMVAGWLARAEPPLGS  829

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW +  R WRNP  TILVH L +
Sbjct  830   EVVRYMLDADSHTWSMRKSKANWYRIVGVLAWAVGLAKWLNSIRQWRNPVTTILVHILYL  889

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LVW+PDL++PT   YV MIG W YRFR +      D ++S AE +D DELDEEFD +P 
Sbjct  890   VLVWYPDLVVPTGFLYVVMIGVWYYRFRPKIPAG-MDVRLSQAEMVDPDELDEEFDTIPS  948

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R  +++RARYD+LR+LG RVQT+LGDLA QGER+QALV+WRDPRAT +FIA+C  +  +
Sbjct  949   SRRPEVIRARYDRLRILGVRVQTILGDLAAQGERIQALVSWRDPRATKLFIAICLAITIV  1008

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+VP KM+A+A GFYYLRHP+FR  MP  +LNFFRRLPSL+DR++
Sbjct  1009  LYVVPPKMVAVALGFYYLRHPMFRHWMPPASLNFFRRLPSLSDRLI  1054


 Score =   171 bits (433),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T+R+LIVE++EAR+LLPKDGHG+SS YVV+DF  Q+K+T T  RDLNP WNEMLEF +S 
Sbjct  22   TQRRLIVEIVEARDLLPKDGHGSSSAYVVVDFDAQKKRTSTKFRDLNPVWNEMLEFVVSD  81

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + L+++VY+DK  G  +  +NNFLGRVK+  +QF ++GEE L+Y+PLE+K++ S
Sbjct  82   PKNMEREELDVEVYNDKRFGNGSGRKNNFLGRVKIYGSQFARRGEEGLVYFPLEKKSVFS  141

Query  497  WIQGDIGLKIYFVD  538
            W++GDIGLKIY+ D
Sbjct  142  WVRGDIGLKIYYFD  155



>ref|XP_003609007.1| Unc-13-like protein [Medicago truncatula]
Length=1036

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/760 (56%), Positives = 545/760 (72%), Gaps = 48/760 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTF  1069
             +DLVE M YLFV+IVK R L P    P VKV  S  +V S+PA           EW+Q F
Sbjct  301   YDLVEPMQYLFVRIVKVRGLNPPTESPFVKVRTSSHYVRSKPASFRPNEPNDSPEWNQVF  360

Query  1070  AFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A G    D++ + LEISVWD        PT       FLGG+CFD+S++P+RD PDSPLA
Sbjct  361   ALGYSKTDATGATLEISVWD-------SPTE-----QFLGGVCFDLSDVPIRDSPDSPLA  408

Query  1247  PQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             PQWYRLEGG A +      GD+ L+ W+GTQ+D++FP+AW +D      +RSKVYQSPKL
Sbjct  409   PQWYRLEGGAAEQNAVRVSGDIQLSVWIGTQSDDAFPEAWSSDAPYVAHTRSKVYQSPKL  468

Query  1409  WYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             WYLR +V+EAQD+        LTAP      ++K QLGFQ Q+T+  S    S S  W+E
Sbjct  469   WYLRVTVMEAQDLNLTPNLPPLTAPE----IRVKVQLGFQSQRTRRGSMNHHSMSFHWHE  524

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVA EP  +  +L  L+E    KE A+LG   IPL+SIE+R+DDR V ++WF  E  
Sbjct  525   DLLFVAGEPLEDSMVL--LVEDRTTKEAALLGHVVIPLTSIEQRIDDRHVPAKWFPLEGG  582

Query  1745  NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +     Y GRVHLRLC +GGYHV++EAAH+CSD+RPTA+ LWKPPVG +ELGI+G + LL
Sbjct  583   S-----YCGRVHLRLCLEGGYHVLDEAAHVCSDFRPTAKSLWKPPVGILELGILGARGLL  637

Query  1925  PMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+   GKGSTD+Y VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+GVFD+
Sbjct  638   PMKSKGPGKGSTDSYCVAKYGKKWVRTRTVTDSFDPRWNEQYTWQVYDPCTVLTVGVFDN  697

Query  2102  WEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +     E   D R+GK+RIR+STL + K+Y +++ L++L+  GLKKMGEIELAVRF  
Sbjct  698   WRMFADVAEEKPDCRIGKIRIRVSTLESNKIYTSSYPLLVLTRNGLKKMGEIELAVRFAC  757

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
                  D   VY QP+LP MH+IRPLG  QQE+LR AA K++   L+RSEPP+  EVV YM
Sbjct  758   HGFFPDTCAVYQQPLLPKMHYIRPLGVAQQEALRGAATKMVAQWLARSEPPMGHEVVRYM  817

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSH++SMRK +ANWFRI+ V+A  + + KW DD R W+NP  T+L+H L ++LVW+P
Sbjct  818   LDADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWKNPVTTVLLHILYLVLVWYP  877

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DLI+PT   YV +IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D+
Sbjct  878   DLIVPTGFLYVVLIGIWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEFDTMPSSKPPDL  936

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C V+A ILY VP 
Sbjct  937   VRVRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLVIAVILYSVPP  996

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  997   KMVAVALGFYYLRHPMFRNPMPPASLNFFRRLPSLSDRLM  1036


 Score =   164 bits (414),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R+L VEV++ARNLLPKDG G+SSPYVV DF GQRK+T T  ++LNP WNE+LEF +S 
Sbjct  13   TVRRLAVEVVDARNLLPKDGQGSSSPYVVADFDGQRKRTTTRFKELNPVWNELLEFIVSD  72

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK  G  +  +N+FLGRVKL  TQF  +GEEAL+YY LE+K++ S
Sbjct  73   PDNMEFEELEVEVYNDKKFGNGSGRKNHFLGRVKLYGTQFFGRGEEALVYYTLEKKSVFS  132

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGLKIY+ D
Sbjct  133  WIRGEIGLKIYYYD  146



>gb|AES91204.2| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=1038

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/760 (56%), Positives = 545/760 (72%), Gaps = 48/760 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTF  1069
             +DLVE M YLFV+IVK R L P    P VKV  S  +V S+PA           EW+Q F
Sbjct  303   YDLVEPMQYLFVRIVKVRGLNPPTESPFVKVRTSSHYVRSKPASFRPNEPNDSPEWNQVF  362

Query  1070  AFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A G    D++ + LEISVWD        PT       FLGG+CFD+S++P+RD PDSPLA
Sbjct  363   ALGYSKTDATGATLEISVWD-------SPTE-----QFLGGVCFDLSDVPIRDSPDSPLA  410

Query  1247  PQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             PQWYRLEGG A +      GD+ L+ W+GTQ+D++FP+AW +D      +RSKVYQSPKL
Sbjct  411   PQWYRLEGGAAEQNAVRVSGDIQLSVWIGTQSDDAFPEAWSSDAPYVAHTRSKVYQSPKL  470

Query  1409  WYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             WYLR +V+EAQD+        LTAP      ++K QLGFQ Q+T+  S    S S  W+E
Sbjct  471   WYLRVTVMEAQDLNLTPNLPPLTAPE----IRVKVQLGFQSQRTRRGSMNHHSMSFHWHE  526

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVA EP  +  +L  L+E    KE A+LG   IPL+SIE+R+DDR V ++WF  E  
Sbjct  527   DLLFVAGEPLEDSMVL--LVEDRTTKEAALLGHVVIPLTSIEQRIDDRHVPAKWFPLEGG  584

Query  1745  NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +     Y GRVHLRLC +GGYHV++EAAH+CSD+RPTA+ LWKPPVG +ELGI+G + LL
Sbjct  585   S-----YCGRVHLRLCLEGGYHVLDEAAHVCSDFRPTAKSLWKPPVGILELGILGARGLL  639

Query  1925  PMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+   GKGSTD+Y VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+GVFD+
Sbjct  640   PMKSKGPGKGSTDSYCVAKYGKKWVRTRTVTDSFDPRWNEQYTWQVYDPCTVLTVGVFDN  699

Query  2102  WEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +     E   D R+GK+RIR+STL + K+Y +++ L++L+  GLKKMGEIELAVRF  
Sbjct  700   WRMFADVAEEKPDCRIGKIRIRVSTLESNKIYTSSYPLLVLTRNGLKKMGEIELAVRFAC  759

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
                  D   VY QP+LP MH+IRPLG  QQE+LR AA K++   L+RSEPP+  EVV YM
Sbjct  760   HGFFPDTCAVYQQPLLPKMHYIRPLGVAQQEALRGAATKMVAQWLARSEPPMGHEVVRYM  819

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSH++SMRK +ANWFRI+ V+A  + + KW DD R W+NP  T+L+H L ++LVW+P
Sbjct  820   LDADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWKNPVTTVLLHILYLVLVWYP  879

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DLI+PT   YV +IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D+
Sbjct  880   DLIVPTGFLYVVLIGIWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEFDTMPSSKPPDL  938

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C V+A ILY VP 
Sbjct  939   VRVRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLVIAVILYSVPP  998

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  999   KMVAVALGFYYLRHPMFRNPMPPASLNFFRRLPSLSDRLM  1038


 Score =   164 bits (414),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R+L VEV++ARNLLPKDG G+SSPYVV DF GQRK+T T  ++LNP WNE+LEF +S 
Sbjct  15   TVRRLAVEVVDARNLLPKDGQGSSSPYVVADFDGQRKRTTTRFKELNPVWNELLEFIVSD  74

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK  G  +  +N+FLGRVKL  TQF  +GEEAL+YY LE+K++ S
Sbjct  75   PDNMEFEELEVEVYNDKKFGNGSGRKNHFLGRVKLYGTQFFGRGEEALVYYTLEKKSVFS  134

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGLKIY+ D
Sbjct  135  WIRGEIGLKIYYYD  148



>ref|XP_007155336.1| hypothetical protein PHAVU_003G192500g [Phaseolus vulgaris]
 gb|ESW27330.1| hypothetical protein PHAVU_003G192500g [Phaseolus vulgaris]
Length=1019

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/760 (56%), Positives = 545/760 (72%), Gaps = 48/760 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvsgshvisRPAR-----KTLLFEWDQTF  1069
             FDLVE M YLFV+IVKAR + P +  P VKV  S  ++ S+PA           EW+Q F
Sbjct  284   FDLVEPMQYLFVKIVKARGVAPPSEAPFVKVRTSSHYMRSKPASFRPNDPPDSPEWNQVF  343

Query  1070  AFGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A G +  D+ S+ LEISVWD             +  NFLGG+CFD+S++P+RDPPDSPLA
Sbjct  344   ALGYNKTDANSATLEISVWD------------TSTENFLGGVCFDLSDVPVRDPPDSPLA  391

Query  1247  PQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             PQWYRLEGG A +      GD+ L+ W+GTQ+D++FP+AW +D      +RSKVYQSPKL
Sbjct  392   PQWYRLEGGTAEQNPGRVSGDIQLSVWIGTQSDDAFPEAWISDAPYVAHTRSKVYQSPKL  451

Query  1409  WYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             WYLR +V+EAQD+        LTAP      ++K QLGFQ Q+T+  S    S S  WNE
Sbjct  452   WYLRVTVVEAQDLNIAPNLPPLTAPE----VRVKVQLGFQSQRTRRGSMNHRSLSFHWNE  507

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVA EP  +  ++  LIE    KE A+LG   +PLSSIE+R+D+R V ++WF  E  
Sbjct  508   DLLFVAGEPLEDSVII--LIEDRTTKEAALLGHIVVPLSSIEQRIDERHVAAKWFPLEGG  565

Query  1745  NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y GRV LRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LL
Sbjct  566   P-----YCGRVFLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLL  620

Query  1925  PMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK+  G KGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+GVFD+
Sbjct  621   PMKSKGGGKGSTDAYCVAKYGKKWVRTRTVTDSFDPRWNEQYTWQVYDPCTVLTVGVFDN  680

Query  2102  WEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +    PE+  D R+GKVRIR+STL + +VY N++ L++L+  GLKKMGEIELAVRF  
Sbjct  681   WRMFADVPEDRPDCRIGKVRIRVSTLESNRVYTNSYPLLVLTRTGLKKMGEIELAVRFAC  740

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
              +   D   VY QP+LP MH++RPLG  QQE+LR AA K++   L+RSEP L  EVV YM
Sbjct  741   PSLLPDTCAVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAQWLARSEPALGHEVVRYM  800

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSH +SMRK +ANWFRI+ V+A  + + KW DD R W+NP  T+L+H L ++LVW+P
Sbjct  801   LDADSHVWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWKNPVTTVLLHMLYLVLVWYP  860

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DLI+PT   YV +IG W YRFR +      DT++S AE++D DELDEEFD +P ++P D+
Sbjct  861   DLIVPTGFLYVVLIGIWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEFDTMPSSKPPDI  919

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             +R RYD+LRML ARVQT+LGD ATQGER+QALV+WRDPRAT +FI +C  +   LY +P 
Sbjct  920   IRMRYDRLRMLAARVQTVLGDFATQGERLQALVSWRDPRATKLFIGVCLAITVTLYAMPP  979

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MPS  LNFFRRLPSL+DR++
Sbjct  980   KMVAVALGFYYLRHPMFRNPMPSATLNFFRRLPSLSDRLM  1019


 Score =   160 bits (405),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            R+L+VEVI+ARNLLPKDG G+SSPYVV DF GQRK+T T  ++LNP WNE LEF +S   
Sbjct  13   RRLVVEVIDARNLLPKDGQGSSSPYVVADFDGQRKRTTTRFKELNPVWNEPLEFIVSDPD  72

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++VY+D+  G     +N+FLGRVKL  TQF ++GEEAL+YY LE++++ SWI
Sbjct  73   NMEFEELEVEVYNDRKFGNGGGRKNHFLGRVKLYGTQFSRRGEEALVYYTLEKRSVFSWI  132

Query  503  QGDIGLKIYFVD  538
            +G+IGL+IY+ D
Sbjct  133  RGEIGLRIYYYD  144



>ref|XP_002309131.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE92654.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1023

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/768 (55%), Positives = 536/768 (70%), Gaps = 47/768 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPAR-----KTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR L     P +K+  S   V S+PA          FEW Q FA
Sbjct  271   YDLVEPMQYLFIRIVKARGLSQNESPFIKLRTSTHFVRSKPASYRPGDSPGSFEWHQVFA  330

Query  1073  FGRD-----APDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
              G +         + I+EISVWD  S +            FLGG+C D+S++P+RDPPDS
Sbjct  331   LGHNNKTDVQSSDAGIIEISVWDSQSEQ------------FLGGVCLDLSDVPVRDPPDS  378

Query  1238  PLAPQWYRLEGGGAH-------KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQ  1396
             PLAPQWYRLE G A         GD+ L+ W+GTQAD++FP+AW +D      +RSKVYQ
Sbjct  379   PLAPQWYRLESGAAADQNSCRVSGDIQLSVWIGTQADDAFPEAWSSDAPYVAHTRSKVYQ  438

Query  1397  SPKLWYLRSSVIEAQD--IFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             SPKLWYLR +VIEAQD  I +   P      ++KAQLGFQ  KT+  S +  S S  W E
Sbjct  439   SPKLWYLRVTVIEAQDLRIASNLPPLTAPEIRVKAQLGFQSAKTRRGSMSNHSTSFQWIE  498

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVA EP  E   L  L+E    KE  +LG   IP+SSIE+R+D+R V S+WF  E  
Sbjct  499   DLIFVAGEPLEES--LILLVEDRTNKEALLLGHIIIPVSSIEQRIDERHVASKWFALEGG  556

Query  1745  NEEKRV--------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
              +            Y+GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELG
Sbjct  557   GDTGGGGGGVNGGSYRGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGVLELG  616

Query  1901  IIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTV  2077
             I+G + LLPMKT  G KGSTDAY VAK+G KWVRTRTI+D+  PRWNEQYTW+VYDP TV
Sbjct  617   ILGARGLLPMKTKGGGKGSTDAYCVAKFGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTV  676

Query  2078  VTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             +TIGVFD+W +     ++  D R+GK+RIR+STL + KVY N + L++L   GLKKMGEI
Sbjct  677   LTIGVFDNWHMFGDMSDDKPDCRIGKIRIRVSTLESNKVYTNAYPLLVLLRTGLKKMGEI  736

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             ELAVRF   +   D    Y QP+LP MH++RPLG  QQE+LR AA ++++  L+RSEPPL
Sbjct  737   ELAVRFACPSLLPDTCAAYGQPLLPKMHYLRPLGVAQQEALRGAATRMVSLWLARSEPPL  796

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
               EVV YMLDADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   T+LVHAL
Sbjct  797   GPEVVRYMLDADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTVLVHAL  856

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
              ++LVW+PDL++PT   YV +IG W YRFR +      D ++S AE++D DELDEEFD +
Sbjct  857   YLVLVWYPDLVVPTGFLYVILIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTI  915

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P  +P +++RARYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C  + 
Sbjct  916   PSMKPPEIIRARYDRLRVLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLAIT  975

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              ILY+VP KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  976   LILYVVPPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1023


 Score =   152 bits (383),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RK++VEV++AR+LLPKDG G+SS YV+ DF GQRK+T T  RDLNP W E  EF +S 
Sbjct  7    TVRKVLVEVVDARDLLPKDGQGSSSAYVIADFDGQRKRTTTKYRDLNPVWKETFEFTVSD  66

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             S++  + LE++V++DK    G   +N+FLGRVK+  +QF K+G+E ++Y+PLE+K++ S
Sbjct  67   PSNMEFEELEIEVFNDKKFCNGSGRKNHFLGRVKVYGSQFSKRGDEGIVYFPLEKKSVFS  126

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+I + D
Sbjct  127  WIRGEIGLRICYYD  140



>ref|XP_002323568.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF05329.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1053

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/769 (55%), Positives = 539/769 (70%), Gaps = 48/769 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF-----EWDQTFA  1072
             +DLVE M YLF+ IVKAR L     P+VK+  S   V S+PA           EW Q FA
Sbjct  300   YDLVEPMQYLFISIVKARGLSQNESPIVKLRTSTHCVRSKPASYRPGASPDSPEWHQVFA  359

Query  1073  FGRDA------PDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPD  1234
              G +       P+++  +EISVWD  S +            FLGG+CFD+SE+P+RDPPD
Sbjct  360   LGHNNKTDGQLPNAAGNIEISVWDARSEQ------------FLGGVCFDISEVPVRDPPD  407

Query  1235  SPLAPQWYRLEGGGAH-------KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVY  1393
             SPLAPQWYRLE   A         GD+ L+ W+GTQAD++F +AW +D      +RSKVY
Sbjct  408   SPLAPQWYRLESDAAAGQICNRVSGDIQLSVWIGTQADDAFAEAWSSDAPYVSHTRSKVY  467

Query  1394  QSPKLWYLRSSVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPASSATGSPS--WN  1561
             QSPKLWYLR +VIEAQD+   +   P      +IKAQLGFQ  +T+  S +  S S  W 
Sbjct  468   QSPKLWYLRVTVIEAQDLHLSSNLPPLTVPDIRIKAQLGFQSARTRRGSMSNHSTSFRWI  527

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             +DL+FVA EP  E   L  L+E    KE  +LG   IP+SSIE+R D+R V S+WF  E 
Sbjct  528   DDLIFVAGEPLEES--LILLVEDRTTKEAVLLGHIIIPVSSIEQRYDERHVASKWFALEG  585

Query  1742  QNEEKRV--------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVEL  1897
                +           Y+GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +EL
Sbjct  586   GGGDTGGAGCATGGSYRGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGVLEL  645

Query  1898  GIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPST  2074
             GI+G + LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D+  PRWNE+YTW+VYDPST
Sbjct  646   GILGARGLLPMKTKGGGKGSTDAYCVAKYGKKWVRTRTITDSFEPRWNEKYTWQVYDPST  705

Query  2075  VVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGE  2248
             V+TIGVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L   GLKKMGE
Sbjct  706   VLTIGVFDNWHMFGEMSDDKPDCRIGKIRIRVSTLESNKVYMNSYPLLVLLRTGLKKMGE  765

Query  2249  IELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPP  2428
             IELAVRF   +   D   VY QP+LP MH++RPLG  QQE+LR AA K+++  L+RSEPP
Sbjct  766   IELAVRFACPSLLPDTCAVYGQPLLPKMHYLRPLGVAQQEALRGAATKMVSLWLARSEPP  825

Query  2429  LRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHA  2608
             L  EVV YMLDADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   T+LVH 
Sbjct  826   LGPEVVRYMLDADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTVLVHI  885

Query  2609  LLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDA  2788
             L ++LVW+P+L++PT   YVF+IG W YRFR +      D ++S AE++D DELDEEFD 
Sbjct  886   LYLVLVWYPELVVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQAETVDSDELDEEFDT  944

Query  2789  VPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVV  2968
             VP  RP +++RARYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FIA+C  +
Sbjct  945   VPSMRPPEIIRARYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIAVCLAI  1004

Query  2969  AFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               ILY+VP KM+A+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1005  TLILYVVPPKMVAVALGFYFLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1053


 Score =   137 bits (346),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEV++AR+LLPKDG G+SS  V+ DF GQRK+T T  RDLNP W E LEF +S  +
Sbjct  9    RKLLVEVVDARDLLPKDGQGSSSACVIADFDGQRKRTTTKYRDLNPVWKETLEFIVSDPN  68

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++V +DK  G  +  +N+FLGRVK+  +QF K+GEE ++Y+PLE+K++ S I
Sbjct  69   NMEFEELEVEVLNDKKFGNGSGRKNHFLGRVKVYGSQFSKRGEEGIVYFPLEKKSVFSCI  128

Query  503  QGDIGLKIYFVD  538
            +G+IGL+I F D
Sbjct  129  RGEIGLRICFYD  140



>ref|XP_006300670.1| hypothetical protein CARUB_v10019701mg [Capsella rubella]
 gb|EOA33568.1| hypothetical protein CARUB_v10019701mg [Capsella rubella]
Length=1077

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/767 (54%), Positives = 543/767 (71%), Gaps = 50/767 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  330   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESVDSPEWNQVFA  389

Query  1073  FGRDAPDSS---SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS+   + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  390   LGHNRSDSAVTGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  437

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  438   APQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  497

Query  1406  LWYLRSSVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  498   LWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHWH  553

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W T E 
Sbjct  554   EDMIFVAGEPLED--CLVLMVEDRTTKEATMLGHAMIPVSSIEQRIDERFVPSKWHTLEV  611

Query  1742  QNEEKRV------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
             +            Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI
Sbjct  612   EGGGGGGGPGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGILELGI  671

Query  1904  IGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+
Sbjct  672   LGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVL  731

Query  2081  TIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEIE
Sbjct  732   TVGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEIE  791

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL 
Sbjct  792   VAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLG  851

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
              EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L 
Sbjct  852   PEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILY  911

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P
Sbjct  912   LVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIP  970

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FIA+C V+  
Sbjct  971   SSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAICLVITI  1030

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +LY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1031  VLYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1077


 Score =   164 bits (414),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +R+L+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F++S  
Sbjct  18   QRRLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPVWNEMLDFSVSDP  77

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  78   KNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  137

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  138  IRGEIGLKIYYYD  150



>ref|XP_010471563.1| PREDICTED: uncharacterized protein LOC104751340 [Camelina sativa]
Length=1074

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/767 (54%), Positives = 543/767 (71%), Gaps = 50/767 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  327   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESADSPEWNQVFA  386

Query  1073  FGRDAPDSS----SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSP  1240
              G +  DS+    + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSP
Sbjct  387   LGHNRSDSAVTGGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSP  434

Query  1241  LAPQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSP  1402
             LAPQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSP
Sbjct  435   LAPQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSP  494

Query  1403  KLWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSW  1558
             KLWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W
Sbjct  495   KLWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHW  550

Query  1559  NEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE  1738
             +ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W T E
Sbjct  551   HEDMIFVAGEPLED--CLVLMVEDRTSKEATLLGHAMIPVSSIEQRIDERFVPSKWHTLE  608

Query  1739  DQNEEKRV-----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
              +           Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI
Sbjct  609   VEGGGGGGPGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGILELGI  668

Query  1904  IGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+
Sbjct  669   LGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVL  728

Query  2081  TIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEIE
Sbjct  729   TVGVFDNWRMFSDASDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEIE  788

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL 
Sbjct  789   VAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLG  848

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
              EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L 
Sbjct  849   PEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILY  908

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P
Sbjct  909   LVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIP  967

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FIA+C V+  
Sbjct  968   SSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAICLVITI  1027

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +LY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1028  VLYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1074


 Score =   158 bits (400),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F +S  
Sbjct  16   QRKLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPVWNEMLDFAVSDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  76   KNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKI  526
            I+G+IGLKI
Sbjct  136  IRGEIGLKI  144



>ref|XP_006390396.1| hypothetical protein EUTSA_v10018050mg [Eutrema salsugineum]
 gb|ESQ27682.1| hypothetical protein EUTSA_v10018050mg [Eutrema salsugineum]
Length=1055

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/765 (54%), Positives = 543/765 (71%), Gaps = 48/765 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP   T   EW+Q FA
Sbjct  310   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESTDSPEWNQVFA  369

Query  1073  FGRDAPDSSS---ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS++    LEIS WD             +   FLGG+CFD+SE+P+RDPPDS L
Sbjct  370   LGHNRSDSAASGATLEISAWD------------ASSEGFLGGVCFDLSEVPVRDPPDSTL  417

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  418   APQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  477

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  478   LWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHWH  533

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  VLG A IP+SSIE+R+D+R V S+W + E 
Sbjct  534   EDMIFVAGEPLED--CLMLMVEDRTTKEPTVLGHAMIPVSSIEQRIDERFVPSKWHSLEG  591

Query  1742  QNEEKRV----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
             ++         Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI+G
Sbjct  592   ESGGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGILELGILG  651

Query  1910  CKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
              + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+T+
Sbjct  652   ARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVLTV  711

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEIE+A
Sbjct  712   GVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEIEVA  771

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL  E
Sbjct  772   VRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLGPE  831

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YMLDADSHS+SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L ++
Sbjct  832   VVRYMLDADSHSWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILYLV  891

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P +
Sbjct  892   LVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIPSS  950

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  +++RARYD+LR+L  R+QT+LGD A QGER+QALV+WRDPRAT +FIA+C  +  +L
Sbjct  951   RRPEVIRARYDRLRILAVRIQTILGDFAAQGERIQALVSWRDPRATKLFIAICLAITIVL  1010

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1011  YVVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1055


 Score =   164 bits (416),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T+R+L+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F +S 
Sbjct  15   TQRRLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVSD  74

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ S
Sbjct  75   PKNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFS  134

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGLKIY+ D
Sbjct  135  WIRGEIGLKIYYYD  148



>emb|CDX85853.1| BnaC06g22810D [Brassica napus]
Length=1044

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/765 (54%), Positives = 542/765 (71%), Gaps = 48/765 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP   T   EW+Q FA
Sbjct  299   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGEPTDSPEWNQVFA  358

Query  1073  FGRDAPDSSS---ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS++    LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  359   LGHNRTDSAASGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  406

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  407   APQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  466

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  467   LWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHWH  522

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  VLG A IP+SSIE+R+D+R V S+W   E 
Sbjct  523   EDMIFVAGEPLED--CLMLMVEDRTSKEPMVLGHAMIPVSSIEQRIDERFVPSKWHALEG  580

Query  1742  QNEEKRV----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
             +          Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI+G
Sbjct  581   EGGGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGVLELGILG  640

Query  1910  CKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
              + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+T+
Sbjct  641   ARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVLTV  700

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEIE+A
Sbjct  701   GVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEIEVA  760

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL  E
Sbjct  761   VRFACPSLLPDVCSAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLGPE  820

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YMLDADSHS+SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L ++
Sbjct  821   VVRYMLDADSHSWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILYLV  880

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P +
Sbjct  881   LVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIPSS  939

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FI +C V+  +L
Sbjct  940   RRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFITICLVITIVL  999

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+VP+KM+A+A GFYYLRHP+FRD MP+  L+FFRRLPSL+DR++
Sbjct  1000  YVVPAKMVAVALGFYYLRHPMFRDTMPTATLSFFRRLPSLSDRLI  1044


 Score =   162 bits (411),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARNLLPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F ++  
Sbjct  16   QRKLVVEVVEARNLLPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVNDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++G+E L+Y+PLE+K++ SW
Sbjct  76   QNMDYDELDIEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGDEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>emb|CDX68168.1| BnaA07g22080D [Brassica napus]
Length=1045

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/767 (54%), Positives = 543/767 (71%), Gaps = 50/767 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP   T   EW+Q FA
Sbjct  298   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGEPTDSPEWNQVFA  357

Query  1073  FGRDAPDSSS---ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS++    LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  358   LGHNRTDSAASGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  405

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  406   APQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  465

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  466   LWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHWH  521

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  VLG A IP+SSIE+R+D+R V S+W   E 
Sbjct  522   EDMIFVAGEPLED--CLMLMVEDRTSKEPMVLGHAMIPVSSIEQRIDERFVPSKWHALEG  579

Query  1742  QNEEKRV------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
             +            Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI
Sbjct  580   EGGGGGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGVLELGI  639

Query  1904  IGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+
Sbjct  640   LGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVL  699

Query  2081  TIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGE+E
Sbjct  700   TVGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEVE  759

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL 
Sbjct  760   VAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLG  819

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
              EVV YMLDADSHS+SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L 
Sbjct  820   PEVVRYMLDADSHSWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILY  879

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P
Sbjct  880   LVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIP  938

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FI +C V+  
Sbjct  939   SSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFITICLVITI  998

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +LY+VP+KM+A+A GFYYLRHP+FRD MP+ +L+FFRRLPSL+DR++
Sbjct  999   VLYVVPAKMVAVALGFYYLRHPMFRDTMPTASLSFFRRLPSLSDRLI  1045


 Score =   164 bits (415),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARNLLPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F ++  
Sbjct  16   QRKLVVEVVEARNLLPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVNDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++G+E L+Y+PLE+K++LSW
Sbjct  76   QNMDYDELDIEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGDEGLVYFPLEKKSVLSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>ref|XP_009104747.1| PREDICTED: uncharacterized protein LOC103830687 [Brassica rapa]
Length=1048

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/767 (54%), Positives = 543/767 (71%), Gaps = 50/767 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP   T   EW+Q FA
Sbjct  301   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGEPTDSPEWNQVFA  360

Query  1073  FGRDAPDSSS---ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS++    LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  361   LGHNRTDSAASGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  408

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  409   APQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  468

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  469   LWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHWH  524

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  VLG A IP+SSIE+R+D+R V S+W   E 
Sbjct  525   EDMIFVAGEPLED--CLMLMVEDRTSKEPMVLGHAMIPVSSIEQRIDERFVPSKWHALEG  582

Query  1742  QNEEKRV------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
             +            Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELGI
Sbjct  583   EGGGGGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGVLELGI  642

Query  1904  IGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             +G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV+
Sbjct  643   LGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTVL  702

Query  2081  TIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGE+E
Sbjct  703   TVGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEVE  762

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL 
Sbjct  763   VAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPLG  822

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
              EVV YMLDADSHS+SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L 
Sbjct  823   PEVVRYMLDADSHSWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHILY  882

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +P
Sbjct  883   LVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIP  941

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FI +C V+  
Sbjct  942   SSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFITICLVITI  1001

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +LY+VP+KM+A+A GFYYLRHP+FRD MP+ +L+FFRRLPSL+DR++
Sbjct  1002  VLYVVPAKMVAVALGFYYLRHPMFRDTMPTASLSFFRRLPSLSDRLI  1048


 Score =   163 bits (412),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARNLLPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F ++  
Sbjct  16   QRKLVVEVVEARNLLPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVNDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++G+E L+Y+PLE+K++ SW
Sbjct  76   QNMDYDELDIEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGDEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>ref|XP_010428463.1| PREDICTED: uncharacterized protein LOC104713111 [Camelina sativa]
Length=1076

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/768 (54%), Positives = 543/768 (71%), Gaps = 51/768 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  328   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESADSPEWNQVFA  387

Query  1073  FGRDAPDSS----SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSP  1240
              G +  DS+    + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSP
Sbjct  388   LGHNRSDSAXTGGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSP  435

Query  1241  LAPQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSP  1402
             LAPQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSP
Sbjct  436   LAPQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSP  495

Query  1403  KLWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSW  1558
             KLWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W
Sbjct  496   KLWYLRVTVLEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSARTRRGSMNNHSGSFHW  551

Query  1559  NEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE  1738
             +ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W + E
Sbjct  552   HEDMIFVAGEPLED--CLVLMVEDRTTKEATLLGHAMIPVSSIEQRIDERFVPSKWHSLE  609

Query  1739  DQNEEKRV------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
              +            Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +ELG
Sbjct  610   VEGGGGGGPGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGILELG  669

Query  1901  IIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTV  2077
             I+G + LLPMK   G KGSTD+Y VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP TV
Sbjct  670   ILGARGLLPMKAKNGGKGSTDSYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCTV  729

Query  2078  VTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             +T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+GLKKMGEI
Sbjct  730   LTVGVFDNWRMFSDASDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGLKKMGEI  789

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             E+AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPPL
Sbjct  790   EVAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPPL  849

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
               EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH L
Sbjct  850   GPEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHIL  909

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
              ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD +
Sbjct  910   YLVLVWYPDLVVPTGFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTI  968

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FIA+C V+ 
Sbjct  969   PSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAICLVIT  1028

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +LY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1029  IVLYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1076


 Score =   165 bits (417),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F++S  
Sbjct  17   QRKLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPVWNEMLDFSVSDP  76

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  77   KNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  136

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  137  IRGEIGLKIYYYD  149



>ref|NP_177610.1| putative transmembrane protein QUIRKY [Arabidopsis thaliana]
 gb|ACL14176.1| quirky [Arabidopsis thaliana]
 gb|AEE35626.1| C2 calcium/lipid-binding plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=1081

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/773 (54%), Positives = 544/773 (70%), Gaps = 56/773 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  328   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESVDSPEWNQVFA  387

Query  1073  FGRDAPDSS---SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS+   + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  388   LGHNRSDSAVTGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  435

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG GA +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  436   APQWYRLEGSGADQNSGRISGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  495

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  496   LWYLRVTVLEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSARTRRGSMNNHSGSFHWH  551

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W T E 
Sbjct  552   EDMIFVAGEPLED--CLVLMVEDRTTKEATLLGHAMIPVSSIEQRIDERFVPSKWHTLEG  609

Query  1742  QNEEKRV------------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVG  1885
             +                  Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G
Sbjct  610   EGGGGGGGGGPGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIG  669

Query  1886  TVELGIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVY  2062
              +ELGI+G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VY
Sbjct  670   ILELGILGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVY  729

Query  2063  DPSTVVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLK  2236
             DP TV+T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+G+K
Sbjct  730   DPCTVLTVGVFDNWRMFSDASDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGMK  789

Query  2237  KMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSR  2416
             KMGEIE+AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R
Sbjct  790   KMGEIEVAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLAR  849

Query  2417  SEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATI  2596
             +EPPL  EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+
Sbjct  850   AEPPLGPEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTV  909

Query  2597  LVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDE  2776
             LVH L ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDE
Sbjct  910   LVHILYLVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDE  968

Query  2777  EFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIAL  2956
             EFD +P +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FIA+
Sbjct  969   EFDTIPSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAI  1028

Query  2957  CFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             C V+  +LY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1029  CLVITIVLYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1081


 Score =   164 bits (415),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F +S  
Sbjct  16   QRKLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVSDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  76   KNMDYDELDIEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>ref|XP_002887555.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63814.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1078

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/775 (54%), Positives = 544/775 (70%), Gaps = 58/775 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  323   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESVDSPEWNQVFA  382

Query  1073  FGRDAPDSS---SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS+   + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  383   LGHNRSDSAVTGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  430

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG GA +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  431   APQWYRLEGSGADQNSGRISGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  490

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  491   LWYLRVTVLEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSARTRRGSMNNHSGSFHWH  546

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W T E 
Sbjct  547   EDMIFVAGEPLED--CLVLMVEDRTTKEATLLGHAMIPVSSIEQRIDERFVPSKWHTLEG  604

Query  1742  QNEEKRV--------------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPP  1879
             +                    Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP
Sbjct  605   EGGGGGGGGGGGGPGSGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPP  664

Query  1880  VGTVELGIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWR  2056
             +G +ELGI+G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+
Sbjct  665   IGILELGILGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQ  724

Query  2057  VYDPSTVVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAG  2230
             VYDP TV+TIGVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+G
Sbjct  725   VYDPCTVLTIGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSG  784

Query  2231  LKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHL  2410
             +KKMGEIE+AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L
Sbjct  785   MKKMGEIEVAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWL  844

Query  2411  SRSEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTA  2590
             +R+EPPL  EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  
Sbjct  845   ARAEPPLGPEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVT  904

Query  2591  TILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDEL  2770
             T+LVH L ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DEL
Sbjct  905   TVLVHILYLVLVWYPDLVVPTGFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDEL  963

Query  2771  DEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFI  2950
             DEEFD +P +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FI
Sbjct  964   DEEFDTIPSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFI  1023

Query  2951  ALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             A+C V+  +LY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1024  AICLVITIVLYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1078


 Score =   164 bits (415),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F +S  
Sbjct  16   QRKLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFTVSDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  76   KNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>ref|XP_003524952.1| PREDICTED: uncharacterized protein LOC100783882 [Glycine max]
Length=1025

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/762 (55%), Positives = 546/762 (72%), Gaps = 50/762 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSL-PTAGRPvvkvvvsgsh-----visRPARKTLLFEWDQTF  1069
             FDLVE M YLFV+I KAR L P +  P+V+V +S           RP+      EW+QTF
Sbjct  288   FDLVEPMQYLFVKIWKARGLAPPSEGPIVRVRMSSQSRRSNPASYRPSEPPDSPEWNQTF  347

Query  1070  AFGRDAPD--SSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             A   +  +  +S+ LEISVWD        PT      NFLGG+CFD+S++P+RDPPDSPL
Sbjct  348   ALSYNNTNDANSATLEISVWD-------SPT-----ENFLGGVCFDLSDVPVRDPPDSPL  395

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEGG A +      GD+ L+ W+GTQ+D++FP+AW +D      +RSKVYQSPK
Sbjct  396   APQWYRLEGGTADQNPGRVSGDIQLSVWIGTQSDDAFPEAWISDAPYVAHTRSKVYQSPK  455

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WN  1561
             LWYLR +V+EAQD+        LTAP      ++K +LGFQ Q+T+  S    S S  WN
Sbjct  456   LWYLRVTVVEAQDLNIAPNLPPLTAPE----VRVKVELGFQSQRTRRGSMNHRSLSFHWN  511

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             EDL+FVA EP  +  ++  L+E    KE A+LG   IPLSSIE+R+D+R V ++WFT E 
Sbjct  512   EDLLFVAGEPLEDSVIV--LLEDRTTKEPALLGHIVIPLSSIEQRIDERHVAAKWFTLEG  569

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
                    Y GRV +RLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + L
Sbjct  570   GP-----YCGRVQMRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGL  624

Query  1922  LPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             LPMK+  G KGSTDAY VAKYG KWVRTRT++D   PRWNEQYTW+VYDP TV+T+GVFD
Sbjct  625   LPMKSKGGGKGSTDAYCVAKYGKKWVRTRTVTDTFDPRWNEQYTWQVYDPCTVLTVGVFD  684

Query  2099  SWEV---IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             +W +   +  ++  D R+GKVRIR+STL + ++Y N++ L++L+  GLKKMGEIELAVRF
Sbjct  685   NWRMFADVSEDHRPDCRIGKVRIRVSTLESNRIYTNSYPLLVLTRTGLKKMGEIELAVRF  744

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
                +   D   VY+QP+LP MH++RPLG  QQE+LR A+ K++   L+RSEPPL  EVV 
Sbjct  745   ACPSLLPDTCAVYAQPLLPRMHYLRPLGVAQQEALRGASTKMVAQWLARSEPPLGHEVVR  804

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH +SMRK +ANWFRI+ V+A  + + KW DD R W+NP  T+L+H L ++LVW
Sbjct  805   YMLDADSHVWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWKNPVTTVLLHILYLVLVW  864

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +PDLI+PT   YV +IG W YRFR +      DT++S AE++D DELDEEFD +P ++P 
Sbjct  865   YPDLIVPTAFLYVVLIGIWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEFDTMPSSKPP  923

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             D++R RYD+LRML ARVQT+LGD ATQGER+QALV+WRDPRAT +FI +C  +   LY +
Sbjct  924   DVIRMRYDRLRMLAARVQTVLGDFATQGERLQALVSWRDPRATKLFIGVCLTITVALYAM  983

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P KM+A+A GFYYLRHP+FR+ MPS  LNFFRRLPSL+DR++
Sbjct  984   PPKMVAVALGFYYLRHPMFRNPMPSATLNFFRRLPSLSDRLM  1025


 Score =   163 bits (412),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R+L+VEV++ARNLLPKDG G+SSPYVV DF GQRK+T T  ++LNP WNE LEF +S 
Sbjct  12   TVRRLVVEVVDARNLLPKDGQGSSSPYVVADFDGQRKRTTTRFKELNPVWNEPLEFIVSD  71

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK  G  +  +N+FLGRVKL  TQF ++GEEAL+YY LE++++ S
Sbjct  72   PENMEFEELEVEVYNDKKFGNGSGRKNHFLGRVKLYGTQFSRRGEEALVYYTLEKRSVFS  131

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  132  WIRGEIGLRIYYYD  145



>ref|XP_010086578.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB20733.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=1051

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/771 (55%), Positives = 542/771 (70%), Gaps = 54/771 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKARSL  +  P VK+  S   V S+PA           EW Q FA
Sbjct  300   YDLVEPMQYLFIRIVKARSLAPSESPYVKLRTSNHFVKSKPAIHRPGEPPDSLEWYQVFA  359

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
              G + P+S S+ LEISVWD            +    FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  360   LGHNRPESNSATLEISVWD------------LPTEQFLGGVCFDLSDVPVRDPPDSPLAP  407

Query  1250  QWYRLEGG------GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             QWYRLEGG      G   G++ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLW
Sbjct  408   QWYRLEGGEGGQNSGRISGEIQLSIWIGTQADDAFPEAWSSDAPFVSHTRSKVYQSPKLW  467

Query  1412  YLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S    S S  WNED
Sbjct  468   YLRVTVMEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSLRTRRGSMKNHSASFHWNED  523

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             ++FVA EP  +   L  L+E    K+  +LG   +P+SSIE+R D+R V S+WF  E   
Sbjct  524   IIFVAGEPLEDS--LIILVEDRTTKDAMLLGHILVPVSSIEQRFDERYVASKWFALEGGG  581

Query  1748  EEKR-----------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVE  1894
                             Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +E
Sbjct  582   GGGEGGCGGPPCSGGAYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILE  641

Query  1895  LGIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPS  2071
             LGI+G + LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP 
Sbjct  642   LGILGARGLLPMKTKSGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPC  701

Query  2072  TVVTIGVFDSWEVI-DPENSK--DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
             TV+T+GVFD+W +  D  + +  D R+GK+RIR+STL + KVY N++ L++L   GLKKM
Sbjct  702   TVLTVGVFDNWRMFADASDGEKPDYRIGKMRIRVSTLESNKVYTNSYPLLVLHRTGLKKM  761

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             GEIE+AVRF   +   +    Y QP+LP MH++RPLG  QQE+LR AA +++   L RSE
Sbjct  762   GEIEVAVRFACPSLLPETCAAYGQPLLPKMHYLRPLGVAQQEALRGAATRMVAAWLGRSE  821

Query  2423  PPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILV  2602
             PPL  EVV YMLDADSH++SMRK +ANWFRI+ V+A ++ + KW D  R WRNP  T+LV
Sbjct  822   PPLGPEVVRYMLDADSHTWSMRKSKANWFRIVAVLAWLVGLAKWLDGIRRWRNPITTVLV  881

Query  2603  HALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEF  2782
             H L ++LVW+PDLI+PT   YVF+IG W YRFR +      DT++S AE++D DELDEEF
Sbjct  882   HILYLVLVWYPDLIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRLSQAEAVDPDELDEEF  940

Query  2783  DAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCF  2962
             D +P ++P D++R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C 
Sbjct  941   DTIPSSKPPDIIRVRYDRLRILAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCL  1000

Query  2963  VVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +  ILY+VP KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1001  AITIILYVVPPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1051


 Score =   159 bits (401),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKLIVEVIEA++LLPKDG G++S YVV DF GQR++T T  RDLNP WNE L+F +S 
Sbjct  18   TIRKLIVEVIEAKDLLPKDGQGSASAYVVADFDGQRRRTCTKFRDLNPVWNEALDFLVSD  77

Query  323  HSDIFGDMLELDVYHDKN----VGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
              ++  + LE++VY+DK      G   +N+FLGRVKL  TQF ++G E L+Y+PLE+K++
Sbjct  78   PDNMDFEELEIEVYNDKRYCNATGTAKKNHFLGRVKLYGTQFARRGNEGLVYFPLEKKSV  137

Query  491  LSWIQGDIGLKIYFVD  538
             SWI+G+IGL+IY+ D
Sbjct  138  FSWIRGEIGLRIYYFD  153



>gb|KDP31210.1| hypothetical protein JCGZ_11586 [Jatropha curcas]
Length=1027

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/763 (56%), Positives = 540/763 (71%), Gaps = 47/763 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR L     P VK+  S   V S+PA       T   EW Q FA
Sbjct  285   YDLVEPMQYLFIRIVKARGLSQNESPYVKIRTSNHFVKSKPAIYRPGEPTDSPEWHQVFA  344

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
              G + PDS SS LEISVWD             +   FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  345   LGHNRPDSASSTLEISVWD-------------SPEQFLGGVCFDLSDVPVRDPPDSPLAP  391

Query  1250  QWYRLEGG-----GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             QWYRLE       G   GD+ L+ W+GTQ D++FP+AW +D      +RSKVYQSPKLWY
Sbjct  392   QWYRLESSPDQHSGRVSGDIQLSVWIGTQNDDAFPEAWSSDAPYVAHTRSKVYQSPKLWY  451

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDL  1570
             LR +V+EAQD+        LTAP      ++KA LGFQ  +T+  S +  S S  W+EDL
Sbjct  452   LRVTVLEAQDLHIASNLPPLTAPE----IRVKAHLGFQSVRTRRGSMSNHSASFQWHEDL  507

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED---  1741
             +FVA EP  +   L  +IE    KE   LG   IP+SSIE+R+D+R V S+WF  E    
Sbjct  508   IFVAGEPLED--FLILVIEDRTSKEAISLGHILIPVSSIEQRIDERHVASKWFALEGGAT  565

Query  1742  --QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
                N     Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELGI+G +
Sbjct  566   AGANCVGGCYHGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILELGILGAR  625

Query  1916  NLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
              LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGV
Sbjct  626   GLLPMKNRGGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGV  685

Query  2093  FDSWEVI-DPENSK-DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             FD+W +  DP   K D R+GKVRIR+STL + KVY N++ L++L   GLKKMGEIE+AVR
Sbjct  686   FDNWRMFADPSEEKGDNRIGKVRIRVSTLESNKVYTNSYPLLVLLRTGLKKMGEIEVAVR  745

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F   +   D   VY QP+LP MH++RPLG  QQE+LR AA K++ + L+RSEPPL  EVV
Sbjct  746   FACPSLLPDTCAVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVASWLARSEPPLGPEVV  805

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLDADSH++SMRK +ANWFRI+ V+A  + + KW  + R W+NP  T+LVH L ++LV
Sbjct  806   QYMLDADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLHNIRRWKNPVTTVLVHLLYLVLV  865

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
             W+PDLI+PT   YVF+IG W YRFR +      D ++S +ES+D DELDEEFD +P ++P
Sbjct  866   WYPDLIVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQSESVDPDELDEEFDTIPSSKP  924

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D++RARYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FIA+C  +  ILY 
Sbjct  925   PDIIRARYDRLRILAARVQTVLGDFATQGERVQALVSWRDPRATKLFIAVCLTITIILYA  984

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             VP KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  985   VPPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1027


 Score =   162 bits (409),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 105/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+V V+ AR+LLPKDG G+SSPYV++DF GQ+K+T T  R+LNP+WNE+LEF +S   
Sbjct  13   RKLLVHVVNARDLLPKDGQGSSSPYVIVDFDGQKKRTSTRYRELNPEWNEILEFTVSDPD  72

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++V++DK  G  +  +N+FLGRVKL  +QF K+GEE LIY+PLE+K++ SWI
Sbjct  73   NMEFEELEIEVFNDKKYGNGSGRKNHFLGRVKLYGSQFAKRGEEGLIYFPLEKKSVFSWI  132

Query  503  QGDIGLKIYFVD  538
            +G+IGLKI + D
Sbjct  133  RGEIGLKICYYD  144



>ref|XP_011019135.1| PREDICTED: uncharacterized protein LOC105121952 [Populus euphratica]
Length=1060

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/772 (55%), Positives = 535/772 (69%), Gaps = 55/772 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPAR-----KTLLFEWDQTFA  1072
             +DLVE M YL+ +IVKAR L     P +K+  S   V S+PA          FEW Q FA
Sbjct  308   YDLVEPMQYLYTRIVKARGLSQNVSPFIKLRTSTHFVRSKPASYRPGDSPGSFEWHQVFA  367

Query  1073  FGRD-----APDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             FG           + ILEISVWD  S +            FLGG+C D+S++P+RDPPDS
Sbjct  368   FGHSNKTDVQSSDAGILEISVWDSQSEQ------------FLGGVCLDLSDVPVRDPPDS  415

Query  1238  PLAPQWYRLEGGGAH-------KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQ  1396
             PLAPQWYRLE G A         GD+ L+ W+GTQAD++FP+A  +D      +RSKVYQ
Sbjct  416   PLAPQWYRLESGAAADQNSCRVSGDIQLSVWIGTQADDAFPEAGSSDAPYVAHTRSKVYQ  475

Query  1397  SPKLWYLRSSVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS-  1555
             SPKLWYLR +VIEAQD+        LTAP      ++KAQLGFQ  KT+  S +  S S 
Sbjct  476   SPKLWYLRVTVIEAQDLPMASNLPPLTAPE----VRVKAQLGFQSAKTRRGSMSNHSTSF  531

Query  1556  -WNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFT  1732
              W EDL+FVA EP  E   L  L+E    KE  +LG   IP+SSIE+R+D+R V S+WF 
Sbjct  532   QWIEDLIFVAGEPLEES--LILLVEDRTNKEALLLGHIIIPVSSIEQRIDERHVASKWFA  589

Query  1733  FEDQNEEKRV--------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGT  1888
              E   +            Y+GR+HLRLC +GGYHV++EAAH+CSD+RP A+QLWKP +G 
Sbjct  590   LEGGGDTGGGGVGAHGGSYRGRIHLRLCLEGGYHVLDEAAHVCSDFRPPAKQLWKPAIGI  649

Query  1889  VELGIIGCKNLLPMKT-MRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYD  2065
             +ELGI+G + LLPMKT   GKGSTDAY VAK+G KWVRTRTI D+  PRWNEQYTW+VYD
Sbjct  650   LELGILGARGLLPMKTKCGGKGSTDAYCVAKFGKKWVRTRTIPDSFDPRWNEQYTWQVYD  709

Query  2066  PSTVVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKK  2239
             P TV+TIGVFD+W +     ++  D R+GK+RIR+S L + KVY N++ L++L   GLKK
Sbjct  710   PCTVLTIGVFDNWHMFGDMSDDKPDCRIGKIRIRVSMLQSNKVYANSYPLLVLLRTGLKK  769

Query  2240  MGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRS  2419
             MGEIELAVRF   +   D    Y QP+LP MH++RPLG  QQE+LR AA ++++  L+RS
Sbjct  770   MGEIELAVRFACPSLLPDTCAAYGQPLLPKMHYLRPLGVAQQEALRGAATRMVSLWLARS  829

Query  2420  EPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATIL  2599
             EPPL  EVV YMLDADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   T+L
Sbjct  830   EPPLGPEVVRYMLDADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTVL  889

Query  2600  VHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEE  2779
             VHAL ++LVW+PDL++PT   YV +IG W YRFR +      D ++S AE++D DELDEE
Sbjct  890   VHALYLVLVWYPDLVVPTGFLYVILIGVWYYRFRPKIPAG-MDIRLSQAETVDLDELDEE  948

Query  2780  FDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALC  2959
             FD +P  +P +++RARYD+LR+L ARVQT+LGDLATQGERVQALV+WRDPRAT +FI +C
Sbjct  949   FDTIPSMKPPEIIRARYDRLRVLAARVQTVLGDLATQGERVQALVSWRDPRATKLFIGVC  1008

Query  2960  FVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               +  ILY+VP KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1009  LAITLILYVVPPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1060


 Score =   149 bits (377),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RK+ VEV++AR+LLPKDG G++S YV+ DF GQRK+T T  RDLNP W E  EF +S 
Sbjct  7    TVRKVQVEVVDARDLLPKDGQGSTSAYVIADFDGQRKRTNTKYRDLNPVWKETFEFTVSD  66

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             S++  + LE++V++DK    G   +N+FLGRVK+  +QF K+G+E ++Y+PLE+K++ S
Sbjct  67   PSNMELEELEIEVFNDKKFCNGSGRKNHFLGRVKVYGSQFSKRGDEGIVYFPLEKKSVFS  126

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+I + D
Sbjct  127  WIRGEIGLRICYYD  140



>ref|XP_008652057.1| PREDICTED: uncharacterized protein LOC103631978 [Zea mays]
 tpg|DAA59661.1| TPA: hypothetical protein ZEAMMB73_562179 [Zea mays]
Length=1070

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/777 (54%), Positives = 540/777 (69%), Gaps = 44/777 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             M +S  DLV++M YLFV++V+AR LP    P V+V   G H  +R AR+   FEWDQTFA
Sbjct  302   MVQSKHDLVDRMPYLFVRVVRARGLPAGAHPHVRVAAGGHHASTREARRGAFFEWDQTFA  361

Query  1073  FGRD-APDSSS-ILEISVWDPLSSKSLDPTSDVA---GHNFLGGICFDVSEIPLRDPPDS  1237
             F RD A DS    LE+SVWD      L P +DV+     +FLGG+CFD +++  RDPPD 
Sbjct  362   FVRDPATDSPGPTLEVSVWD------LPPDADVSIADDRHFLGGLCFDTADVHARDPPDG  415

Query  1238  PLAPQWYRLEGGGAHKG-DLMLATWVGTQADESFPDAWKTDT--------AGNPTSRSKV  1390
             PLA QWYRLEGG    G DLM+ATW GTQADE+F DAWK D+        A   TSR+KV
Sbjct  416   PLATQWYRLEGGRRLGGADLMVATWAGTQADEAFADAWKADSPAATTATAAAAATSRAKV  475

Query  1391  YQSPKLWYLRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSA-TGSPSWNE  1564
             Y SPKLW LR +VIEAQD   LTAP  +++   ++A LG Q  KT+    A  G P+WNE
Sbjct  476   YVSPKLWLLRLTVIEAQDT--LTAPPPRDAGIAVRATLGSQALKTRTTPVARNGGPAWNE  533

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DL+FVAAEPFT+   L   +E    KE   +G ASI L+++ERRVDDR+V S+W      
Sbjct  534   DLLFVAAEPFTDDDCLVISLEVRHGKEAFPVGSASISLATVERRVDDRKVASKWLDLLPS  593

Query  1745  NEE-----KR----VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVEL  1897
             +E      KR    ++ GR+H+R+C DGGY+V +E ++ CSD+RP+ARQLW PP+G VEL
Sbjct  594   DEAAMRVGKRAAMHMHGGRLHVRVCLDGGYNVADEPSYACSDFRPSARQLWSPPLGVVEL  653

Query  1898  GIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTV  2077
             GIIGCK LLPM+   GKG TDAYAVAKYG KW RTRTI+D+  P WNEQYTW VYDP TV
Sbjct  654   GIIGCKGLLPMRAADGKGCTDAYAVAKYGPKWARTRTIADSYDPAWNEQYTWPVYDPCTV  713

Query  2078  VTIGVFDSWEVIDPE--NSKDVR-------MGKVRIRISTLATGKVYRNTFSLILLSPAG  2230
             +T+GVFD    + P     KD         MGKVRIR+STL  G+ YR  + LI++ P G
Sbjct  714   LTVGVFDDPLPLQPSEGGGKDAAAVACSRPMGKVRIRLSTLERGRAYRGLYPLIMMLPTG  773

Query  2231  LKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHL  2410
              K+MG++ELA+RF  S   LD LH Y +P+LP MHH RP+  V +E+LR AAV++   HL
Sbjct  774   AKRMGDVELAIRFSTSGSMLDVLHAYGRPLLPAMHHQRPIPLVNREALRLAAVRISAAHL  833

Query  2411  SRS-EPPLRREVVAYMLDA-DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNP  2584
             +RS EPPLRREV  +MLDA +   FSMRK RANW R +  ++ V D  +W +DTR+WRNP
Sbjct  834   ARSAEPPLRREVSTWMLDAAEPRGFSMRKFRANWNRAVAALSWVTDAARWVEDTRSWRNP  893

Query  2585  TATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRD  2764
             TAT + HA+LVLL W PDL++PT   +   +G W YR R R    H   + S+AE+ DR+
Sbjct  894   TATAMAHAVLVLLAWHPDLVVPTLTLHAAAVGVWKYRRRPRAPAAHPCVRASMAEAPDRE  953

Query  2765  ELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGI  2944
             ELDEEFD +P  RP D+VRARYD+ RM+G R+Q  +GD+ATQ ER+QALV+WRDPRATG+
Sbjct  954   ELDEEFDTIPSARPPDVVRARYDRARMVGVRLQQTVGDVATQAERLQALVSWRDPRATGL  1013

Query  2945  FIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             F+ALC +VA +LY+VP KM+A+  GFYYLRHP+FR+RMP+P +NFFRRLPS+++R++
Sbjct  1014  FVALCVLVAMVLYMVPMKMVAVVAGFYYLRHPMFRNRMPAPVINFFRRLPSMSERIM  1070


 Score =   181 bits (459),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 5/138 (4%)
 Frame = +2

Query  140  GTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL-  316
             T RKLIVEV+EARNL+PKDG G SSPY   DF GQR+KTRTV RDLNP WNE LEF+  
Sbjct  3    ATARKLIVEVVEARNLVPKDGTGTSSPYARADFDGQRRKTRTVARDLNPAWNEALEFDFP  62

Query  317  -SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
             +    + G+ LE+ V HD  +GPT RNNFLGRV+L+A QFV+KGEEALIY+PLE+   L
Sbjct  63   PAGVDPVAGEPLEVTVLHDLRIGPTRRNNFLGRVRLDARQFVRKGEEALIYFPLEKNKGL  122

Query  494  ---SWIQGDIGLKIYFVD  538
               +W++GDIGLK+Y+VD
Sbjct  123  FNFNWVRGDIGLKVYYVD  140



>ref|XP_009417087.1| PREDICTED: uncharacterized protein LOC103997556 [Musa acuminata 
subsp. malaccensis]
Length=1032

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/759 (58%), Positives = 564/759 (74%), Gaps = 27/759 (4%)
 Frame = +2

Query  890   AMERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             AMERS +DLV+KM YLFV++V+AR LP   +P V+V   G HV +R AR+++ FEW+QTF
Sbjct  284   AMERSKYDLVDKMQYLFVRVVRARKLPGNAKPHVRVAAYGRHVSTRTARRSVFFEWNQTF  343

Query  1070  AFGRDAPDSSSI---LEISVWDPLSSKSLDPTSDVAGH---NFLGGICFDVSEIPLRDPP  1231
             AF RDA  +++    LEISVWD      L P SD+      +FLGG+ FDV+E+PLRDPP
Sbjct  344   AFVRDASAAAADPSALEISVWD------LPPFSDLNDEEEEHFLGGVRFDVAEVPLRDPP  397

Query  1232  DSPLAPQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDT-AGNPTSRSKVYQSPKL  1408
             DSPLAPQWYRLEGG    GDLMLA+WVGTQAD+SFP AWK D    +  S SKVY SPKL
Sbjct  398   DSPLAPQWYRLEGGRGRGGDLMLASWVGTQADDSFPHAWKADAPTSHAGSHSKVYVSPKL  457

Query  1409  WYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSP-SWNEDLVFVAA  1585
             WY+R++VIEAQD   +T+  KE +  ++A LGFQV KT+ A S  G+P SWNEDL+FV A
Sbjct  458   WYIRATVIEAQDT--VTSSIKEHAVYVRAALGFQVLKTRNAVSRNGAPPSWNEDLLFVEA  515

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR--  1759
             EPF E   L   +E    K+  VLG  SI LS+IERRVDDR+V SRW      +EE +  
Sbjct  516   EPFGEDQKLVISLELRHGKDAIVLGSGSILLSTIERRVDDRKVASRWLDLLPTSEEAQAK  575

Query  1760  -----VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                  V+ GR+H+R+CFDGGYHV +E  H  SDYRP+ARQLW+ PVG VE+GIIGC+ LL
Sbjct  576   KGRRPVHGGRLHVRVCFDGGYHVSDEPQHAESDYRPSARQLWRSPVGVVEVGIIGCRGLL  635

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             P++T+ GKG+TDAYAVAKYG KW RTRT +++  P WNEQYTW VYDP TV+T+ VFD  
Sbjct  636   PVRTVDGKGTTDAYAVAKYGPKWARTRTAANSFDPAWNEQYTWPVYDPCTVLTVAVFDQS  695

Query  2105  EVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTP  2284
             +  D +++    MGKVRIR+STL T ++YR ++ L++L P+G+K+MGEIELAVRF R+  
Sbjct  696   D--DGKDATSRPMGKVRIRLSTLETNRIYRGSYPLVMLLPSGVKRMGEIELAVRFSRAGS  753

Query  2285  TLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD-  2461
              LD LHVY QPMLP MHH+RP+ A Q+E LR AA +++  HL RSEP L+REV  ++LD 
Sbjct  754   ALDLLHVYGQPMLPAMHHLRPIPAAQREPLRLAAARIVAAHLGRSEPSLQREVALWVLDP  813

Query  2462  -ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
              A+   +SMR+VRANW+RI+  ++ V DV +W +DTRAWRN T T+LVH +LVLLVWFP+
Sbjct  814   AAEPRGYSMRRVRANWYRIVAALSWVADVARWVEDTRAWRNATTTLLVHGVLVLLVWFPE  873

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             L  PT A +V ++GAW YR R+R  + H   + S AE+++R+ELDEEFD VP  R  ++V
Sbjct  874   LAAPTVAVHVAVVGAWRYRRRARGPVPHPCLRASQAEAVEREELDEEFDPVPSARGPEVV  933

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             RARYD++R + AR Q +LGD+A Q ERVQALVTWRDPRATG+F+ALCF++A  LY+VP++
Sbjct  934   RARYDRMRGVAARFQAMLGDVAAQVERVQALVTWRDPRATGMFVALCFLLAVALYVVPAR  993

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M  +A GFYYLRHP+FRDR+P  A+NF+RRLPSLADR++
Sbjct  994   MAVVAAGFYYLRHPMFRDRLPPAAVNFYRRLPSLADRII  1032


 Score =   177 bits (450),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEV+EA +LLPKDG G SSPYVV+DF GQR+KT+TVLR+L+P WNE LEFN+    
Sbjct  6    RKLVVEVMEAHDLLPKDGMGTSSPYVVVDFDGQRRKTQTVLRNLSPTWNEALEFNVIGPV  65

Query  329  DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            D  G+ +E++VYHD+ VGP+ RNNFLGRV++++ + VKKGEEA+  +P+E+K+  SW++G
Sbjct  66   DDAGEPVEVEVYHDRRVGPSRRNNFLGRVRIDSRKVVKKGEEAVESFPVEKKSFFSWVRG  125

Query  509  DIGLKIYFVD  538
            DI LK+Y+VD
Sbjct  126  DIYLKVYYVD  135



>gb|KFK41908.1| hypothetical protein AALP_AA2G188000 [Arabis alpina]
Length=1057

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/769 (54%), Positives = 542/769 (70%), Gaps = 52/769 (7%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF------EWDQTF  1069
             ++LVE M YLFV+IVKAR L +     VKV  S   V S+PA   +        EW+Q F
Sbjct  308   YNLVEPMQYLFVRIVKARGLASNESAYVKVRTSNHFVRSKPAVNRVGESTESSPEWNQVF  367

Query  1070  AFGRDAPDSSS---ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSP  1240
             A G +  DS++    LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSP
Sbjct  368   ALGHNKADSAASGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSP  415

Query  1241  LAPQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSP  1402
             LAPQWYRLEG  A +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSP
Sbjct  416   LAPQWYRLEGSAADQNSGRVSGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSP  475

Query  1403  KLWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSW  1558
             KLWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W
Sbjct  476   KLWYLRVTVLEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSARTRRGSMNNHSGSFHW  531

Query  1559  NEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE  1738
             +ED+VFVA EP  +   L  ++E    KE  +LG   IP+SSIE+R+D+R + S+W + E
Sbjct  532   HEDMVFVAGEPLED--CLILMVEDRTTKEPTLLGHTMIPVSSIEQRIDERFMPSKWHSLE  589

Query  1739  DQNEEKRV-------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVEL  1897
              +             Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G +EL
Sbjct  590   GEGGGGGGGAGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIGILEL  649

Query  1898  GIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPST  2074
             GI+G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VYDP T
Sbjct  650   GILGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVYDPCT  709

Query  2075  VVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGE  2248
             V+T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+G+KKMGE
Sbjct  710   VLTVGVFDNWRMFSDVSDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGMKKMGE  769

Query  2249  IELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPP  2428
             IE+AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R+EPP
Sbjct  770   IEVAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLARAEPP  829

Query  2429  LRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHA  2608
             L  EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+LVH 
Sbjct  830   LGPEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTVLVHI  889

Query  2609  LLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDA  2788
             L ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDEEFD 
Sbjct  890   LYLVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDT  948

Query  2789  VPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVV  2968
             +P +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+W DPRAT +FIA+C  +
Sbjct  949   IPSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWGDPRATKLFIAICLAI  1008

Query  2969  AFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               ILY VP+KM+A+A GFYYLRHP+FRD MP+ +LNFFRRLPSL+DR++
Sbjct  1009  TIILYAVPAKMVAVALGFYYLRHPMFRDTMPTASLNFFRRLPSLSDRLI  1057


 Score =   167 bits (422),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEVIEARNLLPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F++S 
Sbjct  16   THRKLVVEVIEARNLLPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFSISD  75

Query  323  HSDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE ++Y+PLE+K++ S
Sbjct  76   PKNMDYDELDVEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGIVYFPLEKKSVFS  135

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGLKIY+ D
Sbjct  136  WIRGEIGLKIYYYD  149



>ref|XP_009614187.1| PREDICTED: extended synaptotagmin-1 [Nicotiana tomentosiformis]
Length=1047

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/759 (56%), Positives = 542/759 (71%), Gaps = 42/759 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQT  1066
             S+FDLVE M YLFV+IVKAR L  +  P VK+  S   V S     RP       EW Q 
Sbjct  310   SAFDLVEPMQYLFVRIVKARGLAPSESPFVKIRTSSHFVRSKPGIIRPGEPLSYPEWQQV  369

Query  1067  FAFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             FA G +  +++ S LEISVWD             A  NFLGG+CFD++++P+RDPPDSPL
Sbjct  370   FALGYNKQETANSTLEISVWDS------------ASENFLGGVCFDLTDVPVRDPPDSPL  417

Query  1244  APQWYRLEGGG--AHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             APQWY LEGGG   HK  GD+ L+ W+GTQAD++FP++W +D      +RSKVYQSPKLW
Sbjct  418   APQWYNLEGGGDDQHKVSGDIQLSVWIGTQADDAFPESWSSDAPYVAHTRSKVYQSPKLW  477

Query  1412  YLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR +VIEAQD+        LTAP      +IKAQLGFQ  +T+  S    S +  WNED
Sbjct  478   YLRVTVIEAQDLHIAPNLPPLTAPE----VRIKAQLGFQSVRTRRGSMNHHSSAFHWNED  533

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             L+FVA EP  +   L  L E    K+  +LG   IP+SSIE+RVD+R V  +WF  E   
Sbjct  534   LIFVAGEPLEDS--LILLAEDRTTKDPVLLGHIIIPVSSIEQRVDERLVAGKWFGLE--G  589

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
                  Y GRV+LR+C +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLP
Sbjct  590   GPGGSYCGRVNLRMCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLP  649

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             +K+   GKGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  650   LKSKGPGKGSTDAYCVAKYGKKWVRTRTITDTFDPRWNEQYTWQVYDPCTVLTIGVFDNW  709

Query  2105  EVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     ++  D R+GKVRIR+STL   KVY N++ L++L  +GLKKMGEIE+A+RF+  
Sbjct  710   RMFADAGDDKPDYRIGKVRIRVSTLENNKVYTNSYPLLVLLRSGLKKMGEIEVAIRFVCP  769

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +   +   +Y QP+LP MH++RPLG  QQE+LR AA+K++   L+RSEPPL  EVV YML
Sbjct  770   SLLPETCAIYGQPVLPKMHYLRPLGVAQQEALRGAAIKMVAAWLARSEPPLGPEVVRYML  829

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   TILVH L ++LVW+PD
Sbjct  830   DADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTILVHVLYLVLVWYPD  889

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT+IS +E++D DELDEEFD +P +RP +++
Sbjct  890   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRISQSETVDPDELDEEFDTLPSSRPPEII  948

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C ++  +LY VP K
Sbjct  949   RMRYDRLRILAARVQTVLGDFATQGERVQALVSWRDPRATKLFIIVCLIITIVLYAVPPK  1008

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFY+LRHP+FRD MP   LNFFRRLPSL+DR++
Sbjct  1009  MVAVALGFYFLRHPMFRDPMPPATLNFFRRLPSLSDRLM  1047


 Score =   163 bits (413),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VE+++ARNLLPKDG G+SSPYVV+DF GQ+K+T TV R+LNP+W+E LEF +S   
Sbjct  24   RKLVVEILDARNLLPKDGQGSSSPYVVVDFDGQKKRTSTVCRNLNPEWHEALEFIISDPR  83

Query  329  DIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             +  + L+++V++DK +  G   +N+FLGRVK+  +QF ++GEE LIY+PLE+K++ SWI
Sbjct  84   TMEFEELDIEVFNDKKLSNGNARKNHFLGRVKIYGSQFARRGEEGLIYFPLEKKSVFSWI  143

Query  503  QGDIGLKIYFVD  538
            +G++GLKIY+ D
Sbjct  144  RGELGLKIYYYD  155



>ref|XP_009799877.1| PREDICTED: uncharacterized protein LOC104245873 [Nicotiana sylvestris]
Length=1045

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/759 (56%), Positives = 543/759 (72%), Gaps = 42/759 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQT  1066
             S+FDLVE M YLFV+IVKAR L  +  P VK+  S   V S     RP       EW Q 
Sbjct  308   SAFDLVEPMQYLFVRIVKARGLAPSESPFVKIRTSNHFVRSKPGIIRPGEPLSYPEWQQV  367

Query  1067  FAFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             FA G +  +++ S LEISVWD             A  NFLGG+CFD++++P+RDPPDSPL
Sbjct  368   FALGYNKQETANSTLEISVWDS------------ASDNFLGGVCFDLTDVPVRDPPDSPL  415

Query  1244  APQWYRLEGGG--AHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             APQWY LEGGG   HK  GD+ L+ W+GTQAD++FP++W +D      +RSKVYQSPKLW
Sbjct  416   APQWYHLEGGGDDQHKVSGDIQLSVWIGTQADDAFPESWSSDAPYVAHTRSKVYQSPKLW  475

Query  1412  YLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR +VIEAQD+        LTAP      ++KAQLGFQ  +T+  S    S +  WNED
Sbjct  476   YLRVTVIEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSVRTRRGSMNHHSSAFHWNED  531

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             L+FVA EP  +   L  L+E    K+  +LG   IP+SSIE+R+D+R V  +WF  E   
Sbjct  532   LIFVAGEPLEDS--LILLVEDRTTKDPVLLGHIIIPVSSIEQRLDERLVAGKWFGLE--G  587

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
                  Y GRV+LR+C +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLP
Sbjct  588   GPGGSYCGRVNLRMCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLP  647

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             +K+   GKGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  648   LKSKGPGKGSTDAYCVAKYGKKWVRTRTITDTFDPRWNEQYTWQVYDPCTVLTIGVFDNW  707

Query  2105  EVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     ++  D R+GKVRIR+STL   KVY N++ L++L  +GLKKMGEIE+A+RF+  
Sbjct  708   RMFADAGDDKPDYRIGKVRIRVSTLENNKVYTNSYPLLVLLRSGLKKMGEIEVAIRFVCP  767

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +   +   VY QP+LP MH++RPLG  QQE+LR AA+K++   L+RSEPPL  EVV YML
Sbjct  768   SLLPETCAVYGQPVLPTMHYLRPLGVAQQEALRGAAIKMVAAWLARSEPPLGPEVVRYML  827

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   TILVH L ++LVW+PD
Sbjct  828   DADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTILVHVLYLVLVWYPD  887

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT+IS +E++D DELDEEFD +P +RP +++
Sbjct  888   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRISQSETVDPDELDEEFDTLPSSRPPEII  946

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C ++  +LY VP K
Sbjct  947   RMRYDRLRILAARVQTVLGDFATQGERVQALVSWRDPRATKLFIIVCLIITIVLYAVPPK  1006

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFY+LRHP+FRD MP   LNFFRRLPSL+DR++
Sbjct  1007  MVAVALGFYFLRHPMFRDPMPPATLNFFRRLPSLSDRLM  1045


 Score =   163 bits (413),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VE+++ARNLLPKDG G+SSPYVV+DF GQ+K+T TV R+LNP+W+E LEF +S   
Sbjct  24   RKLVVEILDARNLLPKDGQGSSSPYVVVDFDGQKKRTSTVCRNLNPEWHEGLEFIISDPR  83

Query  329  DIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             +  + L+++V++DK +  G   +N+FLGRVKL  +QF ++GEE LIY+PLE+K++ SWI
Sbjct  84   TMEFEELDIEVFNDKKLSNGNARKNHFLGRVKLYGSQFARRGEEGLIYFPLEKKSVFSWI  143

Query  503  QGDIGLKIYFVD  538
            +G++GLKIY+ D
Sbjct  144  RGELGLKIYYYD  155



>dbj|BAC79748.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
Length=818

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/772 (54%), Positives = 542/772 (70%), Gaps = 42/772 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGR  1081
             S  DLV+KM YLFV++V+AR LP    P V+V   G H  +R AR+   FEWDQTFAF R
Sbjct  55    SKHDLVDKMPYLFVRVVRARGLPAGAHPHVRVAAGGRHASTREARRGAFFEWDQTFAFVR  114

Query  1082  D--APDSSS-ILEISVWDPLSSKSLDPTSDVAG---HNFLGGICFDVSEIPLRDPPDSPL  1243
             D  A DS    LE+SVWD      L P +DV+     +FLGG+CFD +++  RDPPD PL
Sbjct  115   DPGATDSPGPTLEVSVWD------LPPDADVSDADDRHFLGGLCFDTADVHARDPPDGPL  168

Query  1244  APQWYRLEGGGAHKG-DLMLATWVGTQADESFPDAWKTDTAGNPTSRS-----KVYQSPK  1405
             A QWYRLEGG    G DLM+ATW GTQADE+F DAWK D+  +  + +     KVY SPK
Sbjct  169   ATQWYRLEGGRRLAGADLMVATWAGTQADEAFADAWKADSPASSVAAAAASRAKVYVSPK  228

Query  1406  LWYLRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSA-TGSPSWNEDLVFV  1579
             LW LR +VIEAQD   LTAP  +++   ++  LGFQ  KT+ A  A  G PSWNEDL+FV
Sbjct  229   LWLLRLTVIEAQDT--LTAPPPRDAGIAVRGTLGFQSLKTRTAPVARNGGPSWNEDLLFV  286

Query  1580  AAEPFTE-HYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEK  1756
             AAEP  +    L   +E    K+   +G ASI L++IERRVDDR+V S+W      +E  
Sbjct  287   AAEPHADGDDCLVISLEVRHGKDAFPVGSASISLATIERRVDDRKVASKWIDLLPSDEAM  346

Query  1757  R---------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
             +         ++ GR+H+R+C DGGYHV +E  +  SD+RP+ARQLW+PP+G VELGI+G
Sbjct  347   KKVGKKAAMHMHGGRLHVRVCLDGGYHVADEQPYASSDFRPSARQLWRPPIGVVELGIVG  406

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
             CK LLPM+T  GKG TDAYAVAKYG KW RTRTISD+  P WNEQYTW VYDP TV+T+G
Sbjct  407   CKGLLPMRTADGKGCTDAYAVAKYGPKWARTRTISDSFDPAWNEQYTWPVYDPCTVLTVG  466

Query  2090  VFDSWEVID----PENSKDVR-----MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
             VFD          P+ +KD       MGKVRIR+STL +G+VYR  + LI++ P G K+M
Sbjct  467   VFDDPPPPSPSQLPDGAKDAAAFSRPMGKVRIRLSTLESGRVYRGVYPLIMMLPTGAKRM  526

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             G++ELA+RF  S   LD LH+Y +P LP MHH+RP+ A  +++LR +A ++   HL+RSE
Sbjct  527   GDVELAIRFAASASALDVLHMYGRPALPPMHHLRPIPAASRDALRLSAARISAAHLARSE  586

Query  2423  PPLRREVVAYMLDA-DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATIL  2599
             PPLRRE   +MLDA +   FSMRK+RANW R +  ++ V D  +WA+DTR+WRNPTAT L
Sbjct  587   PPLRREAATWMLDAAEPRGFSMRKLRANWTRAVAALSWVSDAARWAEDTRSWRNPTATAL  646

Query  2600  VHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEE  2779
              HA+LVLL W PDL++PT   +V  +G W YR R R    H   + S+AE+ DR+ELDEE
Sbjct  647   AHAVLVLLAWHPDLVVPTLTLHVAAVGVWKYRRRPRAPAPHPCVRASMAEAADREELDEE  706

Query  2780  FDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALC  2959
             FDA+P +RP ++VRARYD+ RM+GAR+Q ++GD+ATQ ER+QALV+WRDPRATG+F+ALC
Sbjct  707   FDAIPSSRPPEVVRARYDRARMVGARLQAMVGDVATQAERLQALVSWRDPRATGVFVALC  766

Query  2960  FVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               VA  LY+VP K++A+  GFYYLRHP+FRDRMP+PA+NFFRRLPS+++R++
Sbjct  767   VFVAMALYVVPIKVVAVVAGFYYLRHPMFRDRMPAPAINFFRRLPSMSERIM  818



>ref|XP_006367076.1| PREDICTED: uncharacterized protein LOC102584166 [Solanum tuberosum]
Length=1047

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/759 (56%), Positives = 546/759 (72%), Gaps = 42/759 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA--RKTLLF---EWDQT  1066
             S+FDLVE MHYLFV+IVKAR L  +  P VK+  S   + S+PA  R   L    EW Q 
Sbjct  310   SAFDLVEPMHYLFVKIVKARGLAPSESPFVKIRTSNHFLRSKPAIIRPGELLSNPEWQQV  369

Query  1067  FAFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             F+   +  +S+ S LEISVWD             A  +FLGG+CFD+S++P+RDPPDSPL
Sbjct  370   FSLCHNKQESTNSTLEISVWDS------------ASDHFLGGVCFDLSDVPVRDPPDSPL  417

Query  1244  APQWYRLEGGG--AHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             APQWY LEGG    HK  GD+ L+ W+GTQAD++FP++  +D      +RSKVYQSPKLW
Sbjct  418   APQWYHLEGGADDQHKVSGDIQLSVWIGTQADDAFPESCSSDAPYVAHTRSKVYQSPKLW  477

Query  1412  YLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSP--SWNED  1567
             YLR +VIEAQD+        LTAP      ++KAQLGFQ  +T+  +    S    W+ED
Sbjct  478   YLRITVIEAQDLHIAPNLPPLTAPE----VRVKAQLGFQSVRTRRGTMNHHSSVFHWSED  533

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             L+FVA EP  +   L  L+E    K+ A+LG   IP+SSIE+R+D+R V ++WF  E   
Sbjct  534   LIFVAGEPLEDS--LILLVEDRTTKDPALLGHIIIPVSSIEQRLDERLVPAKWFGLE--G  589

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
                  Y GR+HLR+C +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLP
Sbjct  590   GPGGAYCGRLHLRMCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLP  649

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             +K+   GKGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  650   LKSKGPGKGSTDAYCVAKYGKKWVRTRTITDTFDPRWNEQYTWQVYDPCTVLTIGVFDNW  709

Query  2105  EVI--DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     E+  D R+GKVRIR+STL   KVY N++ L++L  +GLKKMGEIE+A+RF+  
Sbjct  710   RMFADSGEDKPDYRIGKVRIRVSTLENNKVYTNSYPLLVLLRSGLKKMGEIEVAIRFVCP  769

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +   +   VY QP+LP MH++RPLG  QQE+LR AA+K++   L+RSEPPL  EVV YML
Sbjct  770   SLLPETCAVYGQPVLPKMHYLRPLGVAQQEALRGAAIKMVAAWLARSEPPLGPEVVRYML  829

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  TILVH L ++LVW+PD
Sbjct  830   DADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPVTTILVHVLYLVLVWYPD  889

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT+IS +E++D DELDEEFD +P ++P +++
Sbjct  890   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRISQSETVDPDELDEEFDTIPSSKPPEII  948

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C ++  +LY VP K
Sbjct  949   RMRYDRLRILAARVQTVLGDFATQGERVQALVSWRDPRATKLFIIVCLIITIVLYAVPPK  1008

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFY+LRHP+FRD MP   LNFFRRLPSL+DR++
Sbjct  1009  MVAVALGFYFLRHPMFRDPMPPATLNFFRRLPSLSDRLM  1047


 Score =   166 bits (419),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VE+++ARNLLPKDG G+SSPYVV+DF GQ+K+T TV R+LNP+WNE LEF +S   
Sbjct  27   RKLVVEILDARNLLPKDGQGSSSPYVVVDFDGQKKRTSTVCRNLNPEWNEGLEFIISDPR  86

Query  329  DIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             +  + L+++V++DK +  G   +N+FLGRVKL  +QF ++GEE LIY+PLE+K++ SWI
Sbjct  87   TMEFEELDIEVFNDKKLSNGNARKNHFLGRVKLYGSQFARRGEEGLIYFPLEKKSVFSWI  146

Query  503  QGDIGLKIYFVD  538
            +G++GLKIY+ D
Sbjct  147  RGELGLKIYYYD  158



>ref|XP_010678580.1| PREDICTED: uncharacterized protein LOC104894108 [Beta vulgaris 
subsp. vulgaris]
Length=1058

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/766 (55%), Positives = 529/766 (69%), Gaps = 46/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQT  1066
             S+FDLVE M +LFV+IVKAR L     P                  RP       EW + 
Sbjct  311   SAFDLVEPMQFLFVRIVKARGLTPNESPFVKIRTSTESRRTKPAAYRPGESLENPEWREV  370

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FA    +   +  LEIS+WD  + +            FLGG+CFD+S++P+RDPPDSPLA
Sbjct  371   FAIPSTSQSVAGNLEISIWDAATERL-----------FLGGVCFDLSDVPVRDPPDSPLA  419

Query  1247  PQWYRLEGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS----RSKVYQSPKLWY  1414
              QWY LEG     GD+ LA W+GTQAD++FP+AW +D      S    RSKVYQSPKLWY
Sbjct  420   SQWYHLEGSEGISGDIQLAVWIGTQADDAFPEAWTSDAPPQQPSVAFTRSKVYQSPKLWY  479

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSAT---GSPSWNED  1567
             LR +VIEAQD+        LTAP      ++KAQLGFQ  +T+  S +     +  WNED
Sbjct  480   LRVTVIEAQDLHIPPNLPPLTAPE----IRVKAQLGFQSVRTRRGSMSVHGGAAVHWNED  535

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             L+ +A EP  E   L  L+E    K+  +LG A + + SIE+R D+RQV+++W T E   
Sbjct  536   LILIAGEPLEEQ--LILLVEDRTGKDPMLLGHAIVHVGSIEQRNDERQVVAKWITLEGGG  593

Query  1748  EEKRV-------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                         Y GRV LRL  +GGYHV++EAAH+CSDYRPTA+QLWKPP+G +ELGI+
Sbjct  594   GGGGGGGGGGGPYCGRVLLRLSLEGGYHVLDEAAHVCSDYRPTAKQLWKPPIGVLELGIL  653

Query  1907  GCKNLLPMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             G ++LLPMKT   GKGSTDAY VAKYG KWVRTRTI D+  PRWNEQYTW+VYDP TV+T
Sbjct  654   GARSLLPMKTKGVGKGSTDAYCVAKYGKKWVRTRTIVDSFDPRWNEQYTWQVYDPCTVLT  713

Query  2084  IGVFDSWEVI-DP-ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             IGVFD+W +  DP E   D R+GKVRIR+STL + KVY N++ L++L  +GLKKMGEIEL
Sbjct  714   IGVFDNWRMFADPGEEKPDYRIGKVRIRVSTLESNKVYTNSYPLLVLLRSGLKKMGEIEL  773

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             AVRF+  +   D   VY QP+LP MH++RPLG  QQ++LR AA K++   L+RSEPPL  
Sbjct  774   AVRFVCPSLLPDTCAVYGQPLLPRMHYLRPLGVAQQDALRGAATKMVAAWLARSEPPLGP  833

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLDADSH++SMRK +ANWFRI+ V+A  I + KW D  R W+ P  TILVH L +
Sbjct  834   EVVRYMLDADSHAWSMRKSKANWFRIVAVLAWAIGLAKWLDRIRRWKTPLTTILVHILYL  893

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LVW+PDLIIPT   YVF+IG W YRF+ +      DT++S AE+ID D+LDEEFD +P 
Sbjct  894   VLVWYPDLIIPTGFLYVFLIGIWYYRFKPKIPAG-MDTRLSQAETIDPDDLDEEFDTIPS  952

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +RP+D++R RYD+LR+L ARVQT+LGDLATQGERVQALV+WRDPRAT +FI +C +V   
Sbjct  953   SRPSDIIRVRYDRLRILAARVQTVLGDLATQGERVQALVSWRDPRATKLFIGICLMVTIT  1012

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY VP KM+A+A GFY+LRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  1013  LYAVPPKMVAVALGFYFLRHPMFREPMPPTSLNFFRRLPSLSDRLI  1058


 Score =   164 bits (414),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKLIVEVI+AR+LLPKDG G+SSPYVV+DF GQRK+T T  RDLNP WNE LEF +S  +
Sbjct  26   RKLIVEVIDARDLLPKDGQGSSSPYVVVDFDGQRKRTSTKYRDLNPTWNEPLEFIVSDPN  85

Query  329  DIFGDMLELDVYHDKNVGPTT---RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             +  + L ++VYHDK + P+    +N+FLGRVKL  +QF ++G+E L+Y+PLE+K++ SW
Sbjct  86   TMDYEELNVEVYHDKRMSPSGSARKNHFLGRVKLYGSQFARRGDEGLVYFPLEKKSVFSW  145

Query  500  IQGDIGLKIYFVD  538
            I+G++GL+I++ +
Sbjct  146  IKGELGLRIFYYE  158



>ref|XP_004236192.1| PREDICTED: uncharacterized protein LOC101246333 [Solanum lycopersicum]
Length=1047

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/759 (56%), Positives = 543/759 (72%), Gaps = 42/759 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQT  1066
             S+FDLVE MHYLFV+IVKAR L  +  P VK+  S         I RP       EW Q 
Sbjct  310   SAFDLVEPMHYLFVKIVKARGLAPSESPFVKIRTSNHFLRSKPAIIRPGEPLSNPEWQQV  369

Query  1067  FAFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             F+ G +  +S+ S LEISVWD             A  +FLGG+CFD+S++P+RDPPDSPL
Sbjct  370   FSLGHNKQESTNSTLEISVWD------------SASDHFLGGVCFDLSDVPVRDPPDSPL  417

Query  1244  APQWYRLEGGG--AHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             APQWY LEGG    HK  GD+ L+ W+GTQAD++FP++  +D      +RSKVYQSPKLW
Sbjct  418   APQWYHLEGGADDQHKVSGDIQLSVWIGTQADDAFPESCSSDAPYVSHTRSKVYQSPKLW  477

Query  1412  YLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNED  1567
             YLR +VIEAQD+        LTAP      ++KAQLGFQ  +T+  S    S +  W+ED
Sbjct  478   YLRITVIEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSVRTRRGSMNHHSSAFHWSED  533

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             L+FVA EP  +   L  L+E    K+ A+LG   IP+SSIE+R+D+R V ++WF  E   
Sbjct  534   LIFVAGEPLEDS--LILLVEDRTTKDPALLGHIIIPVSSIEQRLDERLVPAKWFGLE--G  589

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
                  Y GR+HLR+C +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLP
Sbjct  590   GPGGAYCGRLHLRMCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLP  649

Query  1928  MKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             +K+   GKGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+TIGVFD+W
Sbjct  650   LKSKGPGKGSTDAYCVAKYGKKWVRTRTITDTFDPRWNEQYTWQVYDPCTVLTIGVFDNW  709

Query  2105  EVI--DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
              +     ++  D R+GKVRIR+STL   KVY N++ L++L  +GLKKMGEIE+A+RF+  
Sbjct  710   RMFADSGDDKPDYRIGKVRIRVSTLENNKVYTNSYPLLVLLRSGLKKMGEIEVAIRFVCP  769

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +   +   VY QP+LP MH++RPLG  QQE+LR AA+K++   L+RSEPPL  EVV YML
Sbjct  770   SLLPETCAVYGQPVLPKMHYLRPLGVAQQEALRGAAIKMVAAWLARSEPPLGPEVVRYML  829

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             DADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  TILVH L ++LVW+PD
Sbjct  830   DADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPVTTILVHVLYLVLVWYPD  889

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   YVF+IG W YRFR +      DT+IS +E++D DELDEEFD +P ++P +++
Sbjct  890   LIVPTGFLYVFLIGVWYYRFRPKIPAG-MDTRISQSETVDPDELDEEFDTIPSSKPPEII  948

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR+L ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C ++  +LY VP K
Sbjct  949   RMRYDRLRILAARVQTVLGDFATQGERAQALVSWRDPRATKLFIIVCLIITIVLYAVPPK  1008

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             M+A+A GFY+LRHP+FRD MP   LNFFRRLPSL+DR++
Sbjct  1009  MVAVALGFYFLRHPMFRDPMPPATLNFFRRLPSLSDRLM  1047


 Score =   166 bits (419),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VE+++ARNLLPKDG G+SSPYVV+DF GQ+K+T TV R+LNP+WNE LEF +S   
Sbjct  27   RKLVVEILDARNLLPKDGQGSSSPYVVVDFDGQKKRTSTVCRNLNPEWNEGLEFIISDPR  86

Query  329  DIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             +  + L+++V++DK +  G   +N+FLGRVKL  +QF ++GEE LIY+PLE+K++ SWI
Sbjct  87   TMEFEELDIEVFNDKKLSNGNARKNHFLGRVKLYGSQFARRGEEGLIYFPLEKKSVFSWI  146

Query  503  QGDIGLKIYFVD  538
            +G++GLKIY+ D
Sbjct  147  RGELGLKIYYYD  158



>emb|CDP14853.1| unnamed protein product [Coffea canephora]
Length=958

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/761 (54%), Positives = 532/761 (70%), Gaps = 41/761 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshv-----isRPARKTLLFEWDQTF  1069
             ++DLVE M YLF++IVKAR+L     P + +  S   V      +RP       EW+Q F
Sbjct  215   AYDLVEPMQYLFIRIVKARNLAPTESPYLNIQTSSHSVKSRPGSTRPGEPPSNPEWNQVF  274

Query  1070  AFGRD-APDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A   + A  S S L+ISVW+  S +            FLGG+CFD+S++P+RDPPDSPLA
Sbjct  275   ALCHNRAEHSRSTLQISVWESSSER------------FLGGVCFDLSDVPVRDPPDSPLA  322

Query  1247  PQWYRLEGGGAHK---------GDLMLATWVGTQADESFPDAWKTDTAGNPT--SRSKVY  1393
             PQWY L+G G            GD+ L+ W+GTQAD++FP+AW +D   N    +RSKVY
Sbjct  323   PQWYHLDGSGPGGGGDGRDSVPGDIQLSVWIGTQADDAFPEAWSSDAPPNHVAHTRSKVY  382

Query  1394  QSPKLWYLRSSVIEAQDIFAL--TAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WN  1561
             QSPKLWYLR +VI+AQD+       P      +IKAQLG Q  +T+  S +  +P+  WN
Sbjct  383   QSPKLWYLRITVIQAQDLHIAPNLPPLTVPEIRIKAQLGLQSVRTRRGSMSHHAPAFHWN  442

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             EDL+FVA EP  ++  L  L+E    ++  +LG   IPL S+E+R D+R V ++W   E 
Sbjct  443   EDLIFVAGEPLEDN--LIILVEDRTGRDPEILGYVRIPLVSVEQRFDERHVAAKWLALE-  499

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
                    Y+GRV LR+C +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELGI+G + L
Sbjct  500   -GGPNGAYRGRVQLRMCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILELGILGARGL  558

Query  1922  LPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             LPMK+  G KGSTDAY VAKYG KWVRTRT++DN  PRWNEQYTW+VYDP TV+TIGVFD
Sbjct  559   LPMKSKGGGKGSTDAYCVAKYGKKWVRTRTVTDNFDPRWNEQYTWQVYDPCTVLTIGVFD  618

Query  2099  SWEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             +W +     E   D R+GKVRIRISTL + KVY N++ L++L   GLKKMGEIE+AVRF 
Sbjct  619   NWRMFADAGEEKPDNRIGKVRIRISTLESNKVYTNSYPLMVLLRTGLKKMGEIEVAVRFA  678

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               +   D    Y QP+LP MH++RPL   QQE+LR AA KL+   L RSEPPL  EVV Y
Sbjct  679   CPSMLPDTCAAYGQPLLPRMHYLRPLAIAQQEALRAAATKLVADWLGRSEPPLGPEVVRY  738

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLDADSH++S+RK +ANWFRI+ V+A  + + KW DD + W+NP  TILVH L ++LVW+
Sbjct  739   MLDADSHTWSIRKSKANWFRIVAVLAWAVGLAKWLDDIKRWKNPVTTILVHILYLVLVWY  798

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             PDLI+PT   YVF+IG W YRFR +      D ++S AES+D DELDEEFD +P +RP +
Sbjct  799   PDLIVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQAESVDPDELDEEFDTIPSSRPAE  857

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             ++R RYD+LR+L ARVQT+LGD ATQGERVQALV+WRDPRAT IFI +C  +A +LY+VP
Sbjct  858   IIRMRYDRLRLLAARVQTVLGDFATQGERVQALVSWRDPRATKIFIGVCLTIAAVLYMVP  917

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              KM+A+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DR+L
Sbjct  918   PKMVAVALGFYFLRHPMFRDPMPPVSLNFFRRLPSLSDRLL  958


 Score = 79.3 bits (194),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +2

Query  347  LELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGDIGL  520
            LE++VY+DK +  G   +N+FLGRVK+  +QF K+GEE +I++ LE+K++ SWI+G++GL
Sbjct  6    LEIEVYNDKKLSSGNARKNHFLGRVKIYGSQFSKRGEEGIIHFALEKKSVFSWIRGELGL  65

Query  521  KIYFVD  538
            KIY+ D
Sbjct  66   KIYYYD  71



>ref|XP_002511523.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52125.1| conserved hypothetical protein [Ricinus communis]
Length=1044

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/754 (55%), Positives = 529/754 (70%), Gaps = 36/754 (5%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +DLVE M YLF +IVKAR L     P          V     I RP   T   EW Q FA
Sbjct  309   YDLVEPMQYLFTRIVKARGLSPNDGPFVKIRTSTHSVRSKPAIYRPGEPTDSPEWHQVFA  368

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
              G + PDS  S LEISVWD             +   FLGG+CFD+S++P+RDPPDSPLAP
Sbjct  369   LGHNKPDSPCSTLEISVWD-------------STEQFLGGVCFDLSDVPVRDPPDSPLAP  415

Query  1250  QWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             QWYRLE G         GD+ L+ W+GTQ D++FP+AW +D      +RSKVYQSPKLWY
Sbjct  416   QWYRLESGPDQNSSRVSGDIQLSVWIGTQNDDAFPEAWSSDAPYVAHTRSKVYQSPKLWY  475

Query  1415  LRSSVIEAQD--IFALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWNEDLVFVA  1582
             LR +VIEAQD  I +   P      ++KA LGFQ  +++  S  + T S  W+EDL+FVA
Sbjct  476   LRVTVIEAQDLQIASNLPPLTAPEIRVKAHLGFQSVRSRRGSMNNHTTSFHWHEDLIFVA  535

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRV  1762
              EP  +   L  ++E    KE   LG   IP++SIE+R+D+R V S+WF  E        
Sbjct  536   GEPLEDS--LILVVEDRTSKEAISLGHIMIPVASIEQRIDERHVSSKWFPLE--GAASGF  591

Query  1763  YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMR  1942
             Y+GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELGI+G + LLPMK   
Sbjct  592   YQGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILELGILGARGLLPMKNQC  651

Query  1943  G-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI-D  2116
             G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGVFD+W +  D
Sbjct  652   GVKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDNWRMFAD  711

Query  2117  PENSK-DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLD  2293
             P   K D R+GKVRIR+STL + KVY N++ L++L  +GLKKMGEIE+AVRF   +   D
Sbjct  712   PSEEKPDSRIGKVRIRVSTLESNKVYTNSYPLLVLLRSGLKKMGEIEVAVRFACPSLLPD  771

Query  2294  FLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSH  2473
                 Y QP+LP MH++RPLG  QQE+LR AA K++ + L+RSEP L  EVV YMLDADSH
Sbjct  772   TCAAYGQPLLPRMHYLRPLGVAQQEALRGAATKMVASWLARSEPALGHEVVQYMLDADSH  831

Query  2474  SFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPT  2653
             ++SMRK +ANWFRI+ V+A  + + KW  D R W+NP  T+LVH L ++LVW+PDL++PT
Sbjct  832   TWSMRKSKANWFRIVAVLAWAVGLAKWLHDIRRWKNPVTTVLVHVLYLVLVWYPDLVVPT  891

Query  2654  FAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYD  2833
                YV +IG W YRFR +      D ++S AE++D DELDEEFD +P +RP +++R RYD
Sbjct  892   GFLYVVLIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIPSSRPPELIRVRYD  950

Query  2834  KLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMA  3013
             +LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FIA+C  +  ILY+VP KM+A+A
Sbjct  951   RLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIAVCLAITIILYMVPPKMVAVA  1010

Query  3014  FGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1011  LGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1044


 Score =   158 bits (400),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEV  AR+LLPKDG G+SSPYV+ +F GQ+K+T T  RDLNP+WNE LEF +S   
Sbjct  15   RKLLVEVANARDLLPKDGQGSSSPYVIAEFDGQKKRTSTKYRDLNPEWNETLEFIVSDPD  74

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++V++DK  G  +  +N+FLGRVK+  TQF ++G+EALIY+PLE+K++ SWI
Sbjct  75   NMEVEELEIEVFNDKKFGNGSGRKNHFLGRVKVYGTQFARRGQEALIYFPLEKKSVFSWI  134

Query  503  QGDIGLKIYFVD  538
            +GD+GL+I + D
Sbjct  135  RGDLGLRICYYD  146



>gb|EEC81571.1| hypothetical protein OsI_25017 [Oryza sativa Indica Group]
Length=769

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/769 (54%), Positives = 536/769 (70%), Gaps = 51/769 (7%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFG  1078
             RS  DLV+KM YLFV++V+AR LP    P V+V   G H  +R AR+   FEWDQTFAF 
Sbjct  22    RSKHDLVDKMPYLFVRVVRARGLPAGAHPHVRVAAGGRHASTREARRGAFFEWDQTFAFV  81

Query  1079  RD--APDSSS-ILEISVWDPLSSKSLDPTSDVAG---HNFLGGICFDVSEIPLRDPPDSP  1240
             RD  A DS    LE+SVWD      L P +DV+     +FLGG+CFD +++  RDPPD P
Sbjct  82    RDPGATDSPGPTLEVSVWD------LPPDADVSDADDRHFLGGLCFDTADVHARDPPDGP  135

Query  1241  LAPQWYRLEGGGAHKG-DLMLATWVGTQADESFPDAWKTDTAGNPTSRS-----KVYQSP  1402
             LA QWYRLEGG    G DLM+ATW GTQADE+F DAWK D+  +  + +     KVY SP
Sbjct  136   LATQWYRLEGGRRLAGADLMVATWAGTQADEAFADAWKADSPASSVAAAAASRAKVYVSP  195

Query  1403  KLWYLRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSA-TGSPSWNEDLVF  1576
             KLW LR +VIEAQD   LTAP  +++   ++  LGFQ  KT+ A  A  G PSWNEDL+F
Sbjct  196   KLWLLRLTVIEAQDT--LTAPPPRDAGIAVRGTLGFQSLKTRTAPVARNGGPSWNEDLLF  253

Query  1577  VAAEPFTE-HYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEE  1753
             VAAEP  +    L   +E    K+   +G ASI L++IERRVDDR+V S+W      +E 
Sbjct  254   VAAEPHADGDDCLVISLEVRHGKDAFPVGSASISLATIERRVDDRKVASKWIDLLPSDEA  313

Query  1754  KR---------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
              +         ++ GR+H+R+C DGGYHV +E  +  SD+RP+ARQLW+PP+G VELGI+
Sbjct  314   MKKVGKKAAMHMHGGRLHVRVCLDGGYHVADEQPYASSDFRPSARQLWRPPIGVVELGIV  373

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
             GCK LLPM+T  GKG TDAYAVAKYG KW RTRTISD+  P WNEQYTW VYDP T+   
Sbjct  374   GCKGLLPMRTADGKGCTDAYAVAKYGPKWARTRTISDSFDPAWNEQYTWPVYDPCTL---  430

Query  2087  GVFDSWEVIDPENSKDVR-----MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
                       P+ +KD       MGKVRIR+STL +G+VYR  + LI++ P G K+MG++
Sbjct  431   ----------PDGAKDAAAFSRPMGKVRIRLSTLESGRVYRGVYPLIMMLPTGAKRMGDV  480

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             ELA+RF  S   LD LH+Y +P LP MHH+RP+ A  +++LR +A ++   HL+RSEPPL
Sbjct  481   ELAIRFAASASALDVLHMYGRPALPPMHHLRPIPAASRDALRLSAARISAAHLARSEPPL  540

Query  2432  RREVVAYMLDA-DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHA  2608
             RRE   +MLDA +   FSMRK+RANW R +  ++ V D  +WA+DTR+WRNPTAT L HA
Sbjct  541   RREAATWMLDAAEPRGFSMRKLRANWTRAVAALSWVSDAARWAEDTRSWRNPTATALAHA  600

Query  2609  LLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDA  2788
             +LVLL W PDL++PT   +V  +G W YR R R    H   + S+AE+ DR+ELDEEFDA
Sbjct  601   VLVLLAWHPDLVVPTLTLHVAAVGVWKYRRRPRAPAPHPCVRASMAEAADREELDEEFDA  660

Query  2789  VPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVV  2968
             +P +RP ++VRARYD+ RM+GAR+Q ++GD+ATQ ER+QALV+WRDPRATG+F+ALC  V
Sbjct  661   IPSSRPPEVVRARYDRARMVGARLQAMVGDVATQAERLQALVSWRDPRATGVFVALCVFV  720

Query  2969  AFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             A  LY+VP K++A+  GFYYLRHP+FRDRMP+PA+NFFRRLPS+++R++
Sbjct  721   AMALYVVPIKVVAVVAGFYYLRHPMFRDRMPAPAINFFRRLPSMSERIM  769



>ref|XP_007037224.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOY21725.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1055

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/756 (56%), Positives = 536/756 (71%), Gaps = 35/756 (5%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvis-----RPARKTLLFEWDQTFA  1072
             FDLVE M YLFV+IVKAR L     P VK+  S  ++ S     RP   T   EW Q FA
Sbjct  315   FDLVEPMQYLFVKIVKARGLAPNECPYVKIRTSSHYLKSKPTIYRPGEPTDSPEWRQVFA  374

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
              G +  +S ++ LEISVWD        PT      NFLGG+CFD+S++P+R+PPDSPLAP
Sbjct  375   LGYNKQESVTATLEISVWDA-------PT-----ENFLGGVCFDLSDVPVREPPDSPLAP  422

Query  1250  QWYRLEGG------GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLW  1411
             QWYRLE G      G   GD+ LA W+GTQ D++FP+AW +D      +RSKVYQSPKLW
Sbjct  423   QWYRLETGAVDQNSGRVSGDIQLAVWIGTQNDDAFPEAWSSDAPYVAHTRSKVYQSPKLW  482

Query  1412  YLRSSVIEAQD--IFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDLVFV  1579
             YLR ++IEAQD  I     P      ++KAQLGFQ  +++  +    S S  WNEDL+FV
Sbjct  483   YLRLTLIEAQDLQIAPNLPPLTVPEIRVKAQLGFQSVRSRRGNMNNHSMSVHWNEDLIFV  542

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR  1759
             A EP  +   L  L+E    KE  VLG+  IPL SIE+R+D+R V S+W+  +       
Sbjct  543   AGEPLEDS--LILLVEDRTNKEATVLGLVMIPLISIEQRIDERHVASKWYGLDGGAGGGG  600

Query  1760  VYKG-RVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKT  1936
                G R+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELGI+G + LLPMKT
Sbjct  601   GPYGGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILELGILGARGLLPMKT  660

Query  1937  MRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI  2113
               G KGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+GVFD+W + 
Sbjct  661   KGGGKGSTDAYCVAKYGKKWVRTRTVTDSFDPRWNEQYTWQVYDPCTVLTVGVFDNWRMF  720

Query  2114  D--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPT  2287
                 E+  D R+GK+RIRISTL + KVY N++ L++L+  GLKKMGEIELAVRF   +  
Sbjct  721   ADASEDKPDSRIGKIRIRISTLESNKVYTNSYPLLVLTRMGLKKMGEIELAVRFACPSLL  780

Query  2288  LDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDAD  2467
              D    Y QP+LP MH++RPLG  QQE+LR AA K++   L+RSEPPL +EVV YMLDAD
Sbjct  781   PDTCSAYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAQWLARSEPPLGQEVVRYMLDAD  840

Query  2468  SHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLII  2647
             SH++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  T+LVH L ++LVW+PDLI+
Sbjct  841   SHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPVTTVLVHVLYLVLVWYPDLIV  900

Query  2648  PTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRAR  2827
             PT   YV +IG W YRFR +      D ++S AE++D DELDEEFD +P ++P +++RAR
Sbjct  901   PTGFLYVVLIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIPSSKPPELIRAR  959

Query  2828  YDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIA  3007
             YD+LR+L  RVQT+LGD ATQGERVQALV+WRDPRAT +FI +C  +  ILY+VP KM+ 
Sbjct  960   YDRLRILAGRVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLAITLILYVVPPKMVV  1019

Query  3008  MAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  1020  VALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1055


 Score =   159 bits (402),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RK+IVEVI+AR+LLPKDG G+SSPYV+ DF GQ+K+T T  R+LNP WNE LEF +S   
Sbjct  17   RKVIVEVIDARDLLPKDGQGSSSPYVIADFDGQKKRTSTKYRELNPVWNEPLEFTVSDPE  76

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++V++DK  G  +  +N+FLGRVKL  +QF ++GEE LIY+PLE+K++ SWI
Sbjct  77   NMDVEELEIEVFNDKKFGNGSGRKNHFLGRVKLYGSQFARRGEEGLIYFPLEKKSVFSWI  136

Query  503  QGDIGLKIYFVD  538
            +G+IGLKI + D
Sbjct  137  RGEIGLKICYYD  148



>ref|NP_001058966.1| Os07g0165100 [Oryza sativa Japonica Group]
 dbj|BAF20880.1| Os07g0165100 [Oryza sativa Japonica Group]
Length=1037

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/772 (54%), Positives = 542/772 (70%), Gaps = 42/772 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGR  1081
             S  DLV+KM YLFV++V+AR LP    P V+V   G H  +R AR+   FEWDQTFAF R
Sbjct  274   SKHDLVDKMPYLFVRVVRARGLPAGAHPHVRVAAGGRHASTREARRGAFFEWDQTFAFVR  333

Query  1082  D--APDSSS-ILEISVWDPLSSKSLDPTSDVAG---HNFLGGICFDVSEIPLRDPPDSPL  1243
             D  A DS    LE+SVWD      L P +DV+     +FLGG+CFD +++  RDPPD PL
Sbjct  334   DPGATDSPGPTLEVSVWD------LPPDADVSDADDRHFLGGLCFDTADVHARDPPDGPL  387

Query  1244  APQWYRLEGGGAHKG-DLMLATWVGTQADESFPDAWKTDTAGNPTSRS-----KVYQSPK  1405
             A QWYRLEGG    G DLM+ATW GTQADE+F DAWK D+  +  + +     KVY SPK
Sbjct  388   ATQWYRLEGGRRLAGADLMVATWAGTQADEAFADAWKADSPASSVAAAAASRAKVYVSPK  447

Query  1406  LWYLRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSA-TGSPSWNEDLVFV  1579
             LW LR +VIEAQD   LTAP  +++   ++  LGFQ  KT+ A  A  G PSWNEDL+FV
Sbjct  448   LWLLRLTVIEAQDT--LTAPPPRDAGIAVRGTLGFQSLKTRTAPVARNGGPSWNEDLLFV  505

Query  1580  AAEPFTE-HYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEK  1756
             AAEP  +    L   +E    K+   +G ASI L++IERRVDDR+V S+W      +E  
Sbjct  506   AAEPHADGDDCLVISLEVRHGKDAFPVGSASISLATIERRVDDRKVASKWIDLLPSDEAM  565

Query  1757  R---------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
             +         ++ GR+H+R+C DGGYHV +E  +  SD+RP+ARQLW+PP+G VELGI+G
Sbjct  566   KKVGKKAAMHMHGGRLHVRVCLDGGYHVADEQPYASSDFRPSARQLWRPPIGVVELGIVG  625

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
             CK LLPM+T  GKG TDAYAVAKYG KW RTRTISD+  P WNEQYTW VYDP TV+T+G
Sbjct  626   CKGLLPMRTADGKGCTDAYAVAKYGPKWARTRTISDSFDPAWNEQYTWPVYDPCTVLTVG  685

Query  2090  VFDSWEVID----PENSKDVR-----MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
             VFD          P+ +KD       MGKVRIR+STL +G+VYR  + LI++ P G K+M
Sbjct  686   VFDDPPPPSPSQLPDGAKDAAAFSRPMGKVRIRLSTLESGRVYRGVYPLIMMLPTGAKRM  745

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSE  2422
             G++ELA+RF  S   LD LH+Y +P LP MHH+RP+ A  +++LR +A ++   HL+RSE
Sbjct  746   GDVELAIRFAASASALDVLHMYGRPALPPMHHLRPIPAASRDALRLSAARISAAHLARSE  805

Query  2423  PPLRREVVAYMLDA-DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATIL  2599
             PPLRRE   +MLDA +   FSMRK+RANW R +  ++ V D  +WA+DTR+WRNPTAT L
Sbjct  806   PPLRREAATWMLDAAEPRGFSMRKLRANWTRAVAALSWVSDAARWAEDTRSWRNPTATAL  865

Query  2600  VHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEE  2779
              HA+LVLL W PDL++PT   +V  +G W YR R R    H   + S+AE+ DR+ELDEE
Sbjct  866   AHAVLVLLAWHPDLVVPTLTLHVAAVGVWKYRRRPRAPAPHPCVRASMAEAADREELDEE  925

Query  2780  FDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALC  2959
             FDA+P +RP ++VRARYD+ RM+GAR+Q ++GD+ATQ ER+QALV+WRDPRATG+F+ALC
Sbjct  926   FDAIPSSRPPEVVRARYDRARMVGARLQAMVGDVATQAERLQALVSWRDPRATGVFVALC  985

Query  2960  FVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               VA  LY+VP K++A+  GFYYLRHP+FRDRMP+PA+NFFRRLPS+++R++
Sbjct  986   VFVAMALYVVPIKVVAVVAGFYYLRHPMFRDRMPAPAINFFRRLPSMSERIM  1037


 Score =   172 bits (437),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV+EARNLLPKDG G SSPY  +DF GQR+KT TV R+LNP WNE LEFN + 
Sbjct  6    TVRKLVVEVVEARNLLPKDGTGTSSPYARVDFDGQRRKTHTVPRELNPAWNEALEFNFAG  65

Query  323  HSDIFG---DMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
             +       + LE+ V HD  VGP+ R+NFLGRV+L+A QFV+KGEEALIY+PLE+K   
Sbjct  66   VAGDVVVGGEPLEVAVLHDVRVGPSRRSNFLGRVRLDARQFVRKGEEALIYFPLEKKGFF  125

Query  494  SWIQGDIGLKIYFV  535
            +W++G+IGL++Y++
Sbjct  126  NWVRGEIGLRVYYL  139



>ref|XP_006476653.1| PREDICTED: uncharacterized protein LOC102631240 [Citrus sinensis]
Length=1029

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/762 (56%), Positives = 543/762 (71%), Gaps = 45/762 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF-----EWDQTFA  1072
             +DLVE M YLFV+I KAR L     P VK+  S  +  S+ A           EW+Q FA
Sbjct  287   YDLVEPMMYLFVKIGKARGLAPNEAPYVKIRTSSHYKKSKLASYRACDPHDSPEWNQVFA  346

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                +  DS S+ LEI+VWD        PT      NFLGG+CFD+S++P+RDPPDSPLAP
Sbjct  347   LFHNKNDSVSATLEITVWD-------SPT-----ENFLGGVCFDLSDVPVRDPPDSPLAP  394

Query  1250  QWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             QWYRLEG  + +     GD+ LA W+GTQADE+FP+AW +D      +RSKVYQSPKLWY
Sbjct  395   QWYRLEGEASDQNNRVSGDIQLAVWIGTQADEAFPEAWSSDAPYVAHTRSKVYQSPKLWY  454

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDL  1570
             LR +V+EAQD+        LTAP      ++KAQL FQ  +T+  S +  S S  W+ED+
Sbjct  455   LRVTVMEAQDLCIAHNLPPLTAPE----IRVKAQLAFQSARTRRGSMSNHSSSFHWHEDV  510

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQA--VLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
              FVAAEPF +   L  L+E    K+ A  +LG   +P+SSI++R+D+R V S+WF  E  
Sbjct  511   FFVAAEPFEDS--LILLVEDRTAKDAAAVILGHVVVPVSSIDQRIDERHVASKWFPLEGS  568

Query  1745  NEE--KRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                   R Y GR+ L+LC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGI+G + 
Sbjct  569   CGRGCARSYCGRIQLKLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGILELGILGARG  628

Query  1919  LLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+T+GVF
Sbjct  629   LLPMKTKNGGKGSTDAYCVAKYGKKWVRTRTITDCFDPRWNEQYTWQVYDPCTVLTVGVF  688

Query  2096  DSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             D+W +     E   D R+GK+RIR+STL   KVY  ++ L++L   GLKKMGEIELAVRF
Sbjct  689   DNWRMFADASEERPDYRIGKIRIRVSTLENNKVYTTSYPLLVLLRTGLKKMGEIELAVRF  748

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
             +  +   +   VY QP+LP MH++RPLG  QQE+LR AA K++ + L+RSEPPL  EVV 
Sbjct  749   VCPSMLPETSSVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVASWLARSEPPLGPEVVR  808

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH++SMRK +ANWFRI+ V+A  I + KW  + R W+NP  T+LVH L ++LVW
Sbjct  809   YMLDADSHAWSMRKSKANWFRIVAVLAWAIGLAKWLHNIRRWKNPVTTVLVHVLYLVLVW  868

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +PDLI+PT   YV +IG W YRFR +   +  DT++S AE++D DELDEEFD +P ++P+
Sbjct  869   YPDLIVPTGFLYVVLIGVWYYRFRPKIP-SGMDTRLSQAETVDPDELDEEFDTIPSSKPS  927

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             +++R RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C V+  +LY+V
Sbjct  928   EIIRMRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCTVITLVLYVV  987

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  988   PPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1029


 Score =   162 bits (411),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV++AR+LLPKDG G+SSPYV+ DF GQRK+T T  RDLNP WNE LEF +S 
Sbjct  14   TVRKLVVEVVDARDLLPKDGQGSSSPYVIADFDGQRKRTSTKFRDLNPVWNEPLEFMVSD  73

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK    G   +N+FLGRVKL  +QF ++G+E L+Y PLE+K++ S
Sbjct  74   PKNMDYEELEIEVYNDKRYCNGSGRKNHFLGRVKLCGSQFARRGDEGLVYIPLEKKSVFS  133

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  134  WIRGEIGLRIYYYD  147



>ref|XP_002267314.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
 ref|XP_010663411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Vitis vinifera]
Length=1009

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/761 (55%), Positives = 539/761 (71%), Gaps = 43/761 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQT  1066
             +++DLVE M YLFV+IVKAR L     P VK+  +           RP       EW Q 
Sbjct  269   TAYDLVEPMQYLFVRIVKARRLSPTESPCVKIRTAGHFLRSKPATLRPGESWENPEWHQV  328

Query  1067  FAFGRDAPDSSS-ILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             FA G +  DS+S  LEISVW+  S +            FLGG+CFD+S++P+RDPPDSPL
Sbjct  329   FALGYNKSDSASATLEISVWNGTSEQ------------FLGGVCFDLSDVPVRDPPDSPL  376

Query  1244  APQWYRLEGG-----GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             APQWYRLEG      G   GD+ L+ W+GTQAD++FP++W +D      +RSKVYQSPKL
Sbjct  377   APQWYRLEGADDQNSGIVSGDIQLSVWIGTQADDAFPESWSSDAPYVAHTRSKVYQSPKL  436

Query  1409  WYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNE  1564
             WYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S ++ S S  W+E
Sbjct  437   WYLRVTVMEAQDLHIASNLPPLTAPE----VRVKAQLGFQSVRTRRGSMSSHSSSFFWHE  492

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             DLVFVA E   +H  L  L+E    K+  +LG   +P+S+IE+R+D+R V S+WF   D 
Sbjct  493   DLVFVAGEALEDH--LILLVEDRTAKDALLLGHVVVPVSAIEQRIDERHVASKWFPL-DG  549

Query  1745  NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y GR++LRLC +GGYHV++EAA +CSD+RPTA+QLWKP VG +ELGI+G + LL
Sbjct  550   GCVGGPYCGRINLRLCLEGGYHVLDEAAQVCSDFRPTAKQLWKPAVGVLELGILGARGLL  609

Query  1925  PMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMKT  G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGVFD+
Sbjct  610   PMKTKGGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDN  669

Query  2102  WEVIDP---ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
               +  P   E   D R+GKVRIR+STL + KVY N++ L++L   GLKKMGEIELA+RF 
Sbjct  670   LRMFAPDMPEEKPDYRIGKVRIRVSTLESNKVYTNSYPLLVLQRTGLKKMGEIELAIRFA  729

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               +   +   +Y QP+LP MH++RPLG  QQE+LR AA K++   L RSEPPL  EVV Y
Sbjct  730   CPSMLPETCAIYGQPLLPRMHYLRPLGVAQQEALRGAATKIVAAWLVRSEPPLGPEVVRY  789

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLDADSH++SMRK +ANWFRI+ V+A  + + KW DD R W+NP  T+LVH L ++LVW+
Sbjct  790   MLDADSHTWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWKNPITTVLVHVLYLVLVWY  849

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             PDLI+PT   Y+F+IG W YRFR +      D ++S AE++D DELDEEFD +P ++P +
Sbjct  850   PDLIVPTGFLYIFLIGLWYYRFRPKIPAG-MDIRLSQAETVDPDELDEEFDTIPSSKPPE  908

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             ++RARYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C +V  +LY VP
Sbjct  909   IIRARYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCLIVTVVLYAVP  968

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              KM+A+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  969   PKMVAVAIGFYFLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1009


 Score =   163 bits (413),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T+RKLIVE+++AR+LLPKDG G+SSPYV++DF G +++T T  RDLNP WNE LEF +S 
Sbjct  14   TQRKLIVEIVDARDLLPKDGQGSSSPYVIVDFDGHKQRTTTKYRDLNPVWNEKLEFLVSD  73

Query  323  HSDIFGDMLELDVYHDKNV----GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
               +  + LE++V++DK +    G + +N+FLGRVKL  +QF K+GEE L+Y+PLE+K++
Sbjct  74   PDTMEVEELEIEVFNDKRMGNGGGSSRKNHFLGRVKLYGSQFAKRGEEGLVYFPLEKKSV  133

Query  491  LSWIQGDIGLKIYFVD  538
             SWI+G+IGL+IY+ D
Sbjct  134  FSWIRGEIGLRIYYYD  149



>ref|XP_011047438.1| PREDICTED: uncharacterized protein LOC105141781 [Populus euphratica]
Length=1044

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/768 (54%), Positives = 528/768 (69%), Gaps = 47/768 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFA  1072
             +DLVE M YLF++IVKAR L     P          +       RP       EW Q FA
Sbjct  292   YDLVEPMQYLFIRIVKARGLSQNKSPIVEVRTTTYRMKSEPASYRPGASPDSPEWHQVFA  351

Query  1073  FGRDA------PDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPD  1234
              G +       P+++  LEISVWD  S +            FLGG+CFD+SE+P+RDPPD
Sbjct  352   LGHNNKTDGQLPNAAGNLEISVWDAHSEQ------------FLGGVCFDISEVPVRDPPD  399

Query  1235  SPLAPQWYRLEGGGAH-------KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVY  1393
             SPLAPQWYRLE   A         GD+ L+ W+GTQAD++FP+AW +D      +RSKVY
Sbjct  400   SPLAPQWYRLESDAAADQSCNRVSGDIQLSVWIGTQADDAFPEAWSSDAPYVAHTRSKVY  459

Query  1394  QSPKLWYLRSSVIEAQD--IFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WN  1561
             QSPKLWYLR +VIEAQD  I +   P      +I AQLGFQ  +T+  S +  S S  W 
Sbjct  460   QSPKLWYLRVTVIEAQDLHISSNLPPLTVPEIRINAQLGFQSARTRRGSMSNHSTSFRWI  519

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             +DLVFVA EP  E   L  L+E     E  +LG   IP+SSIE+R D+R V S+WF  E 
Sbjct  520   DDLVFVAGEPLEES--LILLVEDRTTTEAVLLGYIIIPVSSIEQRYDERHVASKWFPLEG  577

Query  1742  QNEEKRVY-------KGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
               +            +GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELG
Sbjct  578   GGDTGGAGCAPGGSCRGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGVLELG  637

Query  1901  IIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTV  2077
             I+G + LLPMK   G  GSTDAY VAKYG KWVRTRTI D+  PRWNE+YTW+VYDPSTV
Sbjct  638   ILGARGLLPMKPKGGGSGSTDAYCVAKYGKKWVRTRTIRDSFEPRWNEKYTWQVYDPSTV  697

Query  2078  VTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             +T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L   GLKKMGEI
Sbjct  698   LTVGVFDNWHMFGEMSDDKPDCRIGKIRIRVSTLESNKVYMNSYPLLVLLRTGLKKMGEI  757

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             ELAVRF   +   D   VY QP+LP MH++RPLG  QQE+LR AA K+++  L+RSEPPL
Sbjct  758   ELAVRFACPSLLPDTCAVYGQPLLPKMHYLRPLGVAQQEALRGAATKMVSLWLARSEPPL  817

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
               EVV YMLDADSH++SMRK +ANWFRI+ V+A  + + KW DD R WRN   T+LVH L
Sbjct  818   GPEVVRYMLDADSHAWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNSVTTVLVHLL  877

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
              ++LVW+P+L++PT   YVF+IG W YRFR +      D ++S AE++D DELDEEFD V
Sbjct  878   YLVLVWYPELVVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQAETVDSDELDEEFDTV  936

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P  +P +++RARYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FIA+C  + 
Sbjct  937   PSMKPPEIIRARYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIAVCLAIT  996

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              ILY+VP KM+A+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  997   LILYVVPPKMVAVALGFYFLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1044


 Score =   144 bits (363),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 103/132 (78%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL+VEV++AR+LLPKDG G+SS YV+  F GQRK+T T  RDLNP WNE LEF +S  +
Sbjct  9    RKLLVEVLDARDLLPKDGQGSSSAYVIATFDGQRKRTSTKYRDLNPVWNENLEFIVSDPN  68

Query  329  DIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            ++  + LE++V++DK  G  +  +N+FLGRVKL  +QF K+GEE ++Y+PLE+K++ SWI
Sbjct  69   NMEFEELEVEVFNDKRFGNGSGRKNHFLGRVKLYGSQFSKRGEEGIVYFPLEKKSVFSWI  128

Query  503  QGDIGLKIYFVD  538
            +G+IGL+I + D
Sbjct  129  RGEIGLRICYYD  140



>ref|XP_004301166.1| PREDICTED: uncharacterized protein LOC101314668 [Fragaria vesca 
subsp. vesca]
Length=1055

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/754 (55%), Positives = 528/754 (70%), Gaps = 35/754 (5%)
 Frame = +2

Query  911   DLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFAF  1075
             +LVE M YLF +IVKAR L     P         +V     + RP   T   EW+Q FA 
Sbjct  318   ELVEPMQYLFTRIVKARGLAPNESPYVKLRTSSHLVKSKTAVHRPGEPTDSPEWNQVFAL  377

Query  1076  GRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQ  1252
               + PDS SS LEISV D  S +            FLGGI FD+S++P+RDPPDSPLAPQ
Sbjct  378   AHNRPDSVSSTLEISVRDSPSEQ------------FLGGIIFDLSDVPVRDPPDSPLAPQ  425

Query  1253  WYRLEGG------GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             WYRLEGG      G   GD+ L+ W+GTQAD++FP+AW ++      +RSKVYQSPKLWY
Sbjct  426   WYRLEGGAGDQNSGKVSGDIQLSVWIGTQADDAFPEAWSSEAPNVSHTRSKVYQSPKLWY  485

Query  1415  LRSSVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPA--SSATGSPSWNEDLVFVA  1582
             LR++V+E QD+   +   P      ++KAQLG Q  +T+    ++   S  WNEDL+FVA
Sbjct  486   LRTTVMEVQDLHIASNLPPLTTPEIRVKAQLGTQSARTRRGCMNNHCASFHWNEDLIFVA  545

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRV  1762
              EP  +   L  L+E    K+  +LG   IP+SSIE+R+D+R V S+W   E        
Sbjct  546   GEPLEDS--LILLVEDRTNKDPVLLGHIVIPVSSIEQRIDERYVASKWLPLE-GRGGGGP  602

Query  1763  YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMR  1942
             Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLPMK   
Sbjct  603   YSGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLLPMKAKS  662

Query  1943  G-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVID-  2116
             G KGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+TIGVFD+W +   
Sbjct  663   GGKGSTDAYCVAKYGKKWVRTRTITDGFDPRWNEQYTWQVYDPCTVLTIGVFDNWRMFAD  722

Query  2117  -PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLD  2293
               E  +D R+GK+RIRISTL + KVY+N++ L++LS  GLKKMGEIELAVRF   +   +
Sbjct  723   ASEEKQDFRIGKIRIRISTLESNKVYKNSYPLMVLSRTGLKKMGEIELAVRFACPSLLPE  782

Query  2294  FLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSH  2473
                VY QP+LP MH++RPLG  QQE+LR AA +++   L+RSEPPL  EVV YMLDADSH
Sbjct  783   TCAVYGQPLLPRMHYLRPLGVAQQEALRGAATRMVAAWLARSEPPLGTEVVRYMLDADSH  842

Query  2474  SFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPT  2653
             ++SMRK +ANWFRI+ V+A  + + KW DD R WRNP  T+LVH L ++LVW+PDLI+PT
Sbjct  843   TWSMRKSKANWFRIVAVLAWAVGLAKWLDDIRRWRNPVTTVLVHVLYLVLVWYPDLIVPT  902

Query  2654  FAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYD  2833
                YVF+IG W YRFR +      D ++S A+++D DELDEEFD  P ++  D++R RYD
Sbjct  903   GFLYVFLIGVWYYRFRPKIPAG-MDLRLSQADTVDPDELDEEFDTFPSSKSPDVIRVRYD  961

Query  2834  KLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMA  3013
             +LRML ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C ++  +LY VP KM+A+A
Sbjct  962   RLRMLAARVQTVLGDFATQGERAQALVSWRDPRATKLFIGVCLLITVVLYTVPPKMVAVA  1021

Query  3014  FGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  1022  LGFYYLRHPMFREPMPPASLNFFRRLPSLSDRLM  1055


 Score =   157 bits (398),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKLIVEVI+AR+LLPKDG G+SS YVV DF GQRK+T T  +DLNP WNE LEF +S 
Sbjct  44   TIRKLIVEVIDARDLLPKDGQGSSSAYVVADFDGQRKRTATKCKDLNPVWNEPLEFVVSD  103

Query  323  HSDIFGDMLELDVYHDK---NVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
              ++  + LE++V +DK   N G   +N+FLGRVKL  TQF K+G+E L+Y+ LE+K++ 
Sbjct  104  PDNMDYEELEIEVLNDKRYGNSGTARKNHFLGRVKLYGTQFSKRGDEGLVYFQLEKKSVF  163

Query  494  SWIQGDIGLKIYFVD  538
            SWI+G+IGL+IY+ D
Sbjct  164  SWIRGEIGLRIYYYD  178



>ref|XP_011071607.1| PREDICTED: uncharacterized protein LOC105157015 isoform X1 [Sesamum 
indicum]
Length=1033

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/758 (55%), Positives = 536/758 (71%), Gaps = 37/758 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQTF  1069
             +FDLVE M YLFV+IVKAR L     P VK+  SG  V S+PA           EW Q F
Sbjct  292   AFDLVEPMQYLFVRIVKARGLSQNENPHVKIRTSGHFVRSKPATVPPGSDPANPEWHQVF  351

Query  1070  AFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             A G +   ++ S LEISVWD  S K            FLGG+CFD+S++P+RDPPDSPLA
Sbjct  352   ALGYNKETAANSTLEISVWDGPSEK------------FLGGVCFDLSDVPVRDPPDSPLA  399

Query  1247  PQWYRLEGGGAH-----KGDLMLATWVGTQADESFPDAWKTDTAGNP---TSRSKVYQSP  1402
             PQWY LEGG         GDL L+ W+GTQAD++FP++W +D A  P    +R KVYQSP
Sbjct  400   PQWYHLEGGAGEDQNRVSGDLQLSVWIGTQADDAFPESWSSD-APQPFVSYTRPKVYQSP  458

Query  1403  KLWYLRSSVIEAQDIFAL--TAPSKESSFQIKAQLGFQVQKTKPASSA--TGSPSWNEDL  1570
             KLWYLR +VIEAQD+  +    P      ++K QLGFQ  +T+  S +  T +  WNEDL
Sbjct  459   KLWYLRVTVIEAQDLHIIPNLPPLTAPEIRVKGQLGFQSVRTRRGSMSHHTSAFHWNEDL  518

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNE  1750
             +FVA EP  +   L  L+E    K+  +LG   IP+ SIE+R+DDR V ++W+  E +  
Sbjct  519   IFVAGEPLEDS--LILLVEDRTGKDPVLLGHVLIPVGSIEQRLDDRHVAAKWYGLEGEPG  576

Query  1751  EKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPM  1930
                 Y GR+HLR+C +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LLPM
Sbjct  577   GGGSYCGRLHLRMCLEGGYHVLDEAAHICSDFRPTAKQLWKPAVGVLELGILGARGLLPM  636

Query  1931  KTM-RGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             K+   GKGSTDAY VAKYG KWVRTRT++DN  PRWNEQYTW+VYDP TV+T+GVFD+W 
Sbjct  637   KSKGNGKGSTDAYCVAKYGKKWVRTRTVTDNFDPRWNEQYTWQVYDPCTVLTVGVFDNWR  696

Query  2108  VIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
             +     E   D R+GKVR+R+STL + KVY N++ L++LS +GLKKMGEIELAVRF   +
Sbjct  697   MFAEAGEEKPDCRIGKVRVRVSTLDSNKVYMNSYPLMVLSRSGLKKMGEIELAVRFACPS  756

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
                D   +Y QP+LP MH+IRPLG  QQE+LR AA +++   L+RSEPPL  EVV YMLD
Sbjct  757   LLPDTCGIYGQPLLPRMHYIRPLGVAQQEALRGAATRMVAAWLARSEPPLGPEVVRYMLD  816

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
             ADSHS+SMRK +ANWFRI+ V+A  + + KW D  R WRNP  T+LVH L ++LVW+PDL
Sbjct  817   ADSHSWSMRKSKANWFRIVAVLAWAVGLAKWLDHIRRWRNPVTTVLVHVLYLVLVWYPDL  876

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             I+PT   Y+ +IG W YRF+ +      D K+S  +++D DELDEEFD  P +RP ++VR
Sbjct  877   IVPTAFLYICLIGIWYYRFKPKIPAG-MDVKLSQVDTVDPDELDEEFDTFPSSRPPEVVR  935

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RYD+LR+L ARVQT+LGD ATQGER+QALV+WRDPRAT +FI +CF +  ILY+VP KM
Sbjct  936   IRYDRLRILAARVQTVLGDFATQGERIQALVSWRDPRATKLFIGVCFAITIILYVVPPKM  995

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A+A GFY+LRHP+FRD MP  +L+FFRRLP L+DR++
Sbjct  996   VAVALGFYFLRHPMFRDPMPPASLSFFRRLPGLSDRLV  1033


 Score =   159 bits (401),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R+LIVEVIEAR+LLPKDG G+SSPYVV DF GQ+++T TV R+LNP WNE L+F +S 
Sbjct  19   TVRRLIVEVIEARDLLPKDGQGSSSPYVVADFDGQKRRTSTVERNLNPVWNEALQFVVSD  78

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
               +  + L ++V++DK +  G   +N+FLGRVKL  +QF K+GEE L+Y+ LE+K++ S
Sbjct  79   PKTMEFEELNVEVFNDKKLSNGNARKNHFLGRVKLYGSQFAKRGEEGLVYFTLEKKSVFS  138

Query  497  WIQGDIGLKIYFVD  538
            WI+GD+GLKIY+ D
Sbjct  139  WIRGDLGLKIYYYD  152



>ref|XP_008239837.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Prunus mume]
Length=952

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/760 (55%), Positives = 535/760 (70%), Gaps = 44/760 (6%)
 Frame = +2

Query  911   DLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFAF  1075
             DLVE M YLF++IVKAR L     P         +V     + RP   T   EW+Q FA 
Sbjct  212   DLVEPMQYLFIRIVKARGLAPNESPYVRVRTSTHMVRSKAAVHRPGEPTDSPEWNQVFAL  271

Query  1076  GRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQ  1252
               + PDS SS LEI V D    K            FLGGI F+++++ +RDPPDSPLAPQ
Sbjct  272   AHNRPDSVSSELEIVVLDSPCDK------------FLGGIRFNLADVLVRDPPDSPLAPQ  319

Query  1253  WYRLEG---GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             W  L+G    G   G++ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLWYLR 
Sbjct  320   WCSLDGDQNSGRITGEIQLSVWIGTQADDAFPEAWSSDAPFVAHTRSKVYQSPKLWYLRL  379

Query  1424  SVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDLVFV  1579
             +++EAQD+        LTAP      ++KAQLG Q  +T+  S    S S  WNEDL+FV
Sbjct  380   TIMEAQDLHIPSNLPPLTAPE----IRVKAQLGPQSARTRRGSMNNHSASFHWNEDLIFV  435

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN---E  1750
             A EP  +   L  L+E    K+ A+LG   IP+SSIE+R+D+R V S+WF  E Q    E
Sbjct  436   AGEPLEDS--LILLVEDRTNKDAALLGHVVIPVSSIEQRIDERYVASKWFGLECQGNGLE  493

Query  1751  EKRV--YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
              +R   Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LL
Sbjct  494   CRRSEPYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLL  553

Query  1925  PMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGVFD+
Sbjct  554   PMKAKSGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDN  613

Query  2102  WEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +     E+  D R+GK+RIRISTL + KVY N++ L++L   GLKKMGEIELAVRF  
Sbjct  614   WRMFAGPGEDKPDCRIGKIRIRISTLESNKVYTNSYPLLVLLRTGLKKMGEIELAVRFAC  673

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
              +   +   VY QP+LP MH++RPLG  QQE+LR AA ++++  L+RSEPPL  EVV YM
Sbjct  674   PSLLPETCAVYGQPLLPRMHYLRPLGVAQQEALRGAATRMVSAWLARSEPPLGSEVVRYM  733

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSHS+SMRK +ANWFRI+ V+A ++ + KW+DD R WRNP  T+LVH L ++LVW+P
Sbjct  734   LDADSHSWSMRKSKANWFRIVAVLAWLVGLAKWSDDIRRWRNPVTTVLVHVLYLVLVWYP  793

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DLI+PT   YVF+IG W YRFR +      D ++S A+++D DELDEEFD +P +RP+D+
Sbjct  794   DLIVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQADTVDPDELDEEFDTIPSSRPHDV  852

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             +R RYD+LRML ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C  +  +LY VP 
Sbjct  853   IRVRYDRLRMLAARVQTVLGDFATQGERAQALVSWRDPRATKLFIGVCLAITVVLYAVPP  912

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  913   KMVAVALGFYYLRHPMFREHMPPASLNFFRRLPSLSDRLM  952


 Score = 78.6 bits (192),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = +2

Query  347  LELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGDI  514
            LE++V +DK  G ++    +N+FLGRVKL  TQF ++G+E L+Y+ LE+K++ SWI+G+I
Sbjct  6    LEIEVLNDKRFGNSSGTARKNHFLGRVKLYGTQFSRRGDEGLVYFQLEKKSVFSWIKGEI  65

Query  515  GLKIYFVD  538
            GL+IY+ D
Sbjct  66   GLRIYYYD  73



>ref|XP_010275005.1| PREDICTED: uncharacterized protein LOC104610189 [Nelumbo nucifera]
Length=1027

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/766 (55%), Positives = 547/766 (71%), Gaps = 43/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPA-----RKTLLFEWDQT  1066
             S++DLVE M YLFV+IVKAR+L     P VK+      V S+PA       +   EW Q 
Sbjct  277   SAYDLVEPMQYLFVRIVKARALAPNESPHVKIRTGSHFVRSKPATHKPGEASGNPEWHQV  336

Query  1067  FAFGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             FA G + PDS ++ LEISVWD             A   FLG +CFD+S++P+RDPPDS L
Sbjct  337   FALGHNRPDSGNATLEISVWDG------------ASEAFLGAVCFDLSDVPVRDPPDSSL  384

Query  1244  APQWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKL  1408
             APQWYRLEGG   +     GD+ L+ W+GTQAD++FP++W +D      +RSKVYQSPKL
Sbjct  385   APQWYRLEGGDDQQPNKVSGDIQLSVWIGTQADDTFPESWSSDAPYVSHTRSKVYQSPKL  444

Query  1409  WYLRSSVIEAQDI--FALTAPSKESSFQIKAQLGFQVQKTKPASSA-TGSPSWNEDLVFV  1579
             WYLR +V+EAQD+  F+   P+     ++KAQLGFQ  +++ A+S    S  WNEDLVFV
Sbjct  445   WYLRVTVLEAQDLHLFSNHPPATTLDIRVKAQLGFQSIRSRRATSNHISSFFWNEDLVFV  504

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR  1759
             A EP  +   L  L+E    KE  +LG  ++PLSS+E+R+D+R V S+WF  +  +    
Sbjct  505   AGEPLEDQ--LILLVEDRTSKEPVLLGNVTVPLSSVEQRLDERHVPSKWFVLDGGSSGGH  562

Query  1760  -----------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                        +Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP +G +ELGI+
Sbjct  563   GGAPAGGGGGAIYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAIGILELGIL  622

Query  1907  GCKNLLPMKTM-RGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             G + LLPMKT   GKGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+T
Sbjct  623   GARGLLPMKTKGAGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLT  682

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             IGVFD+W +     E   D  +GKVRIR+STL + KVY N++ L++L  +GLKKMGEIE+
Sbjct  683   IGVFDNWRIFADATEERPDYHIGKVRIRVSTLESNKVYTNSYPLLVLQKSGLKKMGEIEV  742

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF       D   +Y QPMLP MH++RPLG  QQE+LR AA+K++   L+RSEPPL R
Sbjct  743   AMRFACPPLLPDTCAIYGQPMLPRMHYLRPLGVAQQEALRGAAIKMVAAWLARSEPPLGR  802

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLDADSH++SMRK +ANWFRI+ V+A  I + +W DD R W+NP  T+LVH L +
Sbjct  803   EVVRYMLDADSHTWSMRKSKANWFRIMAVLAWAIGLARWVDDIRRWKNPVTTVLVHLLYL  862

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LVW+P+LI+PT   YVF+IG W +RF+ +      D ++S A+++D DELDEE D VP 
Sbjct  863   VLVWYPELIVPTVFLYVFLIGVWYHRFKPKIPAG-MDIRLSQADTVDPDELDEESDPVPS  921

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             T+P D+VRARYD+LR L AR+QT+LGD ATQGER+QALV+WRDPRAT +FIA+C  VA +
Sbjct  922   TKPPDIVRARYDRLRTLAARIQTVLGDFATQGERLQALVSWRDPRATRLFIAVCLAVAVV  981

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+VP KM+A+A GFY+LRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  982   LYVVPPKMVAVALGFYFLRHPMFREPMPPASLNFFRRLPSLSDRLM  1027


 Score =   162 bits (409),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T R L+VEV++AR+L PKDG G+SSPYV+ DF GQRK+T T  RDLNP WNE LEF ++ 
Sbjct  14   TVRNLVVEVVDARDLAPKDGQGSSSPYVIADFDGQRKRTSTKFRDLNPIWNEKLEFIVTD  73

Query  323  HSDIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
               +  + LE++V++DK +G  +    RN+FLGRVKL  +QF KKG E LIY+PLE+K++
Sbjct  74   PKTMEAEELEIEVFNDKKMGKGSGSARRNHFLGRVKLYGSQFSKKGNEGLIYFPLEKKSV  133

Query  491  LSWIQGDIGLKIYFVD  538
             SW++G+IGL+IY+ D
Sbjct  134  FSWVKGEIGLRIYYYD  149



>ref|XP_006439651.1| hypothetical protein CICLE_v10018651mg [Citrus clementina]
 gb|ESR52891.1| hypothetical protein CICLE_v10018651mg [Citrus clementina]
Length=1031

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/762 (56%), Positives = 539/762 (71%), Gaps = 45/762 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF-----EWDQTFA  1072
             +DLVE M YLFV+I KAR L     P VK+  S  +  S+ A           EW+Q FA
Sbjct  289   YDLVEPMMYLFVKIRKARGLVPNEAPYVKIRTSSHYRKSKLASYRACDPHDSPEWNQVFA  348

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                +  DS S+ LEI+VWD        PT      NFLGG+CFD+S++P+RDPPDSPLAP
Sbjct  349   LFHNKNDSVSATLEITVWD-------SPT-----ENFLGGVCFDLSDVPVRDPPDSPLAP  396

Query  1250  QWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             QWYRLEG  + +     GD+ LA W+GTQADE+FP+AW +D      +RSKVYQSPKLWY
Sbjct  397   QWYRLEGEASDQNNRVSGDIQLAVWIGTQADEAFPEAWSSDAPYVTHTRSKVYQSPKLWY  456

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDL  1570
             LR +V+EAQD+        LTAP      ++KAQL  Q  +T+  S    S S  W+ED+
Sbjct  457   LRVTVMEAQDLCIAHNLPPLTAPE----IRVKAQLALQSARTRRGSMNNHSSSFHWHEDV  512

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQA--VLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
              FVAAEPF +   L  L+E    K+ A  +LG A +P+SSI++R+D+R V S+WF  E  
Sbjct  513   FFVAAEPFEDS--LILLVEDRTAKDAAAVILGHAVVPVSSIDQRIDERHVASKWFPLEGS  570

Query  1745  NEE--KRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                   R Y GR+ L+LC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGI+G + 
Sbjct  571   CGRGCARSYCGRIQLKLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGILELGILGARG  630

Query  1919  LLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+T+GVF
Sbjct  631   LLPMKTKNGGKGSTDAYCVAKYGKKWVRTRTITDCFDPRWNEQYTWQVYDPCTVLTVGVF  690

Query  2096  DSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             D+W +     E   D R+GK+RIR+STL   KVY  ++ L++L   GLKKMGEIELAVRF
Sbjct  691   DNWRMFADASEERPDYRIGKIRIRVSTLENNKVYTTSYPLLVLLRTGLKKMGEIELAVRF  750

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
             +  +   +   VY QP+LP MH++RPLG  QQE+LR AA K++   L RSEPPL  EVV 
Sbjct  751   VCPSMLPETSSVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAAWLDRSEPPLGPEVVR  810

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH++SMRK +ANWFRI+ V+A  I + KW  + R W+NP  T+LVH L ++LVW
Sbjct  811   YMLDADSHAWSMRKSKANWFRIVAVLAWAIGLAKWLHNIRRWKNPVTTVLVHVLYLVLVW  870

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +PDLI+PT   YV +IG W YRFR +   +  DT++S AE++D DELDEEFD +P ++P 
Sbjct  871   YPDLIVPTGFLYVVLIGVWYYRFRPKIP-SGMDTRLSQAETVDPDELDEEFDTIPSSKPP  929

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             +++R RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C V+  +LY+V
Sbjct  930   EIIRMRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCTVITLVLYVV  989

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P KM+A+A GFYYLRHP+FRD MP  +LNFFRRLPSL+DR++
Sbjct  990   PPKMVAVALGFYYLRHPMFRDPMPPASLNFFRRLPSLSDRLM  1031


 Score =   164 bits (415),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV++AR+LLPKDG G+SSPYV+ DF GQRK+T T  RDLNP WNE LEF +S 
Sbjct  14   TVRKLVVEVVDARDLLPKDGQGSSSPYVIADFDGQRKRTSTKFRDLNPVWNEPLEFIVSD  73

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK    G   +N+FLGRVKL  +QF ++G+E L+Y+PLE+K++ S
Sbjct  74   PKNMDCEELEIEVYNDKRYCNGSGRKNHFLGRVKLCGSQFARRGDEGLVYFPLEKKSVFS  133

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  134  WIRGEIGLRIYYYD  147



>ref|XP_007211180.1| hypothetical protein PRUPE_ppa000632mg [Prunus persica]
 gb|EMJ12379.1| hypothetical protein PRUPE_ppa000632mg [Prunus persica]
Length=1060

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/760 (55%), Positives = 532/760 (70%), Gaps = 44/760 (6%)
 Frame = +2

Query  911   DLVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFAF  1075
             DLVE M YLF++IVKAR L     P         +V     + RP   T   EW+Q FA 
Sbjct  320   DLVEPMQYLFIRIVKARGLAPNESPYVRVRTSTHMVRSKPAVHRPGEPTDSPEWNQVFAL  379

Query  1076  GRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQ  1252
               + PDS +S LEI V D  S K            FLGGI F+++++ +RDPPDSPLAPQ
Sbjct  380   AHNRPDSVNSELEIVVLDLPSDK------------FLGGIRFNLADVLVRDPPDSPLAPQ  427

Query  1253  WYRLEG---GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             W  L+G    G   G++ L+ W+GTQAD++FP+AW +D      +RSKVYQSPKLWYLR 
Sbjct  428   WCSLDGDQNSGRITGEIQLSVWIGTQADDAFPEAWSSDAPFVAHTRSKVYQSPKLWYLRL  487

Query  1424  SVIEAQDIFA------LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDLVFV  1579
             +++EAQD+        LTAP      ++KAQLG Q  +T+  S    S S  WNEDL+FV
Sbjct  488   TIMEAQDLHIPSNLPPLTAPE----IRVKAQLGPQSARTRRGSMNNHSASFHWNEDLIFV  543

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR  1759
             A EP  +   L  ++E    K+ A+LG   IP+SSIE+R+D+R V S+WF  E Q  E  
Sbjct  544   AGEPLEDS--LILIVEDRTNKDAAILGHVVIPVSSIEQRIDERYVASKWFGLECQGNELE  601

Query  1760  V-----YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + LL
Sbjct  602   CRRTEPYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARGLL  661

Query  1925  PMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             PMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGVFD+
Sbjct  662   PMKAKSGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDN  721

Query  2102  WEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             W +     E+  D R+GK+RIRISTL + KVY N++ L++L   GLKKMGEIELAVRF  
Sbjct  722   WRMFAGVGEDKPDCRIGKIRIRISTLESNKVYTNSYPLLVLLRTGLKKMGEIELAVRFAC  781

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
              +   +   VY QP+LP MH++RPLG  QQE+LR AA ++++  L RSEPPL  EVV YM
Sbjct  782   PSLLPETCAVYGQPLLPRMHYLRPLGVAQQEALRGAATRMVSAWLGRSEPPLGSEVVRYM  841

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LDADSHS+SMRK +ANWFRI+ V+A ++ + KW+DD R WRNP  T+LVH L ++LVW+P
Sbjct  842   LDADSHSWSMRKSKANWFRIVAVLAWLVGLAKWSDDIRRWRNPVTTVLVHVLYLVLVWYP  901

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             DLI+PT   YVF+IG W YRFR +      D ++S A+++D DELDEEFD +P +RP D+
Sbjct  902   DLIVPTGFLYVFLIGVWYYRFRPKIPAG-MDIRLSQADTVDPDELDEEFDTIPSSRPPDV  960

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             +R RYD+LRML ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C  +  +LY VP 
Sbjct  961   IRVRYDRLRMLAARVQTVLGDFATQGERAQALVSWRDPRATKLFIGVCLAITVVLYAVPP  1020

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             KM+A+A GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  1021  KMVAVALGFYYLRHPMFREHMPPASLNFFRRLPSLSDRLM  1060


 Score =   156 bits (394),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKLIVEV++AR+LLPKDG G+SSPYVV DF GQRK+T T  + LNP WNE LEF +S 
Sbjct  48   TVRKLIVEVVDARDLLPKDGQGSSSPYVVADFDGQRKRTSTKYKSLNPAWNEALEFVVSD  107

Query  323  HSDIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
               +  + LE++V +DK  G ++    +N+FLGRVKL  TQF ++G+E L+Y+ LE+K++
Sbjct  108  PDHMEYEELEIEVLNDKRFGNSSGTARKNHFLGRVKLYGTQFSRRGDEGLVYFQLEKKSV  167

Query  491  LSWIQGDIGLKIYFVD  538
             SWI+G+IGL+IY+ D
Sbjct  168  FSWIKGEIGLRIYYYD  183



>ref|XP_008656618.1| PREDICTED: uncharacterized protein LOC103636036 [Zea mays]
 gb|AFW83105.1| hypothetical protein ZEAMMB73_233265 [Zea mays]
Length=1084

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/765 (53%), Positives = 547/765 (72%), Gaps = 40/765 (5%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQ  1063
             ++ SS+DLVE M YLFV++V+ R +     P VKV      + SRP R    T   EW+Q
Sbjct  336   VQSSSYDLVEPMRYLFVRVVRVRGIRACEGPYVKVQAGPHSLRSRPGRDVSGTGNPEWNQ  395

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              FA     P+ +  LEISVWD  +    +         FLGG+CFD+S++P+RD PD PL
Sbjct  396   VFAISNAKPEPT--LEISVWDGGAPSPAE--------AFLGGVCFDLSDVPVRDQPDGPL  445

Query  1244  APQWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYL  1417
             APQWYRLEGG  G   GD+M+A W+GTQADE+FP+AW TD      +RSKVYQSPKLWYL
Sbjct  446   APQWYRLEGGEPGMVTGDIMVAVWIGTQADEAFPEAWNTDAPYAAYTRSKVYQSPKLWYL  505

Query  1418  RSSVIEAQDIFALTAPSKESSF--QIKAQLGFQVQKTK--PASSATGSPSWNEDLVFVAA  1585
             R+S+IEAQD+  + AP     F  ++K QLGFQ  +T+   ASS+  + +W+EDL+FVA+
Sbjct  506   RASIIEAQDL-RVPAPPPGLPFDVRVKIQLGFQSARTRRSVASSSGSAFAWSEDLMFVAS  564

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVIS-RWFTFEDQNE----  1750
             EP  ++ L+  + +    KE A+LG A+IP++S+E+R+D+RQ+++ RWF  E        
Sbjct  565   EPLDDN-LIVLVEDRSMIKEPALLGHATIPVTSVEQRLDERQIVAPRWFNLEGGTSGIGM  623

Query  1751  -------EKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                        Y GR+HLRLC +GGYHV++EAAH+CSDYRPTA+QLWKPPVG +ELGIIG
Sbjct  624   PHGYDGGPPAFYSGRLHLRLCLEGGYHVLDEAAHVCSDYRPTAKQLWKPPVGVLELGIIG  683

Query  1910  CKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D+L PRWNEQYTW+VYDP TV+T+
Sbjct  684   ACGLLPMKTKGGAKGSTDAYCVAKYGKKWVRTRTITDSLNPRWNEQYTWQVYDPCTVLTV  743

Query  2087  GVFDSWEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
              VFD+W +     +  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE++LA
Sbjct  744   AVFDNWRMFAGAGDERQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEVQLA  803

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF       D    Y+ P+LP MH++RP+G  QQE+LR AAV+ + T L+RSEPPL  E
Sbjct  804   VRFSSPAQLPDTWATYTTPLLPRMHYLRPIGVAQQEALRGAAVRTVATWLARSEPPLGPE  863

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YMLDA++H++S+R+ +ANWFRI+ V+A  + + +W D  + WRNP+ T+LVHAL ++
Sbjct  864   VVKYMLDANAHTWSVRRAKANWFRIMGVLAWAVGLARWLDGVQRWRNPSTTVLVHALYLV  923

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LVW+P+L++PT + YVFMIG W YRFR R  +   D ++S A+++D DEL+EEFD VP  
Sbjct  924   LVWYPELVVPTASLYVFMIGVWYYRFRPRAPVG-MDARLSQADTVDGDELEEEFDPVP--  980

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
              P +++R RY++LR L  RVQ ++GD+A QGER+QALV+WRDPRA+ IF+ +C  VA  L
Sbjct  981   -PPEVLRLRYERLRTLAGRVQRVMGDVAAQGERLQALVSWRDPRASRIFVGVCLAVAVAL  1039

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y +P KM+A+A GFYYLRHP+FRD MP PA+NFFRRLPSL+DR+L
Sbjct  1040  YAMPPKMVAVASGFYYLRHPMFRDPMPPPAVNFFRRLPSLSDRLL  1084


 Score =   155 bits (391),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 104/134 (78%), Gaps = 6/134 (4%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            R+L VEV++AR+L+PKDG G SS + V+DF GQRK+TRTV RDL+PQW+E LEF +   +
Sbjct  19   RRLAVEVVDARDLVPKDGLGTSSAFAVVDFDGQRKRTRTVPRDLSPQWHERLEFAVHDPA  78

Query  329  DIFGDMLELDVYHDKNVGP------TTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
            ++  + L++ +YHD+   P      + +N+FLGRV++  +QF ++GEE ++Y+PLE+++L
Sbjct  79   NMHAEALDVSLYHDRRFNPSGGGGGSGKNHFLGRVRIYGSQFSRRGEEGIVYFPLEKRSL  138

Query  491  LSWIQGDIGLKIYF  532
            LSWI+G++GLKIY+
Sbjct  139  LSWIRGEVGLKIYY  152



>ref|XP_008374521.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Malus domestica]
Length=1068

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/762 (54%), Positives = 527/762 (69%), Gaps = 43/762 (6%)
 Frame = +2

Query  914   LVEKMHYLFVQIVKARSLPTAGRP-----vvkvvvsgshvisRPARKTLLFEWDQTFAFG  1078
             LVE M YLF++IVKAR L     P         VV     + RP   T   EW+Q FA  
Sbjct  322   LVEPMQYLFIRIVKARGLAPNENPYVKVRTSAHVVRSKVAVHRPCEPTDSPEWNQVFALA  381

Query  1079  RDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQW  1255
              + P+S+ S L+ISV D  S +            FLGGICFD+SE+P+RDPPDSPLAPQW
Sbjct  382   HNRPESAGSELQISVHDSPSEQ------------FLGGICFDMSEVPVRDPPDSPLAPQW  429

Query  1256  YRLE--GGGAH----KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYL  1417
             +RL+   G  H     GD+ L+ W GTQAD++F DAW +D      +RSKVYQSPKLWYL
Sbjct  430   WRLDSSAGDQHPGRVSGDIQLSVWFGTQADDAFQDAWSSDAPFVAHTRSKVYQSPKLWYL  489

Query  1418  RSSVIEAQDIFALT--APSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWNEDLVFVAA  1585
             R++V+E QD+   +   P      ++KAQLG Q  +T+  S  +   S  WNEDL+FVA 
Sbjct  490   RTTVMEVQDLHIPSNLPPLTTPEIRVKAQLGSQSARTRRGSMNNHCASFHWNEDLIFVAG  549

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKR--  1759
             EP  +   L  L+E    K+ A+LG   IP+SSIE+R+DDR V S+W   E         
Sbjct  550   EPLEDS--LILLVEDRTNKDAALLGHVQIPVSSIEQRIDDRYVASKWLPLECGGGGAAPH  607

Query  1760  -------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                     Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + 
Sbjct  608   CVSGGDGSYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGILGARG  667

Query  1919  LLPMKTMR-GKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMK    GKGSTDAY VAKYG KWVRTRT+ D+  PRWNEQYTW+VYDP TV+TIGVF
Sbjct  668   LLPMKAKSXGKGSTDAYCVAKYGKKWVRTRTVMDSFDPRWNEQYTWQVYDPCTVLTIGVF  727

Query  2096  DSWEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             D+W +     E+  D  +GKVRIRIST+ + KVY N++ L++L   GLKKMGEIELAVRF
Sbjct  728   DNWRMFAAAGEDRPDYSIGKVRIRISTMESNKVYTNSYPLLVLLRTGLKKMGEIELAVRF  787

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
                +   +   VY QP+LP MH++RPLG  QQE+LR AA +++   L+RSEPPL +EVV 
Sbjct  788   ACPSLLPETCAVYGQPLLPRMHYLRPLGVAQQEALRGAATRMVAAWLARSEPPLGQEVVR  847

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH++SMRK +ANWFRI+ V+A V+ + KW D+ R WRNP  T+LVH L ++LVW
Sbjct  848   YMLDADSHAWSMRKSKANWFRIVAVLAWVVGLAKWLDNIRRWRNPVTTVLVHVLYLVLVW  907

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +PDLI+PT   YVF+IG W YRFR +      D ++S A+S+D DELDEEFD +P +RP 
Sbjct  908   YPDLIVPTGFLYVFLIGVWYYRFRPKSPAG-MDIRLSQADSVDPDELDEEFDTIPSSRPP  966

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             D++R RYD+LRML ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C  +  +LY V
Sbjct  967   DIIRVRYDRLRMLAARVQTVLGDFATQGERAQALVSWRDPRATKLFIGVCLAITVVLYAV  1026

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P KM+A+A GFYYLRHP+FR+ MP  +LNFFRRLPSL+DR++
Sbjct  1027  PPKMVAVALGFYYLRHPMFREPMPPASLNFFRRLPSLSDRLM  1068


 Score =   152 bits (385),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKLIVE  +AR+LLPKDG G+SSPYVV DF GQRK+T T  + LNP WNE LEF +S   
Sbjct  45   RKLIVEXXDARDLLPKDGQGSSSPYVVADFDGQRKRTSTKFKSLNPVWNEPLEFIVSDPD  104

Query  329  DIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             +  + LE++V +DK  G ++    +N+FLGRVKL  TQF K+G+E L+Y+ LE+K++ S
Sbjct  105  HMEYEELEIEVLNDKRFGTSSGSARKNHFLGRVKLYGTQFSKRGDEGLVYFQLEKKSVFS  164

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  165  WIRGEIGLRIYYYD  178



>ref|XP_002458061.1| hypothetical protein SORBIDRAFT_03g026320 [Sorghum bicolor]
 gb|EES03181.1| hypothetical protein SORBIDRAFT_03g026320 [Sorghum bicolor]
Length=1081

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/768 (53%), Positives = 547/768 (71%), Gaps = 43/768 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQ  1063
             ++ SS+DLVE M YLFV++V+ R +     P VKV      + SRP R    T   EW+Q
Sbjct  330   VQSSSYDLVEPMRYLFVRVVRVRGIRACEGPYVKVQAGPHSLRSRPGRDVSGTGNPEWNQ  389

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              FA     P+ +  LEISVWD  +    +         FLGG+CFD+S++P+RD PD PL
Sbjct  390   VFAISHARPEPT--LEISVWDGGAPSPAE--------AFLGGVCFDLSDVPVRDQPDGPL  439

Query  1244  APQWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYL  1417
             APQWYRLEGG  G   GD+M+A W+GTQAD++FP+AW TD      +RSKVYQSPKLWYL
Sbjct  440   APQWYRLEGGEPGMVTGDIMVAVWIGTQADDAFPEAWNTDAPYAAYTRSKVYQSPKLWYL  499

Query  1418  RSSVIEAQDIFALTAPSKESSF--QIKAQLGFQVQKTK--PASSATGSPSWNEDLVFVAA  1585
             R+SVIEAQD+  + AP     F  ++K QLGFQ  +T+   ASS+  + +W+EDL+FVA+
Sbjct  500   RASVIEAQDL-RVPAPPPGLPFDVRVKIQLGFQSARTRRSVASSSGSAFAWSEDLMFVAS  558

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFE--------  1738
             EP  +  L+  + +    KE A+LG A+IP+++IE+R+D+RQ++ SRWFT E        
Sbjct  559   EPLDDS-LIVLVEDRSMIKEPALLGHATIPVTTIEQRLDERQIVASRWFTLEGGTSGIGM  617

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 +       Y GR+HLRLC +GGYHV++EAAH+CSDYRPTA+QLWKPPVG +ELGII
Sbjct  618   MPPGNAGGPPAFYSGRLHLRLCLEGGYHVLDEAAHVCSDYRPTAKQLWKPPVGVLELGII  677

Query  1907  GCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             G   LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D+L PRWNEQYTW+VYDP TV+T
Sbjct  678   GACGLLPMKTKGGAKGSTDAYCVAKYGKKWVRTRTITDSLNPRWNEQYTWQVYDPCTVLT  737

Query  2084  IGVFDSWEVIDP----ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             + VFD+W +       +  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE+
Sbjct  738   VAVFDNWRMFAGPGAGDERQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEV  797

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
             +LAVRF       D    Y+ P+LP MH++RP+G  QQE+LR AAV+ + T L+RSEPPL
Sbjct  798   QLAVRFSSPAQLPDTWATYTTPLLPRMHYLRPIGVAQQEALRGAAVRTVATWLARSEPPL  857

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
               EVV YMLDAD+H++S+R+ +ANWFRI+ V+A  + + +W D  + WRNP+ T+LVHAL
Sbjct  858   GPEVVKYMLDADAHTWSVRRAKANWFRIMGVLAWAVGLARWLDGVQRWRNPSTTVLVHAL  917

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
              ++LVW+P+L++PT + YVFMIG W YRFR R      D ++S A+++D DEL+EEFD V
Sbjct  918   YLVLVWYPELVVPTASLYVFMIGVWYYRFRPRGPAG-MDARLSQADTVDGDELEEEFDPV  976

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P   P +++R RY++LR L  RVQ ++GD+A QGER+QALV+WRDPRA+ IF+ + F VA
Sbjct  977   P---PPEVLRLRYERLRTLAGRVQRVMGDVAAQGERLQALVSWRDPRASRIFVGVSFAVA  1033

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               LY +P KM+A+A GFYYLRHP+FRD MP PA+NFFRRLPSL+DR+L
Sbjct  1034  VALYAMPPKMVAVASGFYYLRHPMFRDPMPPPAVNFFRRLPSLSDRLL  1081


 Score =   155 bits (391),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 103/137 (75%), Gaps = 7/137 (5%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            R+L VEV++AR+L+PKDG G SS + V+DF GQRK+TRTV RDL+PQW+E LEF +    
Sbjct  20   RRLAVEVVDARDLVPKDGLGTSSAFAVVDFDGQRKRTRTVPRDLSPQWHERLEFVVHDPP  79

Query  329  DIFGDMLELDVYHDKNVGPTT-------RNNFLGRVKLNATQFVKKGEEALIYYPLERKN  487
            ++  + L++ +YHD+   P+        +N+FLGRV +  +QF ++GEE ++Y+PLE+++
Sbjct  80   NMHAEALDISLYHDRRFNPSGGGGGGSRKNHFLGRVHIYGSQFSRRGEEGIVYFPLEKRS  139

Query  488  LLSWIQGDIGLKIYFVD  538
            L+SWI+G+IGLKIY+ D
Sbjct  140  LISWIRGEIGLKIYYYD  156



>ref|XP_009369348.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Pyrus x bretschneideri]
Length=1083

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/766 (55%), Positives = 530/766 (69%), Gaps = 50/766 (7%)
 Frame = +2

Query  911   DLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF-----EWDQTFAF  1075
             DLVE M YLF++IVKAR L     P V+V  S   V S+ A           EW+Q FA 
Sbjct  337   DLVEPMQYLFIRIVKARGLAPNENPYVRVRTSAHVVRSKVAVHRQCEPIDSPEWNQVFAL  396

Query  1076  GRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQ  1252
               + P+S+ S L+IS+             D     FLGGICFD+SE+P+RDPPDSPLAPQ
Sbjct  397   PHNRPESAGSELQISI------------HDWPSEQFLGGICFDMSEVPVRDPPDSPLAPQ  444

Query  1253  WYRLE--GGGAH----KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             W+RL+   G  H     GD+ L+ W GTQAD++FP+AW +D      +RSKVYQSPKLWY
Sbjct  445   WWRLDSSAGDQHPGRVSGDIQLSVWFGTQADDAFPEAWSSDAPFVAHTRSKVYQSPKLWY  504

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWNEDL  1570
             LR++V+E QD+        LTAP      ++KAQLG Q  +T+  S  +   S  WNEDL
Sbjct  505   LRTTVMEVQDLHIPSNLPPLTAPE----IRVKAQLGSQSARTRRGSMNNHCASFHWNEDL  560

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNE  1750
             +FVAAEP  +   L  L+E    K+ A+LG   IP+SSIE+R+DDR V S+W   E    
Sbjct  561   IFVAAEPLEDS--LILLVEDRTNKDAALLGHVQIPVSSIEQRIDDRYVASKWLPLECGGG  618

Query  1751  EKRV--------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                         Y GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+
Sbjct  619   GGGPCVSGGDGSYCGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGILELGIL  678

Query  1907  GCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             G + LLPMK   G KGSTDAY VAKYG KWVRTRT+ D+  PRWNEQYTW+VYDP TV+T
Sbjct  679   GARGLLPMKAKSGGKGSTDAYCVAKYGRKWVRTRTVMDSFDPRWNEQYTWQVYDPCTVLT  738

Query  2084  IGVFDSWEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             IGVFD+W +     E   D  +GKVRIRIST+ + KVY N++ L++L   GLKKMGEIEL
Sbjct  739   IGVFDNWRMFAAAGEEKPDYSIGKVRIRISTMESNKVYTNSYPLLVLLRTGLKKMGEIEL  798

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             AVRF   +   +   VY QP+LP MH++RPLG  QQE+LR AA +++   L+RSEPPL +
Sbjct  799   AVRFACPSLLPETCAVYGQPLLPRMHYLRPLGVAQQEALRGAATRMVAAWLARSEPPLGQ  858

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLDADSH++SMRK +ANWFRI+ V+A V+ + KW D  R WRNP  T+LVH L +
Sbjct  859   EVVRYMLDADSHAWSMRKSKANWFRIVAVLAWVVGLAKWLDSIRRWRNPVTTVLVHVLYL  918

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LVW+PDLI+PT   YVF+IG W YRFR +      D ++S A+S+D DELDEEFD +P 
Sbjct  919   VLVWYPDLIVPTGFLYVFLIGVWYYRFRPKSPAG-MDIRLSQADSVDPDELDEEFDTIPS  977

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +RP+D++R RYD+LRML ARVQT+LGD ATQGER QALV+WRDPRAT +FI +C  +  +
Sbjct  978   SRPSDIIRDRYDRLRMLAARVQTVLGDFATQGERAQALVSWRDPRATKLFIGVCLAITVV  1037

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY VP KM+A+A GFYYLRHP+FR+ MP   LNFFRRLPSL+DR++
Sbjct  1038  LYAVPPKMVAVALGFYYLRHPMFREPMPPAGLNFFRRLPSLSDRLM  1083


 Score =   155 bits (393),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 4/134 (3%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKLIVEV++AR+LLPKDG G+SSPYVV DF GQRK+T T  + LNP WNE LEF +S   
Sbjct  61   RKLIVEVVDARDLLPKDGQGSSSPYVVADFDGQRKRTSTKFKSLNPVWNEPLEFIVSDPD  120

Query  329  DIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
             +  + LE++V +DK  G ++    +N+FLGRVKL  TQF K+G+E L+Y+ LE+K++ S
Sbjct  121  HMEYEELEIEVLNDKRFGTSSGSARKNHFLGRVKLYGTQFSKRGDEGLVYFQLEKKSVFS  180

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  181  WIRGEIGLRIYYYD  194



>ref|XP_004969388.1| PREDICTED: uncharacterized protein LOC101753534 [Setaria italica]
Length=1055

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/758 (54%), Positives = 546/758 (72%), Gaps = 33/758 (4%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQ  1063
             ++ +S+DLVE M YLFV++V+ R +     P VKV      + SRP R    T   EW+Q
Sbjct  314   VQSASYDLVEPMRYLFVRVVRVRGIRACEGPYVKVQAGPHSLRSRPGRDVSGTGNPEWNQ  373

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              FA     P+ +  LEISVWD  +    +         FLGG+CFD+S++P+RD PD PL
Sbjct  374   VFAISHARPEPT--LEISVWDGGAPSPAE--------AFLGGVCFDLSDVPVRDQPDGPL  423

Query  1244  APQWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYL  1417
             APQWYRLEGG  G   GD+M+A W+GTQAD++FP+AW TD      +RSKVYQSPKLWYL
Sbjct  424   APQWYRLEGGEPGMVTGDIMVAVWIGTQADDAFPEAWNTDAPYAAYTRSKVYQSPKLWYL  483

Query  1418  RSSVIEAQDIFALTAPSKESSF--QIKAQLGFQVQKTK-PASSATGSP-SWNEDLVFVAA  1585
             R+SVIEAQD+  + AP     F  ++K QLGFQ  +T+   +S+TGS  +W+EDL+FVA+
Sbjct  484   RASVIEAQDL-RVPAPPPGLPFDVRVKVQLGFQSARTRRSVASSTGSAFAWSEDLMFVAS  542

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFEDQNEEKRV  1762
             EP  +  L+  + +    KE A+LG A+IP++SIE+R+D+RQ++ SRWF  E  ++    
Sbjct  543   EPLDDT-LVVLVEDRSMIKEPALLGHATIPVASIEQRLDERQIVASRWFNLEGGSDGGGP  601

Query  1763  YKG----RVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPM  1930
               G    R+HLRLC +GGYHV++EAAH+CSDYRPTA+QLWKPPVG +ELGII   +LLPM
Sbjct  602   PGGFYSGRLHLRLCLEGGYHVLDEAAHVCSDYRPTAKQLWKPPVGVLELGIIDACSLLPM  661

Query  1931  KTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             KT  G KG TDAY VAKYG KWVRTRT++D+L PRWNEQYTW+VYDP TV+T+ VFD+W 
Sbjct  662   KTKGGAKGCTDAYCVAKYGKKWVRTRTVTDSLNPRWNEQYTWQVYDPCTVLTVAVFDNWR  721

Query  2108  VIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
             +     ++ +D R+GKVR+R+STL + +VY  ++ L++L  +GLKKMGE+ LAVR     
Sbjct  722   MFAGAGDDRQDYRVGKVRVRVSTLESNRVYTASYPLLVLLRSGLKKMGEVRLAVRLSSPA  781

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
                D    Y+ P+LP MH++RP+G  QQE+LR AAV+ + T L+RSEPPL  EVV YMLD
Sbjct  782   ALPDTWVTYTSPLLPRMHYLRPIGVAQQEALRGAAVRTVATWLARSEPPLGPEVVKYMLD  841

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
             AD+H++S+R+ +ANWFRI+ V+A  + + +W D  + WRNP+ T+LVHAL ++LVW+P+L
Sbjct  842   ADAHTWSVRRAKANWFRIMGVLAWAVGLARWLDGVKRWRNPSTTVLVHALYLVLVWYPEL  901

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             ++PT + YVFMIG W YRFR R      D ++S A+++D DEL+EEFD VP   P D++R
Sbjct  902   VVPTASLYVFMIGVWYYRFRPRGPAG-MDARLSQADTVDGDELEEEFDPVP---PPDVLR  957

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RY++LR L  RVQ ++GD+A QGER+QALV+WRDPRA+ IF+ +C  VA  LY +P KM
Sbjct  958   LRYERLRTLAGRVQRVMGDVAAQGERLQALVSWRDPRASRIFVGVCLAVAVALYAMPPKM  1017

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A+A GFYYLRHP+FRD MP PA+NFFRRLPSL+DR+L
Sbjct  1018  VAVASGFYYLRHPMFRDPMPPPAVNFFRRLPSLSDRLL  1055


 Score =   159 bits (401),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            R+L VEV++AR+L+PKDG G SS + V+DF GQRK+TRTV RDLNPQW+E LEF +   +
Sbjct  3    RRLAVEVVDARDLVPKDGLGTSSAFAVVDFDGQRKRTRTVPRDLNPQWHERLEFAVHDPA  62

Query  329  DIFGDMLELDVYHDKNVGPT----TRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            ++  + L++ +YHD+   P+     +N FLGRV++  +QF ++G+E ++Y+PLE+++LLS
Sbjct  63   NMHAEALDVSLYHDRRFNPSGGGGGKNQFLGRVRIYGSQFSRRGQEGIVYFPLEKRSLLS  122

Query  497  WIQGDIGLKIYFVD  538
            WI+G++GLKIY+ D
Sbjct  123  WIRGEVGLKIYYYD  136



>gb|EAZ38802.1| hypothetical protein OsJ_23205 [Oryza sativa Japonica Group]
Length=1038

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/774 (54%), Positives = 537/774 (69%), Gaps = 45/774 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFGR  1081
             S  DLV+KM YLFV++V+AR LP    P V+V   G H  +R AR+   FEWDQTFAF R
Sbjct  274   SKHDLVDKMPYLFVRVVRARGLPAGAHPHVRVAAGGRHASTREARRGAFFEWDQTFAFVR  333

Query  1082  D--APDSSS-ILEISVWDPLSSKSLDPTSDVAG---HNFLGGICFDVSEIPLRDPPDSPL  1243
             D  A DS    LE+SVWD      L P +DV+     +FLGG+CFD +++  RDPPD PL
Sbjct  334   DPGATDSPGPTLEVSVWD------LPPDADVSDADDRHFLGGLCFDTADVHARDPPDGPL  387

Query  1244  APQWYRLEGGGAHKG-DLMLATWVGTQADESFPDAWKTDTAGNPTSRS-----KVYQSPK  1405
             A QWYRLEGG    G DLM+ATW GTQADE+F DAWK D+  +  + +     KVY SPK
Sbjct  388   ATQWYRLEGGRRLAGADLMVATWAGTQADEAFADAWKADSPASSVAAAAASRAKVYVSPK  447

Query  1406  LWYLRSSVIEAQDIFALTAPS-KESSFQIKAQLGFQVQKTKPASSA-TGSPSWNEDLVFV  1579
             LW LR +VIEAQD   LTAP  +++   ++  LGFQ  KT+ A  A  G PSWNEDL+FV
Sbjct  448   LWLLRLTVIEAQDT--LTAPPPRDAGIAVRGTLGFQSLKTRTAPVARNGGPSWNEDLLFV  505

Query  1580  AAEPFTE-HYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEK  1756
             AAEP  +    L   +E    K+   +G ASI L++IERRVDDR+V S+W      +E  
Sbjct  506   AAEPHADGDDCLVISLEVRHGKDAFPVGSASISLATIERRVDDRKVASKWIDLLPSDEAM  565

Query  1757  R---------VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
             +         ++ GR+H+R+C DGGYHV +E  +  SD+RP+ARQLW+PP+G VELGI+G
Sbjct  566   KKVGKKAAMHMHGGRLHVRVCLDGGYHVADEQPYASSDFRPSARQLWRPPIGVVELGIVG  625

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
             CK LLPM+T  GKG TDAYAVAKYG KW RTRTISD+  P WNEQYTW VYDP TV+T+G
Sbjct  626   CKGLLPMRTADGKGCTDAYAVAKYGPKWARTRTISDSFDPAWNEQYTWPVYDPCTVLTVG  685

Query  2090  VFDSWEVID----PENSKDVR-----MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKM  2242
             VFD          P+ +KD       MGKVRIR+STL +G+VYR  + LI++ P G K+M
Sbjct  686   VFDDPPPPSPSQLPDGAKDAAAFSRPMGKVRIRLSTLESGRVYRGVYPLIMMLPTGAKRM  745

Query  2243  GEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLL--TTHLSR  2416
             G++ELA+RF  S   LD LH+Y +P LP MHH+RP+ A  +++LR +A ++        R
Sbjct  746   GDVELAIRFAASASALDVLHMYGRPALPPMHHLRPIPAASRDALRLSAARISGGAPGAGR  805

Query  2417  SEPPLRREVVAYMLDA-DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTAT  2593
             S PPLRRE   +MLDA +   FSMRK+RANW R +  ++ V D  +WA+DTR+WRN TAT
Sbjct  806   S-PPLRREAATWMLDAAEPRGFSMRKLRANWTRAVAALSWVSDAARWAEDTRSWRNLTAT  864

Query  2594  ILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELD  2773
              L HA+LVLL W PDL++PT   +V  +G W YR R R    H   + S+AE+ DR+ELD
Sbjct  865   ALAHAVLVLLAWHPDLVVPTLTLHVAAVGVWKYRRRPRAPAPHPCVRASMAEAADREELD  924

Query  2774  EEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIA  2953
             EEFDA+P +RP ++VRARYD+ RM+GAR+Q ++GD+ATQ ER+QALV+WRDPRATG+F+A
Sbjct  925   EEFDAIPSSRPPEVVRARYDRARMVGARLQAMVGDVATQAERLQALVSWRDPRATGVFVA  984

Query  2954  LCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LC  VA  LY+VP K++A+  GFYYLRHP+FRDRMP+PA+NFFRRLPS+++R++
Sbjct  985   LCVFVAMALYVVPIKVVAVVAGFYYLRHPMFRDRMPAPAINFFRRLPSMSERIM  1038


 Score =   172 bits (436),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV+EARNLLPKDG G SSPY  +DF GQR+KT TV R+LNP WNE LEFN + 
Sbjct  6    TVRKLVVEVVEARNLLPKDGTGTSSPYARVDFDGQRRKTHTVPRELNPAWNEALEFNFAG  65

Query  323  HSDIFG---DMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
             +       + LE+ V HD  VGP+ R+NFLGRV+L+A QFV+KGEEALIY+PLE+K   
Sbjct  66   VAGDVVVGGEPLEVAVLHDVRVGPSRRSNFLGRVRLDARQFVRKGEEALIYFPLEKKGFF  125

Query  494  SWIQGDIGLKIYFV  535
            +W++G+IGL++Y++
Sbjct  126  NWVRGEIGLRVYYL  139



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/763 (51%), Positives = 530/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKAR LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    TTYDLVEQMQYLYVRVVKARDLPAKDVTGSCDPYVEVKLGNYKGTTRYFEKKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++   +SS+ E+ V D           D    + +G + FD++EIP R PPDSPLA
Sbjct  91    FAFSKERIQASSV-EVIVKD----------KDSVKDDIIGRVSFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----RSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A  P+      RSKVY +PK
Sbjct  140   PQWYRLEDRKGDKVKGELMLAVWMGTQADEAFPEAWHSDAATVPSDGLASIRSKVYLTPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     PS +S F    +K  LG Q  +T+ + S T +P WNEDL+F
Sbjct  200   LWYVRVNVIEAQDLL----PSDKSRFPEVFVKVMLGNQALRTRISQSRTINPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  VLG   IPL +++RR+D + V SRW+  E      
Sbjct  256   VAAEPFEEH-LVLSVEDRVAPNKDEVLGKTVIPLQNVDRRLDYKPVNSRWYNLEKHVIVE  314

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  +
Sbjct  315   GEQKKKEMKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNAQ  374

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  375   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  434

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L P+G+KKMGE++LAVR
Sbjct  435   DNCHLQGGEKAAGTRDTRIGKVRIRLSTLETDRVYTHSYPLIVLLPSGVKKMGEVQLAVR  494

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ LH+YSQP+LP MH++ PL  VQ ++LR  A ++++  LSR+EPPLR+EVV
Sbjct  495   FTCSS-LINMLHMYSQPLLPKMHYLYPLSVVQLDNLRHQATQIVSMRLSRAEPPLRKEVV  553

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V + VI V KW D   +WRNP  TIL+H L V+LV
Sbjct  554   EYMLDVDSHMWSMRKSKANFFRIMGVFSPVIAVGKWFDQVCSWRNPLTTILIHVLFVILV  613

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W +R+R R    H DT++S AES   DELDEEFD  P +RP
Sbjct  614   LYPELILPTIFLYLFLIGVWYFRWRPRQP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  672

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              DMVR RYD+LR +  RVQT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  673   PDMVRMRYDRLRSVAGRVQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYV  732

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  733   TPFRVVALLTGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>ref|XP_010933296.1| PREDICTED: uncharacterized protein LOC105053703 [Elaeis guineensis]
Length=1010

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/757 (55%), Positives = 545/757 (72%), Gaps = 40/757 (5%)
 Frame = +2

Query  896   ERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK-TLLFEWDQTFA  1072
             +RS  DLVE M YLFV+IVKAR L     P VKV      + S+PAR  +   EW+Q FA
Sbjct  277   QRSRHDLVEPMQYLFVRIVKARGLRPCESPYVKVRTGSHTMRSKPARNGSGNPEWNQVFA  336

Query  1073  FGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHN--FLGGICFDVSEIPLRDPPDSPLA  1246
               +  P+S+  LEISVWD              G N  FLGG+C D+S++P+RDPPD PLA
Sbjct  337   LNQAKPEST--LEISVWD-------------GGPNEGFLGGVCLDLSDVPVRDPPDGPLA  381

Query  1247  PQWYRLEGG---GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--RSKVYQSPKLW  1411
             PQWYRLEGG   G   GD+M+A W+GTQAD++FP+++ +D      S  RSKVYQSPKLW
Sbjct  382   PQWYRLEGGEDRGEDMGDIMVAVWMGTQADDAFPESFNSDAPAPYVSYTRSKVYQSPKLW  441

Query  1412  YLRSSVIEAQDI-FALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWNEDLVFVA  1582
             YLR SV+EAQD+   +  P      ++K QLGFQ  +T+ ++  S+    SW EDL  VA
Sbjct  442   YLRVSVMEAQDLRITVPPPGTPCDIRVKIQLGFQSARTRRSTVNSSLSVFSWMEDLFLVA  501

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFEDQNEEKR  1759
             +EP  +   +  L+E    KE  ++G+ ++P+ S+E+R D+R V+ S+W+  E       
Sbjct  502   SEPLDDE--MIILVEDRSIKEVGLVGLVTVPMGSVEQRWDERHVVASKWYNLEHGPNN--  557

Query  1760  VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTM  1939
              Y GRVHLRLC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGIIG + LLPMKT 
Sbjct  558   -YSGRVHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGVLELGIIGARGLLPMKTK  616

Query  1940  RG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW----  2104
              G KGSTDAY VAKYG KWVRTRTI+DN  PRWNEQYTW+VYDP TV+TIGVFD+W    
Sbjct  617   GGAKGSTDAYCVAKYGKKWVRTRTITDNFDPRWNEQYTWQVYDPCTVLTIGVFDNWRMFA  676

Query  2105  EVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTP  2284
             +V+D  +  D R+GKVRIR+STL + +VY  ++ L++L  +G+KKMGE+++AVRF  +  
Sbjct  677   DVVD--DRPDYRIGKVRIRVSTLESNRVYTASYPLLVLLRSGVKKMGEVQVAVRFACTAL  734

Query  2285  TLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDA  2464
               D   +YSQPMLP MH++RP+G +QQE LR AA++++   L+RSEPPL  EVV YMLD 
Sbjct  735   LPDTCAMYSQPMLPRMHYLRPIGVLQQEVLRVAAIRMVAGWLARSEPPLGPEVVRYMLDV  794

Query  2465  DSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLI  2644
             D H++SMR+ +ANWFRI+ VIA  + + +W DD R WRNP  T+LVH L ++LVW+P+L+
Sbjct  795   DGHTWSMRRSKANWFRIMGVIAWAVGLARWVDDVRRWRNPVTTVLVHVLYLVLVWYPELV  854

Query  2645  IPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRA  2824
             +PT + YVF++GAW YRFR R  +   D ++S A+++D DELDEEFD VP  +P ++VRA
Sbjct  855   MPTASLYVFLVGAWYYRFRPRTPVG-MDMRLSQADTVDADELDEEFDPVPSAKPAEVVRA  913

Query  2825  RYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMI  3004
             RYD+LR L ARVQ ++GD A Q ERVQALV+WRDPRAT +FI +C +V+ +LY+VP KM+
Sbjct  914   RYDRLRTLSARVQRVMGDFAAQVERVQALVSWRDPRATRLFIGVCLLVSLVLYVVPPKMV  973

Query  3005  AMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             A+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DR+L
Sbjct  974   AVALGFYFLRHPMFRDPMPPASLNFFRRLPSLSDRLL  1010


 Score =   178 bits (451),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 111/136 (82%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV++AR+LLPKDG G SSPYVV+DF GQRK+TRTV RDLNPQW+E LEF +S 
Sbjct  9    TVRKLVVEVVDARDLLPKDGQGTSSPYVVVDFDGQRKRTRTVPRDLNPQWHEHLEFVVSD  68

Query  323  HSDIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
             + +  + L+++VY+DK +G T     +N+FLGRV++  TQF ++GEE LIY+PLE++NL
Sbjct  69   PATMEAEELDVEVYNDKRLGSTAAGARKNHFLGRVRIYGTQFYRRGEEGLIYFPLEKRNL  128

Query  491  LSWIQGDIGLKIYFVD  538
            LSWI+G+IGLKIY+ D
Sbjct  129  LSWIRGEIGLKIYYSD  144



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/762 (51%), Positives = 531/762 (70%), Gaps = 42/762 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKAR LPT     +  P V+V +      +R   KT   EW+Q 
Sbjct  31    TTYDLVEQMQYLYVRVVKARDLPTKDVTGSCDPYVEVKLGNYKGTTRHFEKTTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++   +SS+ E+ V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  91    FAFSKERIQASSV-EVIVKD----------KDFVKDDFIGRVSFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----RSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A  P+      RSKVY +PK
Sbjct  140   PQWYRLEDRKGDKVKGELMLAVWMGTQADEAFPEAWHSDAATVPSDGLASIRSKVYLTPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQ--IKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             LWY+R +VIEAQD+     PS +S F+  +K  LG Q  +T+ +   T +P WNEDL+FV
Sbjct  200   LWYVRVNVIEAQDL----QPSDKSRFEFYVKVMLGNQALRTRISQIRTINPMWNEDLMFV  255

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF EH L+  + + + P +  VLG   I L +++RR+D + V SRW+  E       
Sbjct  256   AAEPFEEH-LVLSVEDRVAPNKDEVLGKTVISLQNVDRRLDYKPVNSRWYNLEKHVIVEG  314

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             +Q +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  + 
Sbjct  315   EQKKKEVKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKQSIGVLELGILNAQG  374

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVFD
Sbjct  375   LLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVFD  434

Query  2099  SWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             +  +   E    ++D R+GKVRIR+STL T +VY + + LI+L P+G+KKMGE++LAVRF
Sbjct  435   NCHLQGGEKAAATRDTRIGKVRIRLSTLETDRVYTHYYPLIVLLPSGVKKMGEVQLAVRF  494

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
               S+  ++ LH+YSQP+LP MH++ PL  VQ ++LR  A ++++  LSR+EPPLR+EVV 
Sbjct  495   TCSS-LINMLHLYSQPLLPKMHYLYPLSVVQLDNLRHQATQIVSMRLSRAEPPLRKEVVE  553

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D   +WRNP  TIL+H L V+LV 
Sbjct  554   YMLDVDSHMWSMRKSKANFFRIMGVLSPLISVGKWFDQVCSWRNPLTTILIHILFVILVL  613

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +P+LI+PT   Y+F+IG W +R+R R    H DT++S AES   DELDEEFD  P +RP 
Sbjct  614   YPELILPTIFLYLFLIGVWYFRWRPRQP-PHMDTRLSHAESAHPDELDEEFDTFPTSRPP  672

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             D+VR RYD+LR +  RVQT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+ 
Sbjct  673   DIVRMRYDRLRSVAGRVQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVT  732

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++A+  G Y LRHP FR R+PS  LNFFRRLP+  D ML
Sbjct  733   PFRVVALLTGLYVLRHPRFRHRLPSVPLNFFRRLPARTDSML  774



>ref|XP_008778481.1| PREDICTED: uncharacterized protein LOC103698267 [Phoenix dactylifera]
Length=1018

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/752 (55%), Positives = 543/752 (72%), Gaps = 32/752 (4%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPTAG--RPvvkvvvsgshvisRPARK-TLLFEWDQTF  1069
             +SS+DLVE M YLFV++VKAR L       P VKV      + S+PAR  +   EW+Q F
Sbjct  286   QSSYDLVEPMQYLFVRVVKARGLRECACESPYVKVRTGSHAMRSKPARDGSGNPEWNQVF  345

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             A  +  PDS+  LEISVWD                 FLGG+CFD+S++P+RD PD PLAP
Sbjct  346   ALSQAKPDST--LEISVWD-----------GGPHEGFLGGVCFDLSDVPVRDQPDGPLAP  392

Query  1250  QWYRLEGG---GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLR  1420
             QWYRLEGG   G   GD+M+A W+GTQAD++FP++  +D      +RSKVYQSPKLWYLR
Sbjct  393   QWYRLEGGDDRGGVTGDIMVAVWMGTQADDAFPESCNSDAPYVSYTRSKVYQSPKLWYLR  452

Query  1421  SSVIEAQDI-FALTAPSKESSFQIKAQLGFQVQKTKPASSATGSP--SWNEDLVFVAAEP  1591
              SVIEAQD+  A   P      ++K QLGFQ  +++ ++  + S   SW EDL+FV +EP
Sbjct  453   VSVIEAQDLRIAAPPPGTPFDIRVKIQLGFQSARSRRSTVNSSSSVFSWPEDLMFVVSEP  512

Query  1592  FTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFEDQNEEKRVYK  1768
               +   +  L+E    KE A+LG   +P+ S+E+R+D+RQ++ S+W+  E        Y 
Sbjct  513   LDDE--MIILVEDRSIKEVALLGHVIVPVGSVEQRLDERQLVASKWYNLEGGPSG---YC  567

Query  1769  GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRG-  1945
             GRVHLRLC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGI+G + LLPMKT  G 
Sbjct  568   GRVHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGVLELGILGARGLLPMKTKGGA  627

Query  1946  KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDP--  2119
             KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIGVFD+W +     
Sbjct  628   KGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIGVFDNWRMFADLV  687

Query  2120  ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFL  2299
              +  D R+GKVRIR+STL + +VY N++ L++L  +G+K+MGE+++AVRF       D  
Sbjct  688   GDRPDYRIGKVRIRVSTLESNRVYTNSYPLLVLLRSGVKRMGEVQVAVRFACPALLPDTC  747

Query  2300  HVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSF  2479
              +Y+QPMLP MH++RP+G VQQE LR AA+K++   ++RSEPPL  EVV YMLDAD+H++
Sbjct  748   AMYTQPMLPRMHYLRPIGVVQQEVLRVAAIKMVAGWMARSEPPLGPEVVRYMLDADAHTW  807

Query  2480  SMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFA  2659
             S+R+ +ANWFRI+ VIA  + + +W DD R WRNP  T+LVH L ++LVW+P+L++PT +
Sbjct  808   SVRRSKANWFRIMGVIAWAVGLARWVDDVRRWRNPVTTVLVHVLYLVLVWYPELVVPTAS  867

Query  2660  FYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKL  2839
              YVF++GAW YRFR R      D ++S A+++D DELDEEFD VP  +P ++VR RYD+L
Sbjct  868   LYVFLVGAWYYRFRPRTPAG-MDMRLSQADTVDADELDEEFDTVPSAKPAEVVRVRYDRL  926

Query  2840  RMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFG  3019
             R L ARVQ ++GD A QGERVQALV+WRDPRAT +FI +C VV+ +LY+VP KM+A+A G
Sbjct  927   RTLAARVQRVMGDFAAQGERVQALVSWRDPRATRLFIGVCLVVSLVLYVVPPKMVAVALG  986

Query  3020  FYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             FY+LRHP+FRD MP  +LNFFRRLPSL+DR+L
Sbjct  987   FYFLRHPMFRDPMPPASLNFFRRLPSLSDRLL  1018


 Score =   172 bits (435),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV +AR LLPKDG G SSPYVV+DF GQRK+TRTV RDLNPQW+E LEF +  
Sbjct  9    TVRKLVVEVEDARGLLPKDGQGTSSPYVVVDFDGQRKRTRTVPRDLNPQWHERLEFVVVD  68

Query  323  HSDIFGDMLELDVYHDKNVGPTT----RNNFLGRVKLNATQFVKKGEEALIYYPLERKNL  490
             + +  + L+++VY+DK +G       +N+FLGRV++  TQF ++GEE LIY+PLE++NL
Sbjct  69   PATMEAEELDVEVYNDKRLGNAAAGGRKNHFLGRVRIYGTQFCRQGEEGLIYFPLEKRNL  128

Query  491  LSWIQGDIGLKIYFVD  538
            LSWI+G+IGLKIY+ D
Sbjct  129  LSWIRGEIGLKIYYYD  144



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/763 (51%), Positives = 531/763 (70%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LPT     +  P V+V +      +R   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKDLPTKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++   +SS+ E+ V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  92    FAFSKERIQASSV-EVIVKD----------KDFVKDDFIGRVSFDLNEIPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  141   PQWYRLEDRKGDKVKGELMLAVWMGTQADEAFPEAWHSDAATVPGDGLASIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     PS +S F    +K  LG Q  +T+ + S T +P WNEDL+F
Sbjct  201   LWYVRVNVIEAQDL----QPSDKSRFPEVFVKVMLGNQALRTRISQSRTINPMWNEDLMF  256

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + E + P +  VLG   I L +++RR+D + V SRW+  E      
Sbjct  257   VAAEPFEEH-LVLSVEERVAPNKDEVLGKTVITLQNVDRRLDYKPVNSRWYNLEKHVIVD  315

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  +
Sbjct  316   GEQKKKEVKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNAQ  375

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  376   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  435

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L P+G+KKMGE++LAVR
Sbjct  436   DNCHLQGGEKAAGTRDTRIGKVRIRLSTLETDRVYTHSYPLIVLLPSGVKKMGEVQLAVR  495

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S   ++ LH+YSQP+LP MH++ PL  VQ ++LR  A ++++  LSR+EPPLR+EVV
Sbjct  496   FTCSY-LINMLHMYSQPLLPKMHYLYPLSVVQLDNLRHQATQIVSMRLSRAEPPLRKEVV  554

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D    WRNP  TIL+H L V+LV
Sbjct  555   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVGKWFDQICNWRNPLTTILIHILFVILV  614

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W +R+R+R    H DT++S AES   DELDEEFD  P +RP
Sbjct  615   LYPELILPTIFLYLFLIGVWYFRWRTRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  673

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  674   PDLVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYV  733

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  734   TPFRVVALLTGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_006850074.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/760 (51%), Positives = 534/760 (70%), Gaps = 40/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT----AGRPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             S++DLVE+M YL+V++VKA+ LPT    +  P V+V +      +R   K    EW+Q F
Sbjct  31    STYDLVEQMQYLYVRVVKAKDLPTDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQVF  90

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF ++     S++E++V D           D+   +F+G + FD++EIP R PPDSPLAP
Sbjct  91    AFSKERI-QFSVIEVTVKD----------KDLVKDDFIGRVTFDLNEIPKRVPPDSPLAP  139

Query  1250  QWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPKL  1408
             QWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A     G    RSKVY SPKL
Sbjct  140   QWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATIHGEGLSNIRSKVYLSPKL  199

Query  1409  WYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             WYLR +VIEAQD+     PS ++ F    +K  LG Q  KT+ + S + SP WNEDL+FV
Sbjct  200   WYLRVNVIEAQDL----VPSDKARFPEVHVKVMLGSQGMKTRVSQSRSLSPLWNEDLMFV  255

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QN  1747
             AAEPF EH L+  + + + P +  ++G   IPL S+E+R D + V SRW+  E     + 
Sbjct  256   AAEPFEEH-LVISVEDRIGPNKDELMGKCVIPLQSVEKRFDHKPVNSRWYNLEKHAITEG  314

Query  1748  EEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             E+K+  K   R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + L
Sbjct  315   EKKKEVKFASRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNAQGL  374

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             LPMKT  G+ +TDAY VAKYGSKW+RTRTI D+  P+WNEQYTW VYDP TVVT+GVFD+
Sbjct  375   LPMKTKDGRNTTDAYCVAKYGSKWIRTRTIIDSFTPKWNEQYTWEVYDPCTVVTVGVFDN  434

Query  2102  WEVI-DPEN-SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
               +  D  N +KD R+GKVRIR+STL T +VY +++ L++L  +G+KKMGE++LAVRF R
Sbjct  435   CHLAGDKANGTKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHSSGVKKMGEVQLAVRFAR  494

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ LH+YSQP+LP MH++ PL   Q +SLR  A ++++  LSR+EP LR+EVV YM
Sbjct  495   SS-LLNMLHIYSQPLLPKMHYLHPLSVTQLDSLRHQATQIVSMRLSRAEPSLRKEVVEYM  553

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD DSH +SMR+ +AN+FRI++V++ +I V KW D    W+NP  TILVH L ++LV +P
Sbjct  554   LDYDSHMWSMRRSKANFFRIMSVMSGMIAVGKWLDKICNWKNPLTTILVHILFLILVLYP  613

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W+YR+R R    + DT++S AE++  DELDEEFD  P +R +D+
Sbjct  614   ELILPTIFLYMFLIGIWHYRWRPRQP-PYMDTRLSHAENVHPDELDEEFDTFPTSRHSDI  672

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GD+ATQGER+Q+L++WRDPRAT +F+  CF+ A +LY+ P 
Sbjct  673   VRMRYDRLRSVAGRIQTVVGDMATQGERLQSLLSWRDPRATALFVTFCFLAAIVLYVTPF  732

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+   FY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  733   RVVAILTAFYVLRHPRFRHKLPSVPLNFFRRLPAKTDSML  772



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/763 (51%), Positives = 528/763 (69%), Gaps = 44/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP+     +  P V+V +      +R   K    EW+Q 
Sbjct  31    TTYDLVEQMQYLYVRVVKAKDLPSKDITGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS++EI V D           D    +F+G +CFD++E+P R PPDSPLA
Sbjct  91    FAFSKER-IQSSVVEIIVKD----------KDFVKDDFIGRVCFDLNEVPKRVPPDSPLA  139

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  140   PQWYRLEERNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASIPGDGLASIRSKVYLTPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR ++IEAQD+     P+  + F    +KA LG Q  +T+ + S T +P WNEDL+F
Sbjct  200   LWYLRVNIIEAQDLI----PNDRTRFPEVYVKAMLGNQALRTRVSPSRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  VLG   I L  + RR+D + + S+W+  E      
Sbjct  256   VAAEPFEEH-LILSVEDRIAPGKDDVLGRTIISLQHVPRRLDHKLLNSQWYNLEKHIIVD  314

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  315   GEQKKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKQLWKHSIGILELGILTAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  374   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  433

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY + + LI+L+PAG+KKMGE++LAVR
Sbjct  434   DNCHLNGGEKANGARDTRIGKVRIRLSTLETDRVYTHAYPLIVLTPAGVKKMGEVQLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL  +Q ++LR  A  +++T LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHLYSQPLLPKMHYVHPLSVMQVDNLRRQATNIVSTRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D    WRNP  TIL+H L V+LV
Sbjct  553   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVAKWFDQICHWRNPLTTILIHVLFVILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AES   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRQP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CFV A +LY+
Sbjct  672   PDIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFVAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR +MPS  LNFFRRLP+  D ML
Sbjct  732   TPFRVVVFLAGLYTLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>gb|EYU35883.1| hypothetical protein MIMGU_mgv1a000608mg [Erythranthe guttata]
Length=1046

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/769 (53%), Positives = 522/769 (68%), Gaps = 49/769 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP----------TAGRPvvkvvvsgshvisRPARKTLLF  1051
              +FDLVE M YLFV+IVKAR L           T+G  +             PA      
Sbjct  296   QAFDLVEPMQYLFVRIVKARGLSQNENPHVKIRTSGHFLRSKTAVIPPGTDSPANP----  351

Query  1052  EWDQTFAFGRDAPDSS-SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDP  1228
             EW Q FA G +   ++ S LEISVWD  +S+            FLGG+CFD+S++P+RDP
Sbjct  352   EWQQVFALGYNKETAANSTLEISVWDGGTSE-----------KFLGGVCFDLSDVPVRDP  400

Query  1229  PDSPLAPQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTS--RS  1384
             PDSPLAPQWY LEGG A +      GDL L+ W+GTQAD++FP++   D      S  R 
Sbjct  401   PDSPLAPQWYHLEGGAAAEDQNRISGDLQLSVWIGTQADDAFPESSSADAPQPYVSYTRP  460

Query  1385  KVYQSPKLWYLRSSVIEAQDIFAL--TAPSKESSFQIKAQLGFQVQKTKPASSA--TGSP  1552
             KVYQ+PKLWYLR +++EAQD+  +    P      ++K QLGFQ  +T+  S    T + 
Sbjct  461   KVYQAPKLWYLRVTILEAQDLHIIPNLPPLTAPEIRVKGQLGFQSARTRRGSMTHHTSAF  520

Query  1553  SWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFT  1732
              WNEDL FVA EP  +   L  L+E    K+  +LG   IP+ SIE+R+DDR V  +W  
Sbjct  521   HWNEDLFFVAGEPLEDS--LILLVEDRTGKDPVLLGHILIPVGSIEQRIDDRHVAPKWHG  578

Query  1733  FEDQNEEKRVYKG-RVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
              E            RVHLR+C +GGYHV++EAAHLCSD+RPTA+QLWKP VG +ELGI+G
Sbjct  579   LEGGPGGGGGSYCGRVHLRMCLEGGYHVLDEAAHLCSDFRPTAKQLWKPAVGVLELGILG  638

Query  1910  CKNLLPMKTM-RGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
             C+ LLPMK+   GKGSTD+Y VAKYG KWVRTRT++D   PRWNEQYTW+VYDP TV+TI
Sbjct  639   CRGLLPMKSKGNGKGSTDSYCVAKYGKKWVRTRTVTDTFDPRWNEQYTWQVYDPCTVLTI  698

Query  2087  GVFDSWEVI-DPENSK-----DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGE  2248
             GVFD+W +  +P         D R+GKVRIR+STL + KVY N++ L++LS +GLKKMGE
Sbjct  699   GVFDNWRMFAEPGGGGGEEKPDCRVGKVRIRVSTLESNKVYMNSYPLMVLSRSGLKKMGE  758

Query  2249  IELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPP  2428
             +ELAVRF   +   D   VY QP+LP MHH+RPLG   QE+LR AA +++   L+RSEPP
Sbjct  759   VELAVRFACPSMLPDTCGVYGQPLLPRMHHLRPLGVAHQEALRGAAARIVAAWLARSEPP  818

Query  2429  LRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHA  2608
             L  EVV YMLD+DS S+SMRK +ANWFRI+ V+A  + + KW D  R W+NP  T+LVH 
Sbjct  819   LGPEVVRYMLDSDSQSWSMRKSKANWFRIVAVLAWAVGLAKWLDHIRRWKNPVTTVLVHV  878

Query  2609  LLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDA  2788
             L ++LVW+PDLI+PT   YVF+IG W YRF+ +      D K+S  + ID DELDEEFD 
Sbjct  879   LYLVLVWYPDLIVPTGFLYVFLIGVWYYRFKPKIPAG-MDVKLSQVDRIDPDELDEEFDT  937

Query  2789  VPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVV  2968
              P +RP ++VR RYD+LR+L ARVQ +LGD+ATQGER+QALV+WRDPRAT +FI +C  +
Sbjct  938   FPSSRPPEIVRVRYDRLRVLAARVQMVLGDIATQGERIQALVSWRDPRATKLFIGVCLAI  997

Query  2969  AFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               I+Y+VP+KM+A+A GFY+LRHP+FRD MP  +L+FFRRLP LADR+L
Sbjct  998   TIIMYIVPAKMVAVALGFYFLRHPMFRDPMPPASLSFFRRLPGLADRLL  1046


 Score =   159 bits (402),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKLIVEVIEAR LLPKDG G+SSPYVV DF GQ+++T TV+++LNP WNE LEF ++   
Sbjct  16   RKLIVEVIEARELLPKDGQGSSSPYVVADFDGQKRRTSTVVKNLNPVWNEGLEFVVTDPK  75

Query  329  DIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
             +  + L ++V++DK +  G   +N+FLGRVKL  +QFV++GEE L+Y+ LE+K++ SWI
Sbjct  76   TMEFEELNVEVFNDKKLSNGNARKNHFLGRVKLYGSQFVRRGEEGLVYFTLEKKSVFSWI  135

Query  503  QGDIGLKIYFVD  538
            +GD+GLKIY+ D
Sbjct  136  KGDLGLKIYYYD  147



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/763 (51%), Positives = 531/763 (70%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKDLPVKDVTGSCDPYVEVKLGNYKGTTRYFEKKTNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++   +SS +E+ V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  92    FAFSKERIQASS-MEVIVKD----------KDSVKDDFIGRVLFDLNEIPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  141   PQWYRLEDRKGDKVKGELMLAVWMGTQADEAFPEAWHSDAATVPGDGLASIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     PS +S F    +K  LG QV +T+ + S T +P WNEDL+F
Sbjct  201   LWYVRVNVIEAQDL----QPSDKSRFPEVFVKVMLGNQVLRTRISQSRTLNPMWNEDLMF  256

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  VLG   IPL +++RR+D + V SRW+  E      
Sbjct  257   VAAEPFEEH-LILSVEDRVAPSKDEVLGRTIIPLQNVDRRLDYKPVNSRWYNLEKHVIVD  315

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+ LWKP +G +ELGI+  +
Sbjct  316   GEQKKKEVKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKPLWKPSIGVLELGILNAQ  375

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  376   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  435

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L P+G+KKMGE++LAVR
Sbjct  436   DNCHLQGGEKAAGTRDTRIGKVRIRLSTLETDRVYTHSYPLIVLLPSGVKKMGEVQLAVR  495

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ LH+YSQP+LP MH++ PL  VQ ++LR  A ++++  LSR+EPPLR+EVV
Sbjct  496   FTCSS-LINMLHMYSQPLLPKMHYLYPLSVVQLDNLRHQATQIVSMRLSRAEPPLRKEVV  554

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D    WRNP  TIL+H L V+LV
Sbjct  555   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVGKWFDQICHWRNPLTTILIHILFVILV  614

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W +R+R R    H DT++S AES   DELDEEFD  P +RP
Sbjct  615   LYPELILPTIFLYLFLIGVWYFRWRPRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  673

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  674   PDLVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYV  733

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  734   TPFRVVALLTGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/763 (51%), Positives = 528/763 (69%), Gaps = 44/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKELPNKDITGSCDPYVEVKLGNYKGQTRHFEKKNNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS++EI V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKER-IQSSVVEIVVKD----------KDLVKDDFIGRVMFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  141   PQWYRLEDRNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASVPGDGLASIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P+ ++ F    +KA LG QV +T+  +S T +P WNEDL+F
Sbjct  201   LWYLRVNVIEAQDLI----PNDKTRFPEVYVKAMLGNQVLRTRVLASRTLNPMWNEDLMF  256

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  V+G   I L  + RR+D R + S+W+  E      
Sbjct  257   VAAEPFEEH-LILSVEDRVAPGKDEVIGRTIISLQHVPRRLDHRLLTSQWYPLEKHVIID  315

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+ LWKP +G +ELGI+  +
Sbjct  316   GEQKKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKPLWKPSIGILELGILTAQ  374

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  375   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  434

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L+P G+KKMGE++LAVR
Sbjct  435   DNCHLNGGEKANGARDTRIGKVRIRLSTLETDRVYTHSYPLIVLTPGGVKKMGEVQLAVR  494

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL  +Q ++LR  A  +++T L R+EPPLR+E+V
Sbjct  495   FTCSS-LLNMMHLYSQPLLPKMHYVHPLSVIQVDNLRRQATNIVSTRLGRAEPPLRKEIV  553

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D    WRNP  TIL+H L V+LV
Sbjct  554   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVAKWFDQICLWRNPLTTILIHVLFVILV  613

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AE+   DELDEEFD  P +RP
Sbjct  614   LYPELILPTIFLYLFLIGVWYYRWRPRQP-PHMDTRLSHAETAHPDELDEEFDTFPTSRP  672

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CF+ A +LY+
Sbjct  673   PDIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFIAAIVLYV  732

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR RMPS  LNFFRRLP+  D ML
Sbjct  733   TPFRVVVFLAGLYVLRHPRFRHRMPSVPLNFFRRLPARTDSML  775



>ref|XP_009412381.1| PREDICTED: uncharacterized protein LOC103993884 [Musa acuminata 
subsp. malaccensis]
Length=1075

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/763 (54%), Positives = 535/763 (70%), Gaps = 42/763 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTL--LFEWDQTFAFGR  1081
             +DLVE M YLFV+IVKAR L     P VK+        S PAR +     EW+Q FA  +
Sbjct  328   YDLVEPMQYLFVRIVKARGLRPCHSPHVKIRTGPIAGQSLPARDSGAGCPEWNQVFALSQ  387

Query  1082  DAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYR  1261
               P+S+  LEISVW+           D     FLGG+CF+++++P+RD PD PLAPQWY+
Sbjct  388   CKPEST--LEISVWE-----------DGPNEAFLGGVCFNLTDVPVRDQPDGPLAPQWYK  434

Query  1262  LEGGGAHK---GDLMLATWVGTQADESFPDAWKTDT--AGNPTSRSKVYQSPKLWYLRSS  1426
             LEG        GD+M+A W+GTQADESF ++W +D        +RSKVYQSPK+WYLR+ 
Sbjct  435   LEGASDDAPVTGDIMVAVWIGTQADESFAESWNSDAPYVSYAYTRSKVYQSPKMWYLRAY  494

Query  1427  VIEAQDIFALTA----PSKESSFQIKAQLGFQVQKTK---PASSATGSPSWNEDLVFVAA  1585
             VIEAQD+   +A    P    + ++K  LGFQ   T+     SS++ S SW EDL+FVA+
Sbjct  495   VIEAQDLRLASAAPLPPGVPHNVRVKIHLGFQSAMTRRPIAVSSSSSSLSWMEDLMFVAS  554

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQ-VISRWFTFEDQNEEK--  1756
             EP + H ++   +E    KE   LG A +P+ S+E+R+D+RQ V SRWF  E     +  
Sbjct  555   EPLSNHEMIV-EVEDRSTKEPEPLGYAVVPVVSVEQRLDERQAVASRWFNLESTATRECG  613

Query  1757  ----RVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
                   Y+GR+HLRLC +GGYHV++EAAH+CSD+RPTA+QLWKP VG +ELGI+G + L+
Sbjct  614   AAPGGGYRGRIHLRLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPAVGVMELGILGARGLI  673

Query  1925  PMKT-----MRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
             PMKT        KGSTDAY VAKYG KWVRTRTI+D+  PRWNEQYTW+VYDP TV+TIG
Sbjct  674   PMKTRGAGGGGAKGSTDAYCVAKYGKKWVRTRTITDSFDPRWNEQYTWQVYDPCTVLTIG  733

Query  2090  VFDSWEVIDPE-NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             VFD+W + D   N +D R+GKVRIR+STL + +VY  ++ L+ L P+G+KKMGE++LAVR
Sbjct  734   VFDNWRMFDAAGNRQDYRIGKVRIRVSTLESNRVYTASYPLLRLLPSGVKKMGEVQLAVR  793

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  +    D   +Y+QPMLP MHH+RPLG +QQ+ LR +A+ L++  L RSEPPL +EVV
Sbjct  794   FACAGLLPDTCAMYAQPMLPRMHHLRPLGVLQQDVLRVSAIILVSEWLERSEPPLGQEVV  853

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD + HS+S R+ +ANWFRI+ VI     + +W DD R WRNPT T+LVH L ++LV
Sbjct  854   RYMLDVNWHSWSNRRSKANWFRIMGVIDWAFGLARWIDDIRRWRNPTTTVLVHVLYLVLV  913

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
             W+P+L++PT + YVF+IGAW  RFR R      D ++S A+ +D ++LDEEFD VP T+P
Sbjct  914   WYPELVVPTASLYVFLIGAWYSRFRPRAPAG-MDVRLSQADMVDAEDLDEEFDPVPSTKP  972

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              ++VRARYD+LR+L ARVQ LLGDLA QGERVQALV+WRDPRAT +FI  C  VA + Y+
Sbjct  973   AEVVRARYDRLRILAARVQRLLGDLAAQGERVQALVSWRDPRATKLFIGACLAVALVFYV  1032

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             VP KMIA+A GFY+LRHP+FRD MP  +LNFFRRLPSL+DRML
Sbjct  1033  VPPKMIAVALGFYFLRHPMFRDPMPPASLNFFRRLPSLSDRML  1075


 Score =   172 bits (436),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL VEVI+AR+LLPKDGHG SSPYVV++F GQRK+T TV RDLNPQWNE LEF ++   
Sbjct  57   RKLAVEVIDARDLLPKDGHGTSSPYVVVEFDGQRKQTHTVPRDLNPQWNERLEFVVADDV  116

Query  329  DIFGDMLELDVYHDKNVGPTT---RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             +  + L ++VY+DK +G  +   +N+FLGRV++  +QF ++GEE LIY+PLE++NLLSW
Sbjct  117  SLEDEELNVEVYNDKRMGSPSGARKNHFLGRVRIYGSQFARRGEEGLIYFPLEKRNLLSW  176

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLK+Y+ D
Sbjct  177  IRGEIGLKMYYYD  189



>gb|EPS62334.1| hypothetical protein M569_12455, partial [Genlisea aurea]
Length=1024

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/764 (53%), Positives = 534/764 (70%), Gaps = 48/764 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRP------ARKTLLFEWDQTF  1069
             FDLVE M YLF++IVKAR L     P V++  SG  V S+P      +      EW+Q F
Sbjct  281   FDLVEPMQYLFIRIVKARGLSQNENPNVRIRSSGHLVRSKPGINPPGSDSPANPEWNQVF  340

Query  1070  A--FGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
             A  + +DA  ++S LEI+VWD  S K            FLGG+CFD+S++PLRDPPDSPL
Sbjct  341   ALPYNKDAA-AASTLEITVWDGASEK------------FLGGVCFDLSDVPLRDPPDSPL  387

Query  1244  APQWYRLEGGGAHK----GDLMLATWVGTQADESFPDAWKTDTAGNPTS--RSKVYQSPK  1405
             APQWY L+G    +    GD+ L+ W+GTQADE+FP++W  D      S  R KVYQSPK
Sbjct  388   APQWYHLDGATDDQNKVSGDMQLSVWIGTQADEAFPESWSADVPQPSVSYTRPKVYQSPK  447

Query  1406  LWYLRSSVIEAQDIFA---LTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDL  1570
             + YLR +VIEAQ++ A   L+AP      ++KAQ+GFQ  +T+  S+   +P+  WNEDL
Sbjct  448   MSYLRVTVIEAQNLHAIPNLSAPE----IRVKAQIGFQTVRTRRGSTTKHAPAFHWNEDL  503

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNE  1750
             +FVA +P  E+ +L             ++G A+I L S+E+R DDR V ++W+  +D   
Sbjct  504   LFVAGDPLEENLILTVEDRTGSGDPVQIIGRATISLDSVEQRHDDRHVAAKWYNLDDGTG  563

Query  1751  EKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPM  1930
                 Y GRV+LR+C + GYHV++E A  CSD+RPTA+QLWKP VG +ELGI+GC+ LLPM
Sbjct  564   GP--YCGRVNLRICMERGYHVLDEPAQFCSDFRPTAKQLWKPAVGILELGILGCRGLLPM  621

Query  1931  KTM--RGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             K     GKGSTD Y VAKYG KWVRTRT+ D+  PRWNEQYTW+VYDP TV+T+GVFD+W
Sbjct  622   KHKGGDGKGSTDPYCVAKYGKKWVRTRTVMDSFDPRWNEQYTWQVYDPCTVLTVGVFDNW  681

Query  2105  EVIDPENSK-------DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
              +   + +        D R+GK+RIR+STL + +VY N++ L++L+ +GLKKMGEIELAV
Sbjct  682   RMFAADGAGAGGDERIDCRIGKIRIRVSTLESNRVYMNSYPLMVLTRSGLKKMGEIELAV  741

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   +   D   VY QPMLP MH++RPLG  QQE+LR AA K +   L RSEPPL  EV
Sbjct  742   RFACPSLLPDVCGVYGQPMLPRMHYLRPLGVAQQEALRIAATKTVAAWLGRSEPPLGSEV  801

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V +MLD DSHS+S+RK +ANWFRI+ VI  VI + KW D  R+W+NP  T+LVH L ++L
Sbjct  802   VKFMLDVDSHSWSVRKSKANWFRIVAVIGWVIGLAKWVDQIRSWKNPITTVLVHVLYLVL  861

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             VW+PDL+IPT   Y+F++G W+ RFRS+      D ++S AE++D DELDEEFD  P TR
Sbjct  862   VWYPDLVIPTGFLYLFLVGIWHRRFRSKIPAG-MDVRLSQAEALDTDELDEEFDPFPSTR  920

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P+++VRARYD+LR+L  RVQT+LGDLATQGER+QALV+WRDPRAT IF+ +C  +  +LY
Sbjct  921   PDEIVRARYDRLRILAGRVQTVLGDLATQGERLQALVSWRDPRATKIFVGVCLAITIVLY  980

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              VP+KM+A+A GFY+LRHP+FRD MP+ AL+FFRRLP L+DR+L
Sbjct  981   AVPAKMVAVAIGFYFLRHPMFRDPMPTAALSFFRRLPGLSDRLL  1024


 Score =   154 bits (389),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL VEV+EAR LLPKDG G+SSPYV  DF GQ+K+T T L+DLNP WNE+L+F +S 
Sbjct  11   TVRKLFVEVVEARELLPKDGQGSSSPYVAADFDGQKKRTSTKLQDLNPVWNEILDFVVSD  70

Query  323  HSDIFGDMLELDVYHDKNVGPTTR-NNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
               +  + + ++VY+DK  G   R N+FLGRVKL  +Q  K+GEE L+Y+ LE+K++LSW
Sbjct  71   PKTMDYEEITIEVYNDKKYGGNVRKNHFLGRVKLYGSQISKRGEEGLVYFTLEKKSVLSW  130

Query  500  IQGDIGLKIYFVD  538
            ++GD+ LKIY+ D
Sbjct  131  VRGDLALKIYYDD  143



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/763 (51%), Positives = 527/763 (69%), Gaps = 44/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP+     +  P V+V +      +R   K    EW+Q 
Sbjct  31    TTYDLVEQMQYLYVRVVKAKDLPSKDITGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS++EI V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKER-IQSSVVEIIVKD----------KDFVKDDFIGRVLFDLNEVPKRVPPDSPLA  139

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  140   PQWYRLEERNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASIPGDGLASIRSKVYLTPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P+  + F    +KA LG Q  +T+ + S T +P WNEDL+F
Sbjct  200   LWYLRVNVIEAQDLI----PNDRTRFPDVYVKAMLGNQALRTRVSPSRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  VLG   I L  + RR+D + + S+W+  E      
Sbjct  256   VAAEPFEEH-LILSVEDRIAPGKDDVLGRTIISLQHVPRRLDHKLLNSQWYNLEKHVIVD  314

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  315   GEQKKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKQLWKHSIGILELGILTAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  374   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITIGVF  433

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY + + LI+L+PAG+KKMGE++LAVR
Sbjct  434   DNCHLNGGEKANGARDTRIGKVRIRLSTLETDRVYTHAYPLIVLTPAGVKKMGEVQLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL  +Q ++LR  A  +++T LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHLYSQPLLPKMHYVHPLSVMQVDNLRRQATNIVSTRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V KW D    WRNP  TIL+H L V+LV
Sbjct  553   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVAKWFDQICHWRNPLTTILIHILFVILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AES   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRQP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CFV A +LY+
Sbjct  672   PDIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFVAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR +MPS  LNFFRRLP+  D ML
Sbjct  732   TPFRVVVFLAGLYTLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/763 (50%), Positives = 529/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP-----TAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKDR-IQASVLEVIVKD----------KDFIKDDFIGRVLFDLTEVPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----RSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FPD+W +D A  P+      RSKVY +PK
Sbjct  141   PQWYRLEDRKGDKGKGELMLAVWMGTQADEAFPDSWHSDAATIPSDGLANIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P +++ F    +K  LG Q  +T+ + S T +P WNEDL+F
Sbjct  201   LWYLRVNVIEAQDLI----PYEKNRFPEVFVKVMLGNQALRTRISQSRTLNPMWNEDLMF  256

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  VLG   IPL  I+RR+D + V SRW+  E      
Sbjct  257   VAAEPFEEH-LVLSVEDRVAPNKDEVLGKTVIPLQKIDRRLDYKPVNSRWYNLEKHVIVE  315

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              DQ +++  +  R+HLR+C +GGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  +
Sbjct  316   GDQKKKEVKFSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILSAQ  375

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+TIGVF
Sbjct  376   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVYDPCTVITIGVF  435

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L P+G+KKMGE++LAVR
Sbjct  436   DNCHLQGGEKAAGTRDTRIGKVRIRLSTLETDRVYTHSYPLIVLLPSGVKKMGEVQLAVR  495

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ LH+YSQP+LP MH++ PL  +Q ++LR  A ++++  LSR+EPPLR+EVV
Sbjct  496   FTCSS-LLNILHMYSQPLLPKMHYLHPLSVMQLDNLRHQATQIVSMRLSRAEPPLRKEVV  554

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ ++ V KW D    W+NP  TIL+H L V+L+
Sbjct  555   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLVAVGKWFDQICHWKNPLTTILIHVLFVILI  614

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W +R+R R    + DT++S A++   DELDEEFD  P +RP
Sbjct  615   LYPELILPTIFLYLFLIGVWYFRWRPRQP-PYMDTRLSHADTAHPDELDEEFDTFPTSRP  673

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY+
Sbjct  674   PDIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLVAAVVLYV  733

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A   G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  734   TPFRVVAFLTGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/763 (50%), Positives = 526/763 (69%), Gaps = 44/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +    K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKELPNKDITGSCDPYVEVKLGNYKGQTGHFEKKNNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS++EI V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFAKER-IQSSVVEILVKD----------KDLVKDDFIGRVIFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  141   PQWYRLEDRNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASVPGDGLASIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P+ ++ F    +KA LG QVQ+T+  +S T +P WNEDL+F
Sbjct  201   LWYLRVNVIEAQDLI----PNDKTRFPEVYVKAMLGNQVQRTRALASRTLNPLWNEDLMF  256

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  V+G   I L  + RR+D R + S+W+  E      
Sbjct  257   VAAEPFEEH-LVLSVEDRVAPGKDEVIGRTIIALQHVPRRLDHRLLTSQWYNLEKHVIID  315

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+ LWKP +G +ELGI+  +
Sbjct  316   GEQKKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKPLWKPSIGILELGILTAQ  374

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TVVTIGVF
Sbjct  375   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVVTIGVF  434

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L+P G+KKMGE++LAVR
Sbjct  435   DNCHLNGGEKANGARDTRIGKVRIRLSTLETDRVYTHSYPLIVLTPGGVKKMGEVQLAVR  494

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL  +Q ++LR  A  +++T L R+EPPLR+E+V
Sbjct  495   FTCSS-LLNMMHLYSQPLLPKMHYVHPLSVIQVDNLRRQATSIVSTRLGRAEPPLRKEIV  553

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI  V++ +  V +W D    W+NP  T+L+H L ++LV
Sbjct  554   EYMLDVDSHMWSMRKSKANFFRITGVLSPLFAVARWFDQICHWKNPLTTVLIHVLFMILV  613

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AE+   DELDEEFD  P +RP
Sbjct  614   LYPELILPTIFLYLFLIGVWYYRWRPRQP-PHMDTRLSHAETAHPDELDEEFDTFPTSRP  672

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYDKLR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CFV A +LY+
Sbjct  673   PDLVRMRYDKLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYV  732

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR +MPS  LNFFRRLP+  D ML
Sbjct  733   TPFRVVVFLAGLYVLRHPRFRHKMPSVPLNFFRRLPARTDSML  775



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/758 (50%), Positives = 528/758 (70%), Gaps = 35/758 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP-----TAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   +    EW+Q 
Sbjct  31    STYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKLGNYKGTTRYFERKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   +S++ EI+V D           D    +++G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRIQASTV-EIAVKD----------KDAVKDDYMGMVMFDLNEVPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----RSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A  P       +SKVY SPK
Sbjct  140   PQWYRLEDRKGEKVKGELMLAVWMGTQADEAFPDAWHSDAASVPGDGLANIKSKVYLSPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAA  1585
             LWYLR +VIEAQD+  L+  +  +   +KA +G Q  +T+ A S + +P WNEDL+FVAA
Sbjct  200   LWYLRVNVIEAQDL-QLSEKAGYAEVFVKATIGNQALRTRIAQSRSANPLWNEDLMFVAA  258

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNEE  1753
             EPF EH L+  + E + P +  VLG A I L S+ERR+D R V SRW+  E     + E+
Sbjct  259   EPFEEH-LVLSVEERVGPNKDEVLGKAVIQLQSVERRLDYRAVNSRWYNLEKHVIVEGEQ  317

Query  1754  KRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
             K+  K   R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + L+P
Sbjct  318   KKEAKFASRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGILELGILSAQGLMP  377

Query  1928  MKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             MKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+T+GVFD+  
Sbjct  378   MKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVITVGVFDNSH  437

Query  2108  VIDPEN--SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
             +   +   +KD R+GKVRIR+STL T +VY +++ L++L   G+KKMGE++LAVRF  S+
Sbjct  438   IQGDKAGVTKDNRIGKVRIRLSTLETDRVYTHSYPLLVLLNTGVKKMGEVQLAVRFTCSS  497

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
               L+ +H+YSQP+LP MH++ PL  +Q ++LR  A ++++  LSR+EPPLR+EVV YMLD
Sbjct  498   -LLNMMHMYSQPLLPKMHYLHPLTVIQLDNLRHQATQIVSMRLSRAEPPLRKEVVEYMLD  556

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
               SH +SMR+ +AN+FRI+ V++ +I V +W +    W+NP  T+L+H L V+LV +P+L
Sbjct  557   VGSHMWSMRRSKANFFRIMGVLSGLIAVGRWFNQICNWKNPLTTVLIHVLFVILVLYPEL  616

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             I+PT   Y+F+IG W YR+R R    H DT++S A++   DELDEE D  P +RP D+VR
Sbjct  617   ILPTIFLYLFLIGVWYYRWRPRQP-PHMDTRLSHADNAHPDELDEESDTFPTSRPPDIVR  675

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RYD+LR +  RVQT++GDLATQGER+Q+L++WRDPRAT +F+  CF+ A +LY+ P ++
Sbjct  676   MRYDRLRSVAGRVQTVVGDLATQGERMQSLLSWRDPRATALFVIFCFIAAIVLYVTPFRV  735

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A+  G Y LRHP FR R+PS  LNFFRRLP+  D +L
Sbjct  736   VALLTGLYVLRHPRFRHRLPSVPLNFFRRLPARTDSLL  773



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/764 (51%), Positives = 525/764 (69%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S+ DLVE+M YL+V++VKAR LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STHDLVEQMQYLYVRVVKARDLPAKDVTGSCDPYVEVKLGNYRGTTRHFEKKTNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   SS+ LE++V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRLQSSN-LEVTVKD----------KDFVKDDFIGRVMFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   A+K  G+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  139   PQWYRLEDRQANKVKGELMLAVWMGTQADEAFPEAWHSDAAAVSGAEGLANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +S F    +K  LG Q  KT+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLI----PSDKSRFPEVFVKVMLGHQALKTRVSMSKTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  +ERR+D + + SRW+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLHQLERRLDHKPINSRWYNLEKYVTV  313

Query  1742  -QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              + E+KR  K   R+H R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  314   VEGEKKREIKFASRIHTRICLEGGYHVLDESTHYSSDLRPTAKQLWKSTIGVLELGILNA  373

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + L PMKT  G+ +TDAY VAKYG KWVRTRTI DN  PRWNEQYTW VYDP TV+TIGV
Sbjct  374   QGLSPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDNFTPRWNEQYTWEVYDPCTVITIGV  433

Query  2093  FDSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +   + S   +D+R+GKVRIR+STL T +VY + + L++L+P+G+KKMGEI LAV
Sbjct  434   FDNCHLQGGDKSGGTRDLRIGKVRIRLSTLETERVYTHVYPLLVLNPSGVKKMGEIHLAV  493

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YSQP+LP MH+I PL   Q + LR  A ++++  LSR+EPPLR+EV
Sbjct  494   RFTCSS-LLNMMHLYSQPLLPKMHYIYPLTVSQLDILRHQATQIVSMRLSRAEPPLRKEV  552

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V+  +I V KW D    W+NP  T+L+H L ++L
Sbjct  553   VEYMLDVGSHMWSMRRSKANFFRIMGVLGGLIAVGKWFDQICNWKNPITTVLIHILFLIL  612

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W YR+R R+   H DT++S A++   DELDEEFD+ P +R
Sbjct  613   VLYPELILPTIFLYLFLIGVWYYRWRPRNP-PHMDTRLSCADNAHPDELDEEFDSFPTSR  671

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  672   PADIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  731

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   VTPFQVVALLTGFYVLRHPRFRYKLPSVPLNFFRRLPARTDCML  775



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/763 (50%), Positives = 528/763 (69%), Gaps = 45/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      ++   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKELPNMDITGSCDPYVEVKLGNYKGQTQHFEKKNNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS++EI V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKER-IQSSVVEIVVKD----------KDLVKDDFIGRVIFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  141   PQWYRLEDRNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASVPGDGLASIRSKVYLTPK  200

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P+  + F    +KA LG QV +T+ A S T +P WNEDL+F
Sbjct  201   LWYLRVNVIEAQDLI----PNDRARFPEVYVKAMLGNQVLRTR-APSRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  V+G   I L  + RR+D R + S+W+  E      
Sbjct  256   VAAEPFEEH-LILSVEDRVAPGKDEVIGRTMISLHHVPRRLDHRLLTSQWYNLEKHVIID  314

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+ LWKP +G +ELGI+  +
Sbjct  315   GEQKKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKPLWKPSIGMLELGILTAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TVVTIGVF
Sbjct  374   GLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVYDPCTVVTIGVF  433

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+G+VRIR+STL T +VY +++ LI+L+P G+KKMGE++LAVR
Sbjct  434   DNCHLNGGEKVNGARDTRIGRVRIRLSTLETDRVYTHSYPLIVLTPGGVKKMGEVQLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+Y+QP+LP MH++ PL  +Q ++LR  A  +++T L R+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHLYTQPLLPKMHYVHPLSVMQVDNLRRQATNIVSTRLGRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI++V++ ++ V KW D    WRNP  TIL+H L ++LV
Sbjct  553   EYMLDVDSHMWSMRKSKANFFRIMSVLSPLVAVTKWFDQICRWRNPLTTILIHVLFMILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AE+   DELDEEFD  P +RP
Sbjct  613   LYPELILPTVFLYLFLIGVWYYRWRLRQP-PHMDTRLSHAETAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CFV A +LY+
Sbjct  672   PDVVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR +MPS  LNFFRRLP+  D ML
Sbjct  732   TPFRVVVFLAGLYMLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>gb|AAD55273.1|AC008263_4 Similar to gb|D86180 phosphoribosylanthranilate transferase from 
Pisum sativum and contains 2 PF|00168 C2 (phospholipid binding) 
domains. ESTs gb|H76726, gb|T45544 and gb|N96377 come 
from this gene [Arabidopsis thaliana]
Length=1276

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/741 (53%), Positives = 514/741 (69%), Gaps = 56/741 (8%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvs-----gshvisRPARKTLLFEWDQTFA  1072
             ++LVE M YLFV+IVKAR LP      VKV  S         ++RP       EW+Q FA
Sbjct  328   YNLVEPMQYLFVRIVKARGLPPNESAYVKVRTSNHFVRSKPAVNRPGESVDSPEWNQVFA  387

Query  1073  FGRDAPDSS---SILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              G +  DS+   + LEIS WD             +  +FLGG+CFD+SE+P+RDPPDSPL
Sbjct  388   LGHNRSDSAVTGATLEISAWD------------ASSESFLGGVCFDLSEVPVRDPPDSPL  435

Query  1244  APQWYRLEGGGAHK------GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPK  1405
             APQWYRLEG GA +      GD+ L+ W+GTQ DE+FP+AW +D      +RSKVYQSPK
Sbjct  436   APQWYRLEGSGADQNSGRISGDIQLSVWIGTQVDEAFPEAWSSDAPHVAHTRSKVYQSPK  495

Query  1406  LWYLRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPAS--SATGSPSWN  1561
             LWYLR +V+EAQD+        LTAP      ++KAQLGFQ  +T+  S  + +GS  W+
Sbjct  496   LWYLRVTVLEAQDLHIAPNLPPLTAPE----IRVKAQLGFQSARTRRGSMNNHSGSFHWH  551

Query  1562  EDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED  1741
             ED++FVA EP  +   L  ++E    KE  +LG A IP+SSIE+R+D+R V S+W T E 
Sbjct  552   EDMIFVAGEPLED--CLVLMVEDRTTKEATLLGHAMIPVSSIEQRIDERFVPSKWHTLEG  609

Query  1742  QNEEKRV------------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVG  1885
             +                  Y GR+ LRLC +GGYHV+EEAAH+CSD+RPTA+QLWKPP+G
Sbjct  610   EGGGGGGGGGPGGGGGGGPYCGRISLRLCLEGGYHVLEEAAHVCSDFRPTAKQLWKPPIG  669

Query  1886  TVELGIIGCKNLLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVY  2062
              +ELGI+G + LLPMK   G KGSTDAY VAKYG KWVRTRTI+D+  PRW+EQYTW+VY
Sbjct  670   ILELGILGARGLLPMKAKNGGKGSTDAYCVAKYGKKWVRTRTITDSFDPRWHEQYTWQVY  729

Query  2063  DPSTVVTIGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLK  2236
             DP TV+T+GVFD+W +     ++  D R+GK+RIR+STL + KVY N++ L++L P+G+K
Sbjct  730   DPCTVLTVGVFDNWRMFSDASDDRPDTRIGKIRIRVSTLESNKVYTNSYPLLVLLPSGMK  789

Query  2237  KMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSR  2416
             KMGEIE+AVRF   +   D    Y QP+LP MH+IRPLG  QQ++LR AA K++   L+R
Sbjct  790   KMGEIEVAVRFACPSLLPDVCAAYGQPLLPRMHYIRPLGVAQQDALRGAATKMVAAWLAR  849

Query  2417  SEPPLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATI  2596
             +EPPL  EVV YMLDADSH++SMRK +ANW+RI+ V+A  + + KW D+ R WRNP  T+
Sbjct  850   AEPPLGPEVVRYMLDADSHAWSMRKSKANWYRIVGVLAWAVGLAKWLDNIRRWRNPVTTV  909

Query  2597  LVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDE  2776
             LVH L ++LVW+PDL++PT   YV MIG W YRFR +      D ++S AE++D DELDE
Sbjct  910   LVHILYLVLVWYPDLVVPTAFLYVVMIGVWYYRFRPKIPAG-MDIRLSQAETVDPDELDE  968

Query  2777  EFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIAL  2956
             EFD +P +R  +++RARYD+LR+L  RVQT+LGD A QGER+QALV+WRDPRAT +FIA+
Sbjct  969   EFDTIPSSRRPEVIRARYDRLRILAVRVQTILGDFAAQGERIQALVSWRDPRATKLFIAI  1028

Query  2957  CFVVAFILYLVPSKMIAMAFG  3019
             C V+  +LY VP+KM+A+A G
Sbjct  1029  CLVITIVLYAVPAKMVAVALG  1049


 Score =   165 bits (417),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  146  ERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKH  325
            +RKL+VEV+EARN+LPKDG G+SS YVV+DF  Q+K+T T  RDLNP WNEML+F +S  
Sbjct  16   QRKLVVEVVEARNILPKDGQGSSSAYVVVDFDAQKKRTSTKFRDLNPIWNEMLDFAVSDP  75

Query  326  SDIFGDMLELDVYHDKNVGPTT--RNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             ++  D L+++VY+DK  G     +N+FLGRVK+  +QF ++GEE L+Y+PLE+K++ SW
Sbjct  76   KNMDYDELDIEVYNDKRFGNGGGRKNHFLGRVKIYGSQFSRRGEEGLVYFPLEKKSVFSW  135

Query  500  IQGDIGLKIYFVD  538
            I+G+IGLKIY+ D
Sbjct  136  IRGEIGLKIYYYD  148



>gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/764 (51%), Positives = 528/764 (69%), Gaps = 42/764 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LPT        P V+V V     I++   K    EW++ 
Sbjct  278   STYDLVEQMRYLFVRVVKARDLPTMDVTGSLDPYVEVRVGNYKGITKYFEKQQNPEWNEV  337

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    SS+LE+ V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  338   FAFARERM-QSSVLEVVVKD----------KDLVKDDFVGIVRFDMNEIPTRVPPDSPLA  386

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----------RSK  1387
             P+WYRLE   G   KG+LMLA W GTQADE+FPDAW +D A  PT            RSK
Sbjct  387   PEWYRLEDKKGDKVKGELMLAVWYGTQADEAFPDAWHSD-AVTPTDSSSSSAISTHIRSK  445

Query  1388  VYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNED  1567
             VY SP+LWY+R +VIEAQD+  L+  ++     IK Q+G QV KTK   + T +P WNED
Sbjct  446   VYHSPRLWYVRVNVIEAQDL-VLSDRNRFPDAYIKVQIGNQVLKTKTVQTRTMNPVWNED  504

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +   +G   IPL+S+ERR DDR + SRWF  E   
Sbjct  505   LMFVAAEPFEDH-LILSVEDRVGPNKDESIGKVVIPLNSVERRADDRIIRSRWFNLEKSI  563

Query  1739  ----DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                 D+++ K+  +  R+HLR+  DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG+
Sbjct  564   SAAMDEHQAKKDKFSSRLHLRIVLDGGYHVLDESTHHSSDLRPTAKQLWKPSIGVLELGV  623

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG++D Y VAKYG KW+RTRTI ++L P++NEQYTW VYD +TV+T
Sbjct  624   LNADGLHPMKTREGKGTSDTYCVAKYGHKWIRTRTIINSLSPKYNEQYTWEVYDTATVLT  683

Query  2084  IGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             +GVFD+ ++     +KDV++GKVRIR+STL TG+VY +++ L++L P+G+KKMGEI LA+
Sbjct  684   VGVFDNSQIGGSNGNKDVKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGEIHLAI  743

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S    + + +YS+P+LP MH++RPL  +QQ+ LR  AV ++   LSR+EPPLRREV
Sbjct  744   RF-SSASLANMMFLYSRPLLPKMHYVRPLTVMQQDMLRHQAVNIVAARLSRAEPPLRREV  802

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM DADSH +SMR+ +AN+FR+++V + +  V KW  +   WRNP  T+LVH L V+L
Sbjct  803   VEYMSDADSHLWSMRRSKANFFRLMSVFSGLFAVGKWFGEVCMWRNPITTVLVHLLFVML  862

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V FP+LI+PT   Y+F+IG WNYRFR R    H +T+IS A+++  DELDEEFD  P TR
Sbjct  863   VCFPELILPTVFLYMFLIGLWNYRFRPRYP-PHMNTRISCADAVHPDELDEEFDTFPTTR  921

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               ++VR RYD+LR +  R+QT++GD+ATQGER+Q+L++WRDPRAT IF+  C V A +LY
Sbjct  922   SAEIVRMRYDRLRSVAGRIQTVVGDMATQGERIQSLLSWRDPRATAIFVTFCLVAAIVLY  981

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               P +++A+  GFY++RHP FR R PS  +NFFRRLP+  D ML
Sbjct  982   ATPFQVLALVGGFYHMRHPRFRHRTPSAPINFFRRLPARTDSML  1025


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 82/132 (62%), Gaps = 8/132 (6%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G++S +V + F  Q+ +T    +DLNP WNE   FN+S  ++
Sbjct  5    KLGVEVVSAHDLMPKDGQGSASAFVELHFDHQKFRTTIKEKDLNPVWNENFYFNVSDPNN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNN---FLGRVKLNATQFVKKGEEALIYYPLERKNLLSWI  502
            +    LE  VY+      T  NN   FLG+V+L  T FV   +  +++YPLE++ + S +
Sbjct  65   LSNLTLEAYVYNH-----TKENNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRGIFSRV  119

Query  503  QGDIGLKIYFVD  538
            +G++GLK++  D
Sbjct  120  KGELGLKVFVTD  131



>ref|XP_002978420.1| hypothetical protein SELMODRAFT_109101 [Selaginella moellendorffii]
 gb|EFJ20406.1| hypothetical protein SELMODRAFT_109101 [Selaginella moellendorffii]
Length=1001

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/751 (50%), Positives = 526/751 (70%), Gaps = 33/751 (4%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSL--PTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFG  1078
             ++DLVEKM+YLFV++VKAR+L    +G    ++V       ++   K+L  EW + FAF 
Sbjct  270   TYDLVEKMNYLFVKVVKARALMESGSGSSYARIVFGSLTAKTKEVGKSLFPEWHEVFAFS  329

Query  1079  RDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWY  1258
             +D   +  ++E+S+WD  + +            F+G + FD+ EIP R PPDSPLAPQWY
Sbjct  330   KDN-SAGPVVEVSIWDHETDQ------------FMGAVGFDLQEIPFRVPPDSPLAPQWY  376

Query  1259  RLEGGGAH-----KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             RLE    +     +GD+MLA W GTQADE+F +AW++D+ G   +R+KVY SPKLWYLR 
Sbjct  377   RLENISKNAEKKVRGDVMLAIWWGTQADEAFTEAWQSDSGGYAHTRAKVYLSPKLWYLRV  436

Query  1424  SVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPF  1594
             +VIEAQ++     P   + F    ++AQLGFQ+ KTK AS+   SP WNEDL+FVA+EPF
Sbjct  437   NVIEAQEV----QPMDRTRFPEVSVRAQLGFQIYKTKVASNRNTSPQWNEDLLFVASEPF  492

Query  1595  TEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGR  1774
              +  LL    +   P E+ VLG+  I L+ IE+R+D RQV S+WF     N   + + GR
Sbjct  493   EDELLLVVQNKTAKPNEEEVLGMVKIALAGIEKRIDHRQVNSKWFDLVRYNGGDKHFHGR  552

Query  1775  VHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGS  1954
             +HLRLCFDGGYHV++EA H  S  RPTA+QLW+P VG +ELGII  K++ PMKT+ G+G+
Sbjct  553   LHLRLCFDGGYHVMDEATHYSSCVRPTAKQLWRPVVGVLELGIIRGKDVHPMKTVDGRGA  612

Query  1955  TDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI-DPENSK  2131
             TDAY VAKYG KWVRTRTI DNL PRWNEQY+W VYDP TV+T+GVFD+  V   PE  K
Sbjct  613   TDAYCVAKYGQKWVRTRTIVDNLNPRWNEQYSWEVYDPCTVLTVGVFDNCHVHPHPEGGK  672

Query  2132  DVR---MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLH  2302
             D++   +GKVRIR+STL + ++Y N+  L++L  +G++K+GEIELAVR+  S   +  + 
Sbjct  673   DLKDLQIGKVRIRLSTLESERIYTNSHPLLMLQRSGVRKLGEIELAVRY-SSVSIVSVMG  731

Query  2303  VYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFS  2482
             +Y +P+LP MH++ PLG  Q E LR +A++L+   L+RSEPPLR+EVV +MLDAD H +S
Sbjct  732   LYFRPLLPKMHYLHPLGVTQSEILRISAMRLVAIRLNRSEPPLRQEVVQFMLDADFHVWS  791

Query  2483  MRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAF  2662
             +R+ + N+FRI+N++A  + V  W  +   W+NP  T+LVH L ++LV FP+LI+PT   
Sbjct  792   LRRSKVNYFRIMNLLAGPMAVGTWFHNICHWKNPVTTLLVHILFLILVMFPELILPTLFL  851

Query  2663  YVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLR  2842
             Y+ +IGAW YR+R R   +  D K+S AE ++ DELDEEFD +P  +   +V+ARYD+LR
Sbjct  852   YLSLIGAWRYRYRPRSPPS-MDGKLSQAEQVEPDELDEEFDPIPTNKDPSVVKARYDRLR  910

Query  2843  MLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGF  3022
             ++ +R+Q +LGD+ATQGER+ AL++WRDPRA+GI +A+C  +A  LY+VP ++I +  G 
Sbjct  911   IVSSRIQHVLGDIATQGERLTALLSWRDPRASGIMVAVCMTIAIFLYVVPLRVIVVIVGL  970

Query  3023  YYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y LRHP FR+R+P   +NFFRRLPSLADR+L
Sbjct  971   YVLRHPKFRERLPGWPINFFRRLPSLADRIL  1001


 Score =   127 bits (319),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL VEV  A +L+PKDG G++S Y  ++F GQR+KT T  +DLNP WN ++EF + +  
Sbjct  3    RKLFVEVCNAADLMPKDGQGSASAYCTLEFDGQRRKTDTKAKDLNPVWNTVVEFPILEGK  62

Query  329  DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            ++  ++LEL V  +K  G   +  FLG+VK+     VKKGEEAL+YYPLE++++ S ++G
Sbjct  63   NLESEVLELSVLCEKR-GAQRKPGFLGKVKIPGRSIVKKGEEALVYYPLEKRSMFSQVKG  121

Query  509  DIGLKIYF  532
            +IGLK+++
Sbjct  122  EIGLKVWW  129



>ref|XP_010273065.1| PREDICTED: uncharacterized protein LOC104608707 [Nelumbo nucifera]
Length=1009

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/765 (50%), Positives = 529/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVEKM +LFV++VKAR LP         P V+V V     I++   K    EW++ 
Sbjct  264   STYDLVEKMQFLFVRVVKARELPAKDITGSLDPYVEVKVGNYKGITKHFEKKQNPEWNEV  323

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    SS+LE+ V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  324   FAFARERM-QSSVLEVVVKD----------KDLVKDDFVGILKFDLNEVPTRVPPDSPLA  372

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A             RSKVY 
Sbjct  373   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFPDAWHSDAATPADIAAAVSTHIRSKVYH  432

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +VIEAQD+     P  +S F    +K QLG QV KTK   + T SP WNE+
Sbjct  433   APRLWYVRVNVIEAQDVI----PGDKSRFPEVHVKVQLGNQVLKTKTVQARTMSPLWNEE  488

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
              +FV AEPF +H L+  + + + P +  V+G A IPL+S+E+R DDR + +RW+  E   
Sbjct  489   FLFVVAEPFEDH-LILSVEDRVGPNKDEVIGRAMIPLNSVEKRADDRPIHNRWYNLEKPV  547

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++ + +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+
Sbjct  548   AVDVDQLKKDK-FSTRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGILELGIL  606

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  GKG++D Y VAKYG KWVRTRTI ++ CPR+NEQYTW VYDP+TV+T+
Sbjct  607   NVDGLHPMKTREGKGTSDTYCVAKYGHKWVRTRTIINSPCPRYNEQYTWEVYDPATVLTV  666

Query  2087  GVFDSWEVIDP--ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +     +KD+++GKVRIRISTL TG+VY +T+ L++L P+G+KKMGE+ LA
Sbjct  667   GVFDNGQLGEKSGNGNKDMKIGKVRIRISTLETGRVYTHTYPLLVLHPSGVKKMGELHLA  726

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T  ++ +++YS+P+LP MH++RPL  +Q + LR  AV ++   LSR+EPPLR+E
Sbjct  727   IRF-SCTSLVNMMYIYSRPLLPKMHYVRPLTVLQLDMLRHQAVNIVAARLSRAEPPLRKE  785

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR++ V++ +  V KW  D R W+NP  T+LVH L V+
Sbjct  786   VVEYMSDVDSHLWSMRRSKANFFRLMTVLSGLFAVGKWFGDVRTWKNPITTVLVHVLYVM  845

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WNYR+R +    H +T+IS AE++  DELDEEFD  P +
Sbjct  846   LVCFPELILPTIFLYMFLIGIWNYRYRPQYP-PHMNTRISCAEAVHPDELDEEFDTFPTS  904

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  ++VR RYD+LR +  RVQT++GD+ATQGER+QAL++WRDPRAT IF+  C + A +L
Sbjct  905   RSPELVRMRYDRLRSVAGRVQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLIAALVL  964

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P +++A+  G Y +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  965   YVTPFQVVAVVAGIYLMRHPRFRHRLPSVPINFFRRLPAKTDSML  1009


 Score =   115 bits (287),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 85/129 (66%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NL+PKDG G+SS +V + F GQ+ +T T  RDLNP WNE   FN+S  S+
Sbjct  7    KLGVQVVSATNLMPKDGQGSSSAFVELHFDGQKFRTTTKERDLNPVWNETFYFNISDPSN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L+   Y++ N    TR +FLG+V+L  T FV   +  +++YPLE++ L S ++G+
Sbjct  67   VPNLALDAYAYNNINAATHTR-SFLGKVRLTGTSFVPYSDAVVLHYPLEKRGLFSRVKGE  125

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  126  LGLKVFITD  134



>ref|XP_002970262.1| hypothetical protein SELMODRAFT_93870 [Selaginella moellendorffii]
 gb|EFJ28392.1| hypothetical protein SELMODRAFT_93870 [Selaginella moellendorffii]
Length=1002

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/751 (50%), Positives = 526/751 (70%), Gaps = 33/751 (4%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSL--PTAGRPvvkvvvsgshvisRPARKTLLFEWDQTFAFG  1078
             ++DLVEKM+YLFV++VKAR+L    +G    ++V       ++   K+L  EW + FAF 
Sbjct  271   TYDLVEKMNYLFVKVVKARALMESGSGSSYARIVFGSLTAKTKEVGKSLFPEWHEIFAFS  330

Query  1079  RDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWY  1258
             +D   +  ++E+S+WD  + +            F+G + FD+ EIP R PPDSPLAPQWY
Sbjct  331   KDN-SAGPVVEVSIWDHETDQ------------FMGAVGFDLQEIPFRVPPDSPLAPQWY  377

Query  1259  RLEGGGAH-----KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             RLE    +     +GD+MLA W GTQADE+F +AW++D+ G   +R+KVY SPKLWYLR 
Sbjct  378   RLENISKNAEKKVRGDVMLAIWWGTQADEAFTEAWQSDSGGYAHTRAKVYLSPKLWYLRV  437

Query  1424  SVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAAEPF  1594
             +VIEAQ++     P   + F    ++AQLGFQ+ KTK AS+   SP WNEDL+FVA+EPF
Sbjct  438   NVIEAQEV----QPMDRTRFPEVSVRAQLGFQIYKTKVASNRNTSPQWNEDLLFVASEPF  493

Query  1595  TEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKGR  1774
              +  LL    +   P E+ VLG+  I L+ IE+R+D RQV S+WF     N   + + GR
Sbjct  494   EDELLLVVQNKTAKPNEEEVLGMVKIALAGIEKRIDHRQVNSKWFDLVRYNGGDKHFHGR  553

Query  1775  VHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKGS  1954
             +HLRLCFDGGYHV++EA H  S  RPTA+QLW+P VG +ELGII  K++ PMKT+ G+G+
Sbjct  554   LHLRLCFDGGYHVMDEATHYSSCVRPTAKQLWRPVVGVLELGIIRGKDVHPMKTVDGRGA  613

Query  1955  TDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVI-DPENSK  2131
             TDAY VAKYG KWVRTRTI DNL PRWNEQY+W VYDP TV+T+GVFD+  V   PE  K
Sbjct  614   TDAYCVAKYGQKWVRTRTIVDNLNPRWNEQYSWEVYDPCTVLTVGVFDNCHVHPHPEGGK  673

Query  2132  DVR---MGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDFLH  2302
             D++   +GKVRIR+STL + ++Y N+  L++L  +G++K+GEIELAVR+  S   +  + 
Sbjct  674   DLKDLQIGKVRIRLSTLESERIYTNSHPLLMLQRSGVRKLGEIELAVRY-SSVSIVSVMG  732

Query  2303  VYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHSFS  2482
             +Y +P+LP MH++ PLG  Q E LR +A++L+   L+RSEPPLR+EVV +MLDAD H +S
Sbjct  733   LYFRPLLPKMHYLHPLGVTQSEILRISAMRLVAIRLNRSEPPLRQEVVQFMLDADFHVWS  792

Query  2483  MRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAF  2662
             +R+ + N+FRI+N++A  + V  W  +   W+NP  T+LVH L ++LV FP+LI+PT   
Sbjct  793   LRRSKVNYFRIMNLLAGPMAVGTWFHNICHWKNPVTTLLVHILFLILVMFPELILPTLFL  852

Query  2663  YVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDKLR  2842
             Y+ +IGAW YR+R R   +  D K+S AE ++ DELDEEFD +P  +   +V+ARYD+LR
Sbjct  853   YLSLIGAWRYRYRPRSPPS-MDGKLSQAEQVEPDELDEEFDPIPTNKDPSVVKARYDRLR  911

Query  2843  MLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGF  3022
             ++ +R+Q +LGD+ATQGER+ AL++WRDPRA+GI +A+C  +A  LY+VP ++I +  G 
Sbjct  912   IVSSRIQHVLGDIATQGERLTALLSWRDPRASGIMVAVCMTIAIFLYVVPLRVIVVIVGL  971

Query  3023  YYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y LRHP FR+R+P   +NFFRRLPSLADR+L
Sbjct  972   YVLRHPKFRERLPGWPINFFRRLPSLADRIL  1002


 Score =   127 bits (318),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL VEV  A +L+PKDG G++S Y  ++F GQR+KT T  +DLNP WN ++EF + +  
Sbjct  3    RKLFVEVCNAADLMPKDGQGSASAYCTLEFDGQRRKTDTKAKDLNPVWNTVVEFPILEGK  62

Query  329  DIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            ++  ++LEL V  +K  G   +  FLG+VK+     VKKGEEAL+YYPLE++++ S ++G
Sbjct  63   NLESEVLELSVLCEKR-GAQRKPGFLGKVKIPGRSIVKKGEEALVYYPLEKRSMFSQVKG  121

Query  509  DIGLKIYF  532
            +IGLK+++
Sbjct  122  EIGLKVWW  129



>gb|KDO76051.1| hypothetical protein CISIN_1g042999mg, partial [Citrus sinensis]
Length=1006

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/737 (55%), Positives = 517/737 (70%), Gaps = 45/737 (6%)
 Frame = +2

Query  908   FDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARKTLLF-----EWDQTFA  1072
             +DLVE M YLFV+I KAR L     P VK+  S  +  S+ A           EW+Q FA
Sbjct  289   YDLVEPMMYLFVKIRKARGLVPNEAPYVKIRTSSHYKKSKLASYRACDPHDSPEWNQVFA  348

Query  1073  FGRDAPDS-SSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
                +  DS S+ LEI+VWD        PT      NFLGG+CFD+S++P+RDPPDSPLAP
Sbjct  349   LFHNKNDSVSATLEITVWD-------SPT-----ENFLGGVCFDLSDVPVRDPPDSPLAP  396

Query  1250  QWYRLEGGGAHK-----GDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             QWYRLEG  + +     GD+ LA W+GTQADE+FP+AW +D      +RSKVYQSPKLWY
Sbjct  397   QWYRLEGEASDQNNRVSGDIQLAVWIGTQADEAFPEAWSSDAPYVTHTRSKVYQSPKLWY  456

Query  1415  LRSSVIEAQDIF------ALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPS--WNEDL  1570
             LR +V+EAQD+        LTAP      ++KAQL  Q  +T+  S    S S  W+ED+
Sbjct  457   LRVTVMEAQDLCIAHNLPPLTAPE----IRVKAQLALQSARTRRGSMNNHSSSFHWHEDV  512

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQA--VLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
              FVAAEPF +   L  L+E    K+ A  +LG A +P+SSI++R+D+R V S+WF  E  
Sbjct  513   FFVAAEPFEDS--LILLVEDRTAKDAAAVILGHAVVPVSSIDQRIDERHVASKWFPLEGS  570

Query  1745  NEE--KRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                   R Y GR+ L+LC +GGYHV++EAAH+CSD+RPTA+QLWKPPVG +ELGI+G + 
Sbjct  571   CGRGCARSYCGRIQLKLCLEGGYHVLDEAAHVCSDFRPTAKQLWKPPVGILELGILGARG  630

Query  1919  LLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMKT  G KGSTDAY VAKYG KWVRTRTI+D   PRWNEQYTW+VYDP TV+T+GVF
Sbjct  631   LLPMKTKNGGKGSTDAYCVAKYGKKWVRTRTITDCFDPRWNEQYTWQVYDPCTVLTVGVF  690

Query  2096  DSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             D+W +     E   D R+GK+RIR+STL   KVY  ++ L++L   GLKKMGEIELAVRF
Sbjct  691   DNWRMFADASEERPDYRIGKIRIRVSTLENNKVYTTSYPLLVLLRTGLKKMGEIELAVRF  750

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
             +  +   +   VY QP+LP MH++RPLG  QQE+LR AA K++   L RSEPPL  EVV 
Sbjct  751   VCPSMLPETSSVYGQPLLPRMHYLRPLGVAQQEALRGAATKMVAAWLDRSEPPLGPEVVR  810

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLDADSH++SMRK +ANWFRI+ V+A  I + KW  + R W+NP  T+LVH L ++LVW
Sbjct  811   YMLDADSHAWSMRKSKANWFRIVAVLAWAIGLAKWLHNIRRWKNPVTTVLVHVLYLVLVW  870

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +PDLI+PT   YV +IG W YRFR +   +  DT++S AE++D DELDEEFD +P ++P 
Sbjct  871   YPDLIVPTGFLYVVLIGVWYYRFRPKIP-SGMDTRLSQAETVDPDELDEEFDTIPSSKPP  929

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             +++R RYD+LRML ARVQT+LGD ATQGERVQALV+WRDPRAT +FI +C V+  +LY+V
Sbjct  930   EIIRMRYDRLRMLAARVQTVLGDFATQGERVQALVSWRDPRATKLFIGVCTVITLVLYVV  989

Query  2990  PSKMIAMAFGFYYLRHP  3040
             P KM+A+A GFYYLRHP
Sbjct  990   PPKMVAVALGFYYLRHP  1006


 Score =   164 bits (415),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  143  TERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSK  322
            T RKL+VEV++AR+LLPKDG G+SSPYV+ DF GQRK+T T  RDLNP WNE LEF +S 
Sbjct  14   TVRKLVVEVVDARDLLPKDGQGSSSPYVIADFDGQRKRTSTKFRDLNPVWNEPLEFIVSD  73

Query  323  HSDIFGDMLELDVYHDKNV--GPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
              ++  + LE++VY+DK    G   +N+FLGRVKL  +QF ++G+E L+Y+PLE+K++ S
Sbjct  74   PKNMDCEELEIEVYNDKRYCNGSGRKNHFLGRVKLCGSQFARRGDEGLVYFPLEKKSVFS  133

Query  497  WIQGDIGLKIYFVD  538
            WI+G+IGL+IY+ D
Sbjct  134  WIRGEIGLRIYYYD  147



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/763 (50%), Positives = 529/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP-----TAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  29    STYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQV  88

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS+LE++V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  89    FAFSKDRI-QSSVLEVTVKD----------KDFVKDDFMGRVLFDLNEIPKRVPPDSPLA  137

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   +G+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  138   PQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSP  197

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P+ +  F    +KAQLG Q  +T+ ++S T +P WNEDL+
Sbjct  198   KLWYLRVNVIEAQDL----QPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLM  253

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF EH L+  + + + P +  VLG   IPL  +++R+D + V +RW+  E     
Sbjct  254   FVAAEPFEEH-LILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVV  312

Query  1742  QNEEKR--VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+   +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  313   EGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQ  372

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  373   GLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVF  432

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   +    ++D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  433   DNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVR  492

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL   Q +SLR  A ++++  LSR+EPPLR+EVV
Sbjct  493   FTCSS-LLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVV  551

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++LV
Sbjct  552   EYMLDVGSHMWSMRRSKANFFRIMGVLSGIIAVGKWFDQICNWKNPITTVLIHILFIILV  611

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP
Sbjct  612   LYPELILPTVFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRP  670

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  671   SDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYV  730

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  731   TPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  773



>gb|ABR16393.1| unknown [Picea sitchensis]
Length=758

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/767 (50%), Positives = 523/767 (68%), Gaps = 44/767 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE M YL+V++VKAR LP      +  P V+V V      ++   KT    W Q 
Sbjct  7     STYDLVEHMQYLYVRVVKARDLPAMDIGGSCDPYVEVKVGNYKGTTKHFEKTANPVWKQV  66

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S LE+ V D           D+   +F+G I FD+ E+P R PPDSPLA
Sbjct  67    FAFSKDR-TPASFLEVVVKD----------KDLVKDDFIGRIGFDLLEVPTRVPPDSPLA  115

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G G  KG+LMLA W+GTQADE+F +AW +D A     G   +RSKVY SP
Sbjct  116   PQWYRLEDKKGEGKVKGELMLAVWLGTQADEAFSEAWHSDAAAVHSDGLVNTRSKVYLSP  175

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPA-SSATGSPSWNEDLVFV  1579
             KLWY+R +VIEAQD+   +  +K   FQ+K QLG Q  KTKPA  S   SP WNE+L+FV
Sbjct  176   KLWYVRVNVIEAQDLIP-SDKTKFPDFQVKVQLGNQTGKTKPAVPSRNMSPFWNEELLFV  234

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + L P ++ ++G A IPL+ +++R+D +  I RWF+ E       
Sbjct  235   AAEPFEDH-LILTVEDRLGPNKEEIMGRAIIPLNLVDKRLDHKTAIPRWFSLEKPAVAAA  293

Query  1739  --DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
               D  +++  +  R+ LRL  DGGYHV++E+ H  SD RPT + LWK  +G +++GI+  
Sbjct  294   EGDSKKKEVKFASRIFLRLSLDGGYHVLDESTHYSSDLRPTHKHLWKSYIGILQVGILSA  353

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             +NLLPMKT  G+G+TDAY VAKYG KWVRTRT+ D L P+WNEQYTW VYDP TV+T+GV
Sbjct  354   QNLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTLIDTLNPKWNEQYTWEVYDPCTVITVGV  413

Query  2093  FDSWEVIDPENS------KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             FD+  +   E        KD R+GKVRIR+STL T +VY + + L++L P+G+KKMGE+ 
Sbjct  414   FDNCHLQGGEKEKSAASPKDARIGKVRIRLSTLETDRVYTHAYPLLVLHPSGVKKMGELH  473

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             LAVRF  S+  ++ +H+Y+QP+LP MH++ PL   Q E+LR  A++++   LSR+EPPLR
Sbjct  474   LAVRFSCSS-LMNMMHIYTQPLLPKMHYLHPLSVQQLEALRYQAMQIVAMRLSRAEPPLR  532

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
             REVV YMLD DSH +SMR+ +AN+FRI+NV+AA+  V +W  D   W+NP  T+LVH L 
Sbjct  533   REVVEYMLDVDSHMWSMRRSKANFFRIMNVLAALTAVGRWFSDICLWKNPVTTVLVHILF  592

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             ++L+W+P+LI+PT   Y+F+IG W +RFR R    H DT++S AE +  DELDEEFD  P
Sbjct  593   LILIWYPELILPTVFLYMFLIGIWQFRFRPRHP-PHMDTRLSHAELVHPDELDEEFDTFP  651

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              T+ +D+VR RYD+LR +  R+QT++GD+ATQGER+Q L++WRDPRAT IF+  C + A 
Sbjct  652   STKSSDIVRMRYDRLRSVAGRIQTVVGDMATQGERLQHLLSWRDPRATTIFVIFCLIAAI  711

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ILY  P ++IA+ F  Y LRHP FR R+PS  LNFFRRLP+ +D ML
Sbjct  712   ILYTTPFQVIAVVFVMYVLRHPRFRHRLPSAPLNFFRRLPARSDSML  758



>ref|NP_001043430.2| Os01g0587300 [Oryza sativa Japonica Group]
 dbj|BAB89913.1| putative phosphoribosyltransferase [Oryza sativa Japonica Group]
 gb|EAZ12501.1| hypothetical protein OsJ_02397 [Oryza sativa Japonica Group]
 dbj|BAF05344.2| Os01g0587300 [Oryza sativa Japonica Group]
Length=1080

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/765 (53%), Positives = 544/765 (71%), Gaps = 42/765 (5%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQTF  1069
             +SS+DLVE M YLFV++VK R +     P VK+      + SRP R    T   EW+Q F
Sbjct  332   QSSYDLVEPMRYLFVRVVKVRGIRACEGPYVKIQAGPHTLRSRPGRDVSGTGNPEWNQVF  391

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             A     P+ +  LEISVWD  +   ++         FLGG+CFD+S++P+RD PD PLAP
Sbjct  392   AINHAKPEPT--LEISVWDGGAPSPIE--------AFLGGVCFDLSDVPVRDQPDGPLAP  441

Query  1250  QWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             QWYRLEGG  G   GD+M+A W+GTQADE+FP+AW TD      +RSKVYQSPKLWYLR+
Sbjct  442   QWYRLEGGEPGMVTGDIMVAVWIGTQADEAFPEAWNTDAPYAAYTRSKVYQSPKLWYLRA  501

Query  1424  SVIEAQDIFALTAPSKESSF--QIKAQLGFQVQKTKP--ASSATGSP-SWNEDLVFVAAE  1588
             SVIEAQD+  + AP     F  ++K Q+GFQ  +T+   AS ++GS  +W EDL+FV +E
Sbjct  502   SVIEAQDL-RVPAPPPGLPFDVRVKIQVGFQSARTRRSVASRSSGSAFAWEEDLMFVVSE  560

Query  1589  PFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFEDQNEEKRV-  1762
             P  E  L+  + +    KE A+LG A+IP++S+E+R+ +RQ++ SRWF+ E    +  + 
Sbjct  561   PLDES-LVVLVEDRSMIKEPALLGHATIPVNSVEQRLHERQLVASRWFSLEGGTSDIGIG  619

Query  1763  --------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                     Y GR+HLRLC +GGYHV++EAAH+CSDYRPTA+QLW+PPVG +ELGIIG   
Sbjct  620   PGGGPPGFYSGRLHLRLCLEGGYHVLDEAAHVCSDYRPTAKQLWRPPVGVLELGIIGACG  679

Query  1919  LLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMKT  G KGSTDAY VAKYG KWVRTRT++D+L PRWNEQYTW+VYDP TV+T+ VF
Sbjct  680   LLPMKTKGGAKGSTDAYCVAKYGKKWVRTRTVTDSLNPRWNEQYTWQVYDPCTVLTVAVF  739

Query  2096  DSWEVI-----DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             D+W +        E  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE++LA
Sbjct  740   DNWRMFAFAGAGDEQRQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEVQLA  799

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF       D    Y+ P+LP MH++RP+G  QQE+LR AAV+++   L RSEPPL RE
Sbjct  800   VRFTSPAHLPDTWATYTSPLLPRMHYLRPIGVAQQEALRAAAVRVVAAWLERSEPPLGRE  859

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV +MLD D+H++S+R+ +ANWFRI+ V+A  + + +W D  + WR+P  T+LVH L ++
Sbjct  860   VVRHMLDVDAHTWSVRRAKANWFRIMGVLAWAVGLARWLDSVQRWRSPPTTVLVHVLYLV  919

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LVW+P+L +PT + YVF+IG W YRFR R      D ++S A++++ D+L+EEFDAVP  
Sbjct  920   LVWYPELAVPTASLYVFLIGVWYYRFRPRGPAG-MDARLSQADTVEADDLEEEFDAVP--  976

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
              P +++RARY++LR L  RVQ ++GD+A QGERVQALV+WRDPRA+ IF+ +C  VA  L
Sbjct  977   -PPEVLRARYERLRTLAGRVQRVMGDVAAQGERVQALVSWRDPRASRIFVGVCLAVAVAL  1035

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y +PSKM+A+A GFYYLRHP+FRD MP  A+NFFRRLPSL+DRML
Sbjct  1036  YAMPSKMVAVAGGFYYLRHPMFRDPMPPAAVNFFRRLPSLSDRML  1080


 Score =   157 bits (396),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 7/141 (5%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   R+L VEV++AR+L+PKDG G SS + V+DF GQRK+TRTV RDL+PQW+E LEF +
Sbjct  21   MRVARRLAVEVVDARDLVPKDGLGTSSAFAVVDFDGQRKRTRTVPRDLSPQWHERLEFAV  80

Query  317  SKHSDIFGDMLELDVYHDKNVGPT-------TRNNFLGRVKLNATQFVKKGEEALIYYPL  475
               + +  + L++ +YHD+   P+        +N+FLGRV++  +QF ++GEE ++Y+PL
Sbjct  81   HDPAAMHAEALDVSLYHDRRFNPSGGGGGGGGKNHFLGRVRIYGSQFSRRGEEGIVYFPL  140

Query  476  ERKNLLSWIQGDIGLKIYFVD  538
            E+++LLSWI+G++GLKIY+ D
Sbjct  141  EKRSLLSWIRGEVGLKIYYYD  161



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/763 (50%), Positives = 526/763 (69%), Gaps = 44/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    TTYDLVEQMQYLYVRVVKAKELPAKDLTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +S++EI V D           D    +++G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKER-IQASVVEIIVKD----------KDFVKDDYIGRVMFDLNEVPKRVPPDSPLA  139

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNP-----TSRSKVYQSPK  1405
             PQWYRLE    HK  G+LMLA W+GTQADE+FP+AW +D A  P     + RSKVY +PK
Sbjct  140   PQWYRLEERNGHKVKGELMLAVWMGTQADEAFPEAWHSDAASIPGDGLASIRSKVYLTPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     P+ ++ F    +KA LG Q  +T+ +   T +P WNEDL+F
Sbjct  200   LWYLRVNVIEAQDLI----PNDKTRFPEVYVKAMLGNQALRTRVSPGRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  V+G   I L  + RR+D + + S+W+  E      
Sbjct  256   VAAEPFEEH-LILSVEDRIAPGKDDVIGRTVISLQHVARRLDHKLLNSQWYNLEKHVMVD  314

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              +Q +E + +  R+HLR+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  315   GEQRKETK-FSSRIHLRICLEGGYHVLDESTHYSSDLRPTAKQLWKHNIGVLELGILTAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMKT  G+G+TD Y VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLLPMKTKDGRGTTDPYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVHDPCTVITIGVF  433

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E    ++D R+GKVRIR+STL T +VY +++ LI+L+PAG+KKMGE++LAVR
Sbjct  434   DNCHLNGGEKANGARDTRIGKVRIRLSTLETDRVYTHSYPLIVLTPAGVKKMGEVQLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ + +YSQP+LP MH+I PL  +Q ++LR  A  +++T LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMTLYSQPLLPKMHYIHPLSVIQVDNLRRQATNIVSTRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMRK +AN+FRI+ V++ +I V +W D    WRNP  TIL+H L V+LV
Sbjct  553   EYMLDVDSHMWSMRKSKANFFRIMGVLSPLIAVARWFDQICHWRNPLTTILIHVLFVILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+RSR    H DT++S AE+   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRSRQP-PHMDTRLSHAETAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  CF+ A +LY+
Sbjct  672   PDIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    G Y LRHP FR +MPS  LNFFRRLP+  D ML
Sbjct  732   TPFRVVVFLAGLYTLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>gb|EYU23487.1| hypothetical protein MIMGU_mgv1a000757mg [Erythranthe guttata]
Length=993

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/759 (50%), Positives = 523/759 (69%), Gaps = 39/759 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLVEKMH+LFV++VKAR LP         P V+V +     I++   K     W+  F
Sbjct  252   TYDLVEKMHFLFVRVVKARELPAMDVTGSLDPYVEVKIGNYKGITKHIEKQQNPMWNVVF  311

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF R+    +S+LE+ V D           D+   +F+G + FD++E+P+R PPDSPLAP
Sbjct  312   AFSRERM-QASVLEVVVKD----------KDILKDDFVGFVRFDLNEVPMRVPPDSPLAP  360

Query  1250  QWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTD--------TAGNPTSRSKVYQS  1399
             +WYRLE   G   +G+LMLA W+GTQADE+FPDAW +D        +A +   RSKVYQ+
Sbjct  361   EWYRLEDKKGEKIRGELMLAVWIGTQADEAFPDAWHSDAASPLDSSSAASALIRSKVYQA  420

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +V+EAQD+  L       ++ +KAQ+G QV +TKP  S   +P WNEDL FV
Sbjct  421   PRLWYVRVNVVEAQDLIPLEKTRFPDAY-VKAQIGNQVMRTKPVQSRNFNPLWNEDLFFV  479

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  V+G   IPL+ +E+R DDR + SRWF  E       
Sbjct  480   AAEPFEDH-LVLTVEDRVAPGKDEVIGRVIIPLNMVEKRADDRVIHSRWFNLEKPVLVDV  538

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++++ +  ++HLR+C DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELGI+    
Sbjct  539   DQLKKEK-FSSKLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPPIGVLELGILNAVG  597

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KW+RTRTI DNL P++NEQYTW V+DP+TV+T+G+FD
Sbjct  598   LHPMKTRDGKGTSDTYCVAKYGHKWIRTRTIVDNLFPKYNEQYTWEVFDPATVLTVGIFD  657

Query  2099  SWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             + + +  E  KDV++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+RF   
Sbjct  658   NSQ-LSGEKGKDVKIGKVRIRISTLQTGRIYTHSYPLLVLHPTGVKKMGELHLALRF-SC  715

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             T   + L+ YS+P+LP MH++RP   VQ + LR  AV ++ T L RSEPPLR+EVV YM 
Sbjct  716   TSFANMLYTYSRPLLPKMHYVRPFTVVQLDMLRHQAVNIVATRLGRSEPPLRKEVVEYMS  775

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D DSH +SMR+ +AN+FR+++V A +    KW  D   WRNP  T+LVH L ++LV FP+
Sbjct  776   DVDSHLWSMRRSKANFFRMMSVFAGIFSAGKWIGDICTWRNPITTVLVHLLYLMLVSFPE  835

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG WN+RFR R    H +TKIS AE++  DELDEEFD  P +R  D+V
Sbjct  836   LILPTVFLYMFLIGVWNFRFRPRYP-PHMNTKISQAEAVHPDELDEEFDTFPTSRNPDLV  894

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  R+QT++GD+ATQGERV +L++WRDPRAT IF+  C V A +LY+ P +
Sbjct  895   RMRYDRLRSVAGRIQTVVGDVATQGERVHSLLSWRDPRATAIFVTFCLVAAVVLYVTPFQ  954

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +IA   G Y +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  955   VIAALAGVYAMRHPRFRYRLPSVPVNFFRRLPARTDSML  993


 Score =   111 bits (278),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V++I A NLLPKDG G+S+P+V + F GQR ++    +DLNP W+E   FN++  ++
Sbjct  7    KLGVDIISAHNLLPKDGQGSSNPFVELHFDGQRYRSTIKEKDLNPVWHESFYFNITDPTN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD +   N+  T   +FLG+V +N   FV   +   ++YPLE++ + S ++G+
Sbjct  67   L--HTLTLDAHIYSNIKATQSKSFLGKVTINGNSFVPYSDSVTLHYPLEKRGIFSHVRGE  124

Query  512  IGLKIYFVD  538
            IGLK+Y  D
Sbjct  125  IGLKVYITD  133



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/761 (50%), Positives = 528/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V      ++   K    EW++ 
Sbjct  260   STYDLVEQMQYLFVRVVKARDLPAMDVSGSLDPYVEVRVGNYRGSTKHFEKKQNPEWNEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    SS+LE+ V D           D+   +F+G I FD++++P R PPDSPLA
Sbjct  320   FAFSRDR-MQSSVLEVVVKD----------RDLIKDDFVGLIRFDLNDVPTRVPPDSPLA  368

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTD-------TAGNPTSRSKVYQS  1399
             P+WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D       +A +   RSKVY  
Sbjct  369   PEWYRLEDKKGDKTKGELMLAVWIGTQADEAFPDAWHSDAVVPSDASAVSSHLRSKVYHG  428

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R ++IEAQDI  +   ++     +KA++G Q  +TK   + T +P WNED +FV
Sbjct  429   PRLWYVRVNIIEAQDII-IADRTRFPDVYVKARIGNQFLRTKIVQARTFNPLWNEDFMFV  487

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  V+G   IPL SIERR DDR + SRWF+ E       
Sbjct  488   AAEPFEDH-LILSVEDRVGPNKDEVIGRVIIPLGSIERRADDRMIHSRWFSLEKPVAVDV  546

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + 
Sbjct  547   DQMKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLELGILNAEG  605

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KWVRTRTI  +L P++NEQYTW VYDP+TV+T+GVFD
Sbjct  606   LHPMKTRDGKGTSDTYCVAKYGQKWVRTRTIISSLSPKYNEQYTWEVYDPATVLTVGVFD  665

Query  2099  SWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             + ++ +  P  +KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF 
Sbjct  666   NCQLGEKGPNGNKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRF-  724

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              ST  ++ +H YS+P+LP MH++RPL  +Q + LR  AV+++   LSR EPPLR+EVV Y
Sbjct  725   SSTSLINMMHSYSRPLLPKMHYVRPLTVMQLDMLRHQAVQIVAARLSRMEPPLRKEVVEY  784

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR+++V + +    KW  +  AW+NP  T+LVH L ++LV F
Sbjct  785   MSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGNVCAWKNPITTVLVHILFIMLVCF  844

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P  R  +
Sbjct  845   PELILPTIFLYMFLIGVWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDEFPTNRSPE  903

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IF+  C + A +LY+ P
Sbjct  904   LVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLIAALVLYVTP  963

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A+  GFY +RHP FR RMPS  +NFFRRLP+  D ML
Sbjct  964   FQVLAVLAGFYVMRHPRFRHRMPSAPINFFRRLPARTDSML  1004


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 79/129 (61%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEVI A +L+PKDG G++SP V + F GQ+ +T    +DLNP WNE   FN+S    
Sbjct  5    KLGVEVISAHDLMPKDGQGSASPCVELRFDGQKFRTTIKEKDLNPVWNERFYFNISDPGS  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  V +  N   T    FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPDLALEAWVCNINNA--THSKTFLGKVRIAGTSFVPFADAVVMHYPLEKRGIFSRVKGE  122

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  123  LGLKVFLTD  131



>ref|XP_009386410.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386411.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386413.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009386415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/761 (50%), Positives = 524/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKA+ LP         P V+V V      ++   K    EW++ 
Sbjct  260   STYDLVEQMQYLFVRVVKAKDLPAMDVTGSLDPFVEVRVGNYKGTTKHFEKKQNPEWNEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +SI+E+ V D           D+   +F+G + FD++++P R PPDSPLA
Sbjct  320   FAFSRDQL-QASIVEVVVKD----------KDLVKDDFVGLVRFDLNDVPSRVPPDSPLA  368

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG-------NPTSRSKVYQS  1399
             P+WYRLE   G   KG+LMLA W+GTQADESFPDAW +D A            RSKVY +
Sbjct  369   PEWYRLEDKKGDKTKGELMLAVWIGTQADESFPDAWHSDAAAPVGASAVGSHIRSKVYHA  428

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +V+EAQDI  ++  ++     +K QLG QV +T+   + T +P WNED + V
Sbjct  429   PRLWYVRVNVVEAQDI-VMSDKTRFPDVYVKVQLGNQVLRTRAVQARTFNPLWNEDFMLV  487

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  V+G   IPL SIE+R DDR +  RWF+ E       
Sbjct  488   AAEPFEDH-LILSVEDRVGPNKDEVIGRVIIPLGSIEKRADDRIIYGRWFSLEKPVAVDV  546

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++ + +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + 
Sbjct  547   DQLKKDK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLELGILNAEG  605

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KWVRTRTI ++L P++NEQYTW VYDP TV+T+GVFD
Sbjct  606   LHPMKTQEGKGTSDTYCVAKYGQKWVRTRTIINSLSPKYNEQYTWEVYDPDTVLTVGVFD  665

Query  2099  SWEVIDPENS--KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             + ++ +  +S  KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF 
Sbjct  666   NCQLGEKGSSGNKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGIKKMGELHLAIRF-  724

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              ST  ++ L+ YS+P+LP MH+IRPL  +QQ+ LR  AV+++   L R EPPLR+EVV Y
Sbjct  725   SSTSLINMLYTYSRPLLPKMHYIRPLTMMQQDMLRHQAVQIVAARLGRMEPPLRKEVVEY  784

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR+++V + +  V KW  D  AW+NP  T+LVH L ++LV F
Sbjct  785   MSDVDSHLWSMRRSKANFFRLMSVFSGLFAVSKWFKDVCAWKNPITTVLVHILFLMLVCF  844

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+L++PT   Y+FMIG WNYR+R R    H + KIS AE++  DELDEEFD  P +R  +
Sbjct  845   PELVLPTIFLYMFMIGIWNYRYRPRYP-PHMNIKISHAEAVQPDELDEEFDTFPTSRSAE  903

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GDLATQGERVQAL++WRDPRAT IF+  C V A +LY+ P
Sbjct  904   LVRMRYDRLRSVAGRIQTVVGDLATQGERVQALLSWRDPRATAIFVVFCLVAALVLYVTP  963

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++    GFY +RHP FR RMPS  +NFFRRLP+  D ML
Sbjct  964   LQVLIALAGFYVMRHPRFRHRMPSAPVNFFRRLPARTDSML  1004


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G++ P V + F GQ+ +T    +DLNP WNE   FN++  + 
Sbjct  5    KLGVEVVSAHDLMPKDGQGSACPCVELQFDGQKFRTTIKEKDLNPVWNECFYFNIANPAS  64

Query  332  IFGDMLELDVYHDKNVGPTTRNN-FLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    LE  VY   NV   T +  FLG+V++  T FV   +  +++YPLE++ + S ++G
Sbjct  65   LPELELEAFVY---NVNRATHSRPFLGKVRIAGTSFVPYADAVVMHYPLEKRGIFSRVKG  121

Query  509  DIGLKIYFVD  538
            ++GLK++  D
Sbjct  122  ELGLKVFLTD  131



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/765 (50%), Positives = 528/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+MH+L+V++VKAR LP         P V+V V     I+R   +    EW+Q 
Sbjct  264   STYDLVEQMHFLYVRVVKARELPAMDISGSIDPYVEVRVGNYKGITRHYEQKQNPEWNQV  323

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    +S+L++ + D           D+   +F+G + FDV+E+PLR PPDSPLA
Sbjct  324   FAFSRERM-QASVLDVVIKD----------KDLVKDDFVGIVRFDVNEVPLRVPPDSPLA  372

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--NPTS------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A   N T       RSKVY 
Sbjct  373   PEWYRLESKKGEKIKGELMLAVWIGTQADEAFPEAWHSDAATPVNATPMVSALIRSKVYH  432

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +++EAQD+     P++++ F    +KAQ+G Q+ KTK   +   +  WNED
Sbjct  433   APRLWYVRVNIVEAQDL----VPTEKNRFPDVYVKAQIGNQIMKTKAVQARGFNSLWNED  488

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  +LG   IPL S+E+R DDR V +RWF  E   
Sbjct  489   LLFVAAEPFEDH-LILSVEDRVAPGKDEILGRVIIPLGSVEKRADDRIVHTRWFNLERPI  547

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  ++HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+
Sbjct  548   AVDVDQIKKEK-FSSKIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGIL  606

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRTI DNLCP++NEQYTW V+DP+TV+T+
Sbjct  607   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTIVDNLCPKYNEQYTWEVFDPATVLTV  666

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +     +KD+++GKVRIRISTL TG+VY +T+ L++L P G+KKMGE+ LA
Sbjct  667   GVFDNCQLGEKGANGNKDLKIGKVRIRISTLETGRVYTHTYPLLVLHPTGVKKMGELHLA  726

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T  ++ L  YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+E
Sbjct  727   IRF-SCTSLMNMLCTYSRPLLPKMHYVRPFNVMQLDMLRHQAVTIVAARLGRAEPPLRKE  785

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMRK +AN+FR+++V + +  + KW  D   WRNP  T+LVH L  +
Sbjct  786   VVEYMSDVDSHLWSMRKSKANFFRLMSVFSGLFAIGKWFGDICMWRNPITTVLVHVLFAM  845

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE++  DELDEEFD  P T
Sbjct  846   LVCFPELILPTTFLYMFLIGVWNFRYRPRYP-PHMNTKISQAEAVHPDELDEEFDTFPTT  904

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IF+  C V A +L
Sbjct  905   RSPDLVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATAIFVTFCLVAALVL  964

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P + +A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  965   YVTPFQAVAGLAGFYMMRHPRFRHRLPSAPINFFRRLPARTDSML  1009


 Score =   101 bits (251),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M +  KL V+V+ A +LLPKDG G+S+ +V + F  Q+ +T    +DL+P WNE   FN+
Sbjct  1    MMSSLKLGVDVVSAHDLLPKDGQGSSNAFVELSFDRQKFRTTIKEKDLSPVWNESFYFNI  60

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            S  S++    L+  VY+   +  T   NFLG+V L  T FV   +  + +YPLE++ + S
Sbjct  61   SDPSNLHYLTLDACVYN--TIKATNTRNFLGKVCLTGTSFVPYSDAVVFHYPLEKRGIFS  118

Query  497  WIQGDIGLKIYFVD  538
             ++G++GLK+Y  +
Sbjct  119  RVRGELGLKVYITN  132



>ref|XP_011080971.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080972.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080973.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080974.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080975.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
Length=1001

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/764 (50%), Positives = 525/764 (69%), Gaps = 46/764 (6%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLVEKMH+LFV++VKAR LP         P V+V +     +++   K     W+  F
Sbjct  257   TYDLVEKMHFLFVRVVKARELPAMDVTGSLDPYVEVRIGNYKGVTKHIEKNQHPVWNVVF  316

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF R+    +SILE+ V D           D+   +++G + FD++E+P+R PPDSPLAP
Sbjct  317   AFSRERM-QASILEVVVKD----------KDLVKDDYVGFVRFDLNEVPMRVPPDSPLAP  365

Query  1250  QWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA--------GNPTSRSKVYQS  1399
             +WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A         +   RSKVY +
Sbjct  366   EWYRLEDKKGEKIKGELMLAVWIGTQADEAFPDAWHSDAATPIDSSAAASALIRSKVYHA  425

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDL  1570
             P+LWY+R +V+EAQD+     PS+++ F    +KAQ+G QV +TKP  S   +P WNEDL
Sbjct  426   PRLWYVRCNVVEAQDLI----PSEKTRFPDAYVKAQIGNQVMRTKPIQSRNFNPVWNEDL  481

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE----  1738
              FVAAEPF +H L+  + + + P +  ++G   IPL+ +ERR DDR + SRWF  E    
Sbjct  482   FFVAAEPFEDH-LILTVEDRVAPGKDEIIGRVIIPLNMVERRADDRIIHSRWFNLEKPVA  540

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                DQ ++ + +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELGI+ 
Sbjct  541   VDVDQLKKDK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPPIGILELGILN  599

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
                L PMKT  GKG++D Y VAKYG KWVRTRTI DNL P++NEQYTW V+DP+TV+T+G
Sbjct  600   AVGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTIVDNLFPKYNEQYTWEVFDPATVLTVG  659

Query  2090  VFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             VFD+ ++ D     +KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ LA+
Sbjct  660   VFDNSQLGDKGANGNKDLKIGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGEVHLAL  719

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   T   + L+VYS+P+LP MH+IRP   +Q + LR  AV ++ T L R+EPPLR+EV
Sbjct  720   RF-SCTSFANMLYVYSRPLLPKMHYIRPFTVMQLDMLRHQAVNIVATRLGRAEPPLRKEV  778

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM D DSH +SMR+ +AN+FR+++V   +  V KW  D   W+NP  T+LVH L ++L
Sbjct  779   VEYMSDVDSHLWSMRRSKANFFRLMSVFTGLFAVGKWFGDICMWKNPVTTVLVHVLYLML  838

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V FP+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE++  DELDEEFD  P +R
Sbjct  839   VSFPELILPTIFLYMFLIGVWNFRYRPRYP-PHMNTKISQAEAVHPDELDEEFDTFPTSR  897

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               D+VR RYD+LR +  R+QT++GD+ATQGERV +L++WRDPRAT IF+  C V A +LY
Sbjct  898   NPDLVRMRYDRLRSVAGRIQTVVGDIATQGERVHSLLSWRDPRATAIFVTFCLVAALVLY  957

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P ++IA   G + +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  958   VTPFQVIAALAGIFMMRHPRFRYRVPSVPVNFFRRLPARTDSML  1001


 Score =   110 bits (276),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+++ A NLLPKDG G+SS +V + F GQR ++    +DLNP WNE   FN+S  S 
Sbjct  7    KLGVDIVSAHNLLPKDGQGSSSAFVELYFDGQRYRSTIKEKDLNPVWNETFYFNISDPSI  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD Y   +V  T    FLG+V +N T FV   +  +++YPLE++ + S ++G+
Sbjct  67   L--HCLTLDAYIYNHVKATQSRAFLGKVSINGTSFVPYPDAVVLHYPLEKRGIFSRVRGE  124

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  125  LGLKVYITD  133



>gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/760 (51%), Positives = 525/760 (69%), Gaps = 37/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  32    TTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYVEVRLGNYKGTTRHFEKKTNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V             DV   +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKDR-IQASVLEVTV----------KDKDVVKDDFIGRVLFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGN------PTSRSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A           RSKVY SP
Sbjct  141   PQWYRLEDRKGDKLKGELMLAVWMGTQADEAFPEAWHSDAASVSGMDSLANIRSKVYLSP  200

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA LG Q  +T+ + S T +P WNEDL+FVA
Sbjct  201   KLWYLRVNVIEAQDL-QPTDKGRYPEVFVKAILGNQALRTRISPSKTINPMWNEDLMFVA  259

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNE  1750
             AEPF E  L+  + + + P +  VLG  +IPL  ++RR+D R V +RWF  E     + E
Sbjct  260   AEPFEEP-LILSVEDRVAPNKDEVLGKCAIPLQYVDRRLDHRPVNTRWFNLEKHVIVEGE  318

Query  1751  EKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWKP +G +E+GI+  + L+
Sbjct  319   KKKETKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLEVGILNAQGLM  378

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVFD+ 
Sbjct  379   PMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFIPKWNEQYTWEVFDPCTVITIGVFDNC  438

Query  2105  EVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
              +   E S   KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF  
Sbjct  439   HLHGGEKSAAAKDARIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFTC  498

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ +H+YSQP+LP MH++ PL   Q +SLR  A ++++  LSR+EPPLR+EVV YM
Sbjct  499   SS-LLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYM  557

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD  SH +SMR+ +AN+FRI+ V++ +I V KW D    WRNP  T+L+H L ++LV +P
Sbjct  558   LDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWRNPITTVLIHILFIILVLYP  617

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W YR+R R    H DT++S AES   DELDEEFD  P +RP+D+
Sbjct  618   ELILPTVFLYLFLIGVWYYRWRPRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSRPSDI  676

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY+ P 
Sbjct  677   VRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPF  736

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  737   QVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  776



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/763 (50%), Positives = 523/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPAKDVTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRM-QASMLEVTVKD----------KDFVKDDFMGRVLFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  139   PQWYRLEDRKGDKFKGELMLAVWMGTQADEAFPEAWHSDAATVTGTDGLANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA LG QV +T+ + S + +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDL----QPSDKGRYPEVYVKATLGNQVLRTRVSPSRSINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P +  VLG  +IP+  ++RR+D + V +RWF  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRIAPNKDEVLGKCAIPMHYVDRRLDHKPVNTRWFNLERHVIV  313

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
               + +++  +  R+H R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+  +
Sbjct  314   EGEKKKETKFSSRIHTRICLEGGYHVLDESTHYSSDLRPTAKQLWKNSIGVLEVGILNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMKT   +G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLMPMKTKDSRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +     P  ++D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  434   DNCHLHGGDKPGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+NV   +I V KW D    W+NP  T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRRSKANFFRIMNVFGGLIAVGKWFDQICNWKNPITTVLIHILFIILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG W YR+R R    H DT++S AES   DELDEEFD  P +RP
Sbjct  613   LFPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   PDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>gb|EAY74728.1| hypothetical protein OsI_02619 [Oryza sativa Indica Group]
Length=1079

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/765 (53%), Positives = 543/765 (71%), Gaps = 42/765 (5%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQTF  1069
             +SS+DLVE M YLFV++VK R +     P VK+      + SRP R    T   EW+Q F
Sbjct  331   QSSYDLVEPMRYLFVRVVKVRGIRACEGPYVKIQAGPHTLRSRPGRDVSGTGNPEWNQVF  390

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             A     P+ +  LEISVWD  +   ++         FLGG+CFD+S++P+RD PD PLAP
Sbjct  391   AINHAKPEPT--LEISVWDGGAPSPIE--------AFLGGVCFDLSDVPVRDQPDGPLAP  440

Query  1250  QWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRS  1423
             QWYRLEGG  G   GD+M+A W+GTQADE+FP+AW TD      +RSKVYQSPKLWYLR+
Sbjct  441   QWYRLEGGEPGMVTGDIMVAVWIGTQADEAFPEAWNTDAPYAAYTRSKVYQSPKLWYLRA  500

Query  1424  SVIEAQDIFALTAPSKESSF--QIKAQLGFQVQKTKP--ASSATGSP-SWNEDLVFVAAE  1588
             SVIEAQD+  + AP     F  ++K Q+GFQ  +T+   AS ++GS  +W EDL+FV +E
Sbjct  501   SVIEAQDL-RVPAPPPGLPFDVRVKIQVGFQSARTRRSVASRSSGSAFAWEEDLMFVVSE  559

Query  1589  PFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFEDQNEEKRV-  1762
             P  E  L+  + +    KE A+LG A+IP++S+E+R+ +RQ++ SRWF+ E    +  + 
Sbjct  560   PLDES-LVVLVEDRSMIKEPALLGHATIPVNSVEQRLHERQLVASRWFSLEGGTSDIGIG  618

Query  1763  --------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
                     Y GR+HLRLC +GGYHV++EAAH+CSDYRPTA+QLW+PPVG +ELGIIG   
Sbjct  619   PGGGPPGFYSGRLHLRLCLEGGYHVLDEAAHVCSDYRPTAKQLWRPPVGVLELGIIGACG  678

Query  1919  LLPMKTMRG-KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
             LLPMKT  G KGSTDAY VAKYG KWVRTRT++D+L PRWNEQYTW+VYDP TV+T+ VF
Sbjct  679   LLPMKTKGGAKGSTDAYCVAKYGKKWVRTRTVTDSLNPRWNEQYTWQVYDPCTVLTVAVF  738

Query  2096  DSWEVI-----DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             D+W +        E  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE++LA
Sbjct  739   DNWRMFAFAGAGDEQRQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEVQLA  798

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF       D    Y+ P+LP +H++RP+G  QQE+LR AAV+++   L RSEPPL RE
Sbjct  799   VRFTSPAHLPDTWATYTSPLLPRVHYLRPIGVAQQEALRAAAVRVVAAWLERSEPPLGRE  858

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV +MLD D+H++S+R+ +ANWFRI+ V+A  + + +W D  + WR+P  T+LVH L ++
Sbjct  859   VVRHMLDVDAHTWSVRRAKANWFRIMGVLAWAVGLARWLDGVQRWRSPPTTVLVHVLYLV  918

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LVW+P+L +PT + YVF+IG W YRFR R      D ++S A++++ D+L+EEFDAVP  
Sbjct  919   LVWYPELAVPTASLYVFLIGVWYYRFRPRGPAG-MDARLSQADTVEADDLEEEFDAVP--  975

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
              P +++RARY++LR L  RVQ ++GD+A QGERVQALV+WRDPRA+ IF+ +C  VA  L
Sbjct  976   -PPEVLRARYERLRTLAGRVQRVMGDVAAQGERVQALVSWRDPRASRIFVGVCLAVAVAL  1034

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y +P KM+A+A GFYYLRHP+FRD MP  A+NFFRRLPSL+DRML
Sbjct  1035  YAMPPKMVAVAGGFYYLRHPMFRDPMPPAAVNFFRRLPSLSDRML  1079


 Score =   156 bits (394),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M   R+L VEV++AR+L+PKDG G SS + V+DF GQRK+TRTV RDL+PQW+E LEF +
Sbjct  20   MRVARRLAVEVVDARDLVPKDGLGTSSAFAVVDFDGQRKRTRTVPRDLSPQWHERLEFAV  79

Query  317  SKHSDIFGDMLELDVYHDKNVGP-------TTRNNFLGRVKLNATQFVKKGEEALIYYPL  475
               + +  + L++ +YHD+   P         +N+FLGRV++  +QF ++GEE ++Y+PL
Sbjct  80   HDPAAMHAEALDVSLYHDRRFNPSGGGSGGGGKNHFLGRVRIYGSQFSRRGEEGIVYFPL  139

Query  476  ERKNLLSWIQGDIGLKIYFVD  538
            E+++LLSWI+G++GLKIY+ D
Sbjct  140  EKRSLLSWIRGEVGLKIYYYD  160



>ref|NP_001054305.1| Os04g0683800 [Oryza sativa Japonica Group]
 emb|CAE03445.1| OSJNBa0088H09.3 [Oryza sativa Japonica Group]
 dbj|BAF16219.1| Os04g0683800 [Oryza sativa Japonica Group]
 dbj|BAG95778.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1011

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/763 (50%), Positives = 538/763 (71%), Gaps = 41/763 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I+R   K    EW+  
Sbjct  265   STYDLVERMQYLFVRVVKARDLPDMDVTGSLDPYVEVRVGNYRGITRHFEKQKNPEWNAV  324

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    ++ILE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  325   FAFSRDRM-QATILEVVVKD----------KDLLKDDFVGLVRFDLNDVPMRVPPDSPLA  373

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAG--NPTS----RSKVYQSP  1402
             P+WYRL  + G   +G+LMLA W+GTQADE+FPDAW +D A   +P++    +SKVY +P
Sbjct  374   PEWYRLVHKTGDKSRGELMLAVWIGTQADEAFPDAWHSDAATLEDPSAVTHMKSKVYHAP  433

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQDI A+T  ++     ++AQ+G Q  +TKP  +   +P WNEDL+FVA
Sbjct  434   RLWYLRVNIIEAQDI-AITDKTRYPDVFVRAQVGHQHGRTKPVQARNFNPFWNEDLMFVA  492

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------D  1741
             AEPF +H L+  L + + P +  VLG   IPL+ I+RR DDR V  +WF  E       D
Sbjct  493   AEPFEDH-LILSLEDRVAPNKDEVLGRVIIPLTMIDRRADDRIVHGKWFNLEKPVLIDVD  551

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             Q ++++ +  R+HLRLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELGI+G + +
Sbjct  552   QLKKEK-FSTRLHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGILGAQGI  610

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKGS+D Y VAKYGSKWVRTRTI +N  P++NEQYTW VYDP+TV+T+GVFD+
Sbjct  611   VPMKTRDGKGSSDTYCVAKYGSKWVRTRTIVNNPGPKFNEQYTWEVYDPATVLTVGVFDN  670

Query  2102  WEVIDP-----ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
              ++ +       +SKD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+R
Sbjct  671   GQLGEKGGEKTSSSKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIR  730

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  ST  ++ +++YS+P+LP MH++RP+  +Q + LR  AV++++  LSR EPPLR+EVV
Sbjct  731   F-SSTSLVNMMYLYSRPLLPKMHYVRPIPVLQVDMLRHQAVQIVSARLSRMEPPLRKEVV  789

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM D DSH +SMR+ +AN+FR+++V + +  V KW +   +WRNP  T+LVH L ++LV
Sbjct  790   EYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAVSKWFNGVCSWRNPITTVLVHILFIMLV  849

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WNYR+R      H +TKIS AE++  DELDEEFD  P +R 
Sbjct  850   CFPELILPTVFLYMFLIGVWNYRYRPCYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRS  908

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D++R RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT IF+  C + A +LY+
Sbjct  909   PDVIRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCLIAAIVLYV  968

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  969   TPLQVLAALAGFYVMRHPRFRYRLPSTPVNFFRRLPARTDSML  1011


 Score = 98.6 bits (244),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV  A +L+PKDG G++S  V + F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVASAHDLMPKDGQGSASACVELTFDGQRFRTAIKDKDLNPVWNERFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+       +R +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYVYNINRSIDGSR-SFLGKVRIAGTSFVPFPDAVVMHYPLEKRGMFSRVKGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  +
Sbjct  124  LGLKVYITN  132



>ref|XP_010113221.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC74799.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=796

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/765 (49%), Positives = 526/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++        EW+Q 
Sbjct  51    STYDLVERMYFLYVRVVKARDLPAMDVTGSLDPFVEVKIGNYKGITKHFEHRQNPEWNQV  110

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ + D           D+   +F+G + FD++EIPLR PPDSPLA
Sbjct  111   FAFSKDRM-QASVLEVVIKD----------KDLVKDDFVGIVRFDINEIPLRVPPDSPLA  159

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  160   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTAAISAVIRSKVYH  219

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             SP+LWY+R +VIEAQD+     P++++ F    +K Q+G QV KTKP  + T +  WNED
Sbjct  220   SPRLWYVRVNVIEAQDL----VPTEKNRFPDAYVKVQIGHQVLKTKPVQARTLNALWNED  275

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPL+ ++RR DDR + SRW+  E   
Sbjct  276   LLFVAAEPFEDH-LVLTVEDRVGPGKDEIIGRVIIPLNIVDRRADDRMIHSRWYNLEKPV  334

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+
Sbjct  335   VFDVDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGIL  393

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  394   NAIGLHPMKTRDGRGTSDTYCVAKYGQKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTV  453

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
              VFD+ ++ +    ++KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA
Sbjct  454   CVFDNSQIGEKGSGSNKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLA  513

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + L+ YS+P+LP MH++RP   +Q + LR  AV ++   LSR+EPPLR+E
Sbjct  514   IRF-SCTSFANMLYTYSKPLLPKMHYVRPFSVMQLDMLRHQAVNIVAARLSRAEPPLRKE  572

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR++ V + +  V KW  D   WRNP  TILVH L ++
Sbjct  573   VVEYMSDVDSHLWSMRRSKANFFRLMTVFSGLFAVGKWFGDICMWRNPFTTILVHILFLM  632

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WNYR+R R    H +T+IS AE++  DE+DEEFD  P +
Sbjct  633   LVCFPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTRISQAEAVHPDEMDEEFDTFPTS  691

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT +FI  C V A +L
Sbjct  692   RNPDIVRMRYDRLRSVAGRIQTVVGDVATQGERVQALLSWRDPRATAMFITFCLVAALVL  751

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P +++A   GFY +RHP FR R+P   +NFFRRLPS  D ML
Sbjct  752   YVTPFQVVAALMGFYVMRHPRFRHRLPPVPVNFFRRLPSRTDSML  796



>ref|XP_002986408.1| hypothetical protein SELMODRAFT_123924 [Selaginella moellendorffii]
 ref|XP_002988662.1| hypothetical protein SELMODRAFT_184030 [Selaginella moellendorffii]
 gb|EFJ10173.1| hypothetical protein SELMODRAFT_184030 [Selaginella moellendorffii]
 gb|EFJ12617.1| hypothetical protein SELMODRAFT_123924 [Selaginella moellendorffii]
Length=761

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/753 (50%), Positives = 525/753 (70%), Gaps = 32/753 (4%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFE-WDQT  1066
             S DLVEKM YL+V++VKAR L       +  P VKV V   +      RK  +   W+Q 
Sbjct  25    SHDLVEKMQYLYVRVVKARDLVAKDLGGSSDPYVKVKVGEGYPAKTEIRKRSVNPVWNQV  84

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAFG+D     ++ EI+VWD            V+  +FLG + FD++EI  R PP+SPLA
Sbjct  85    FAFGKDKIQGPTV-EITVWD---------ADKVSKDDFLGFVQFDLTEISKRVPPESPLA  134

Query  1247  PQWYRLE---GGGAH-KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWY  1414
             PQWY+LE    G  H +G++MLA W GTQADE+F +AW++D+ G+  +++KVY SPKLWY
Sbjct  135   PQWYKLEPGRKGDVHVRGEIMLAVWWGTQADEAFSEAWQSDSGGHYHNKAKVYMSPKLWY  194

Query  1415  LRSSVIEAQDIFALTAPSKESSFQIKAQLG-FQVQKTKPASSATGSPSWNEDLVFVAAEP  1591
             LR +VIEAQD+   +  ++     ++ QLG  QV KTK +++ T SP WN+D+VFVAAEP
Sbjct  195   LRVNVIEAQDLIP-SEKNRLPEVSVRVQLGGTQVYKTKVSANRTNSPFWNQDMVFVAAEP  253

Query  1592  FTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNEEKRVYKG  1771
             F EH L+  + + +   ++ VLGV  IPL  ++RR+D R V +RWF  E   E+   ++G
Sbjct  254   FEEH-LVLTVEDRVGGNKEEVLGVVKIPLKEVDRRIDHRLVNTRWFNLEKNGEKP--FRG  310

Query  1772  RVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRGKG  1951
             R+HLR+CFDGGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+  KNL+PMK+  G+ 
Sbjct  311   RLHLRVCFDGGYHVMDESTHHISDTRPTAKQLWKASMGVLEIGILSAKNLVPMKSRDGRS  370

Query  1952  STDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDPENSK  2131
             +TDAY VAKYG KWVRTRT  D+  PRW+EQYTW V+DP TV+TIGVFD+    D    K
Sbjct  371   TTDAYCVAKYGQKWVRTRTCMDSFSPRWHEQYTWEVHDPCTVLTIGVFDNCHTKDEPGEK  430

Query  2132  -----DVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDF  2296
                  D  +GKVRIR+STL + +VY N++ L++L  +G+KK GE+ELAVRF   T  L+ 
Sbjct  431   VSSGRDNPIGKVRIRVSTLESDRVYTNSYPLLVLQRSGVKKTGELELAVRF-SCTSVLNM  489

Query  2297  LHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHS  2476
             +H+Y  P LP MH++ PLG ++ E LR  A+++++  L+RSEPPLR+EVV YMLD DS+ 
Sbjct  490   MHIYFTPPLPKMHYLHPLGVIELEQLRNIAIRIVSLRLARSEPPLRQEVVHYMLDTDSNM  549

Query  2477  FSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTF  2656
             +SMR+ + N++R++ V++  I V KW  D   W+NP  T+LVH L ++LVW+P+LI+PT 
Sbjct  550   WSMRRSKVNYYRMLGVLSGAIAVTKWFSDICQWKNPLTTVLVHILFLILVWYPELILPTL  609

Query  2657  AFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDK  2836
               Y+F+IGAW+YRFR R    + D ++S AE ++ DELDEEFD  P ++  D+V+ RY++
Sbjct  610   FLYMFLIGAWHYRFRPRAP-PYMDARLSQAEHVEHDELDEEFDTFPTSKSPDIVKHRYER  668

Query  2837  LRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAF  3016
             LRM+ +R+Q++LGDLA+QGER+ AL++WRDPRAT IFI  C V A +LY++P +++A+  
Sbjct  669   LRMVASRIQSVLGDLASQGERLNALLSWRDPRATAIFITFCLVAAILLYVIPLRVVAVLL  728

Query  3017  GFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             G Y LRHP FR+R+P   +NFFRRLPS ADR+L
Sbjct  729   GIYALRHPRFRNRVPPVPMNFFRRLPSYADRIL  761



>ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis 
sativus]
 ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis 
sativus]
 ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/761 (50%), Positives = 522/761 (69%), Gaps = 38/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M+YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMYYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+SV D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRI-QASVLEVSVKD----------KDFVKDDFMGRVLFDLNEVPRRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRL+   G   KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  140   PQWYRLDDRKGDKVKGELMLAVWMGTQADEAFPEAWNSDAATVSGADGLANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR ++IEAQD+   T   +     +KA LG Q  +T+ + S T +P WNEDL+FVA
Sbjct  200   KLWYLRVNIIEAQDL-QPTDKGRYPEVFVKAILGNQALRTRISQSRTINPMWNEDLMFVA  258

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED-----QN  1747
             AEPF E  L+  + + + P +  VLG  +I L  I+RR+D R V +RWF  E      + 
Sbjct  259   AEPFEEP-LILSVEDRVAPNKDEVLGRCAIQLQYIDRRLDHRAVNTRWFNLEKHVVVVEG  317

Query  1748  EEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             E+K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  + L
Sbjct  318   EKKKEIKFSSRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKNSIGVLELGILNAQGL  377

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  G+G+TDAY VAKYG KW+RTRTI D+  P+WNEQYTW V+DP TV+TIGVFD+
Sbjct  378   MPMKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFIPKWNEQYTWEVFDPCTVITIGVFDN  437

Query  2102  WEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
               +   E    SKD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF 
Sbjct  438   CHLHGGEKAGVSKDARIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFT  497

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              S+  L+ LH+YS P+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+EVV Y
Sbjct  498   CSS-LLNMLHMYSHPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEY  556

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLD  SH +SMR+ +AN+FRI+ V + +I V KW D    WRNP  T+L+H L ++LV +
Sbjct  557   MLDVGSHMWSMRRSKANFFRIMGVFSGLIAVGKWFDQICNWRNPITTVLIHILFIILVMY  616

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG W+YR+R R    H DT++S A+S   DELDEEFD  P +RP D
Sbjct  617   PELILPTIFLYLFLIGVWHYRWRPRHP-PHMDTRLSHADSSHPDELDEEFDTFPTSRPAD  675

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRA+ +F+  C V A +LY+ P
Sbjct  676   IVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRASALFVIFCLVSAIVLYVTP  735

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  736   FQVVALLSGIYVLRHPRFRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/762 (50%), Positives = 524/762 (69%), Gaps = 40/762 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I++   K    EW++ 
Sbjct  260   STYDLVEQMQYLFVRVVKARDLPAMDVSGSLDPYVEVRVGNYRGITKHFEKKQNPEWNEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   SS             + +    D+   +F+G I FD++++P R PPDSPLA
Sbjct  320   FAFSQDRMQSSV-----------VEVVVKDKDLVKDDFVGLIRFDLNDVPTRVPPDSPLA  368

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG-------NPTSRSKVYQS  1399
             P+WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A        +   RSKVY  
Sbjct  369   PEWYRLEDKKGDKRKGELMLAVWIGTQADEAFPDAWHSDAAAPIDASAVSSHLRSKVYHG  428

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R ++IEAQDI      S    + +K ++G Q  +TK   + T +P WNEDL+FV
Sbjct  429   PRLWYVRVNIIEAQDIIVADXNSFPDVY-VKVRIGNQFLRTKVVQARTFNPLWNEDLMFV  487

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  V+G   IPL SIE+R DDR + SRWF+ E       
Sbjct  488   AAEPFEDH-LILSVEDRVGPNKDEVIGRVLIPLGSIEKRADDRMIHSRWFSLEKPVAVDV  546

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + 
Sbjct  547   DQMKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLELGILNAEG  605

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KWVRTRTI D+L P++NEQYTW VYDP+TV+T+GVFD
Sbjct  606   LHPMKTRDGKGTSDTYCVAKYGQKWVRTRTIIDSLSPKYNEQYTWEVYDPATVLTVGVFD  665

Query  2099  SWEV---IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             + ++     P+ +KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF
Sbjct  666   NCQLGGEKGPDGNKDAKIGKVRIRLSTLETGRVYTHSYPLLILHPSGVKKMGELHLAIRF  725

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
               ST  ++ ++ YS+P+LP MH+IRPL  +Q + LR  AV+++   +SR EPPLR+EVV 
Sbjct  726   -SSTAFINMMYTYSRPLLPKMHYIRPLTVMQLDMLRHQAVQIVAARMSRMEPPLRKEVVE  784

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YM D DSH +SMR+ +AN+FR+++V + +    KW  D  AW+NP  T+LVH L ++LV 
Sbjct  785   YMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFRDVCAWKNPITTVLVHILFIMLVC  844

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             FP+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R  
Sbjct  845   FPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRSA  903

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             ++VR RYD+LR +  R+QT++GD+A+QGER+QAL++WRDPRAT IF+  C + A +LY+ 
Sbjct  904   ELVRMRYDRLRSVAGRIQTVVGDVASQGERIQALLSWRDPRATAIFVLFCLIAALVLYVT  963

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++A   GFY +RHP FR RMPS  LNFFRRLP+  D ML
Sbjct  964   PFQVLAAVAGFYVMRHPRFRHRMPSAPLNFFRRLPARTDSML  1005


 Score =   105 bits (262),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEVI A +L+PKDG G++SP V + F GQ+ +T    +DLNP WNE   FN+S  + 
Sbjct  5    KLGVEVISAHDLMPKDGQGSASPCVELHFDGQKFRTTIKEKDLNPVWNERFYFNISDPAS  64

Query  332  IFGDMLELDVYHDKNVGPTTRN-NFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    LE  VY   N+   T + +FLGRV++  T FV   +  +++YPLE++ + S ++G
Sbjct  65   LHDLGLEAFVY---NINKATHSKSFLGRVQIAGTSFVPFPDAVVLHYPLEKRGIFSRVKG  121

Query  509  DIGLKIYFVD  538
            ++GLK++  D
Sbjct  122  ELGLKVFLTD  131



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/760 (50%), Positives = 527/760 (69%), Gaps = 37/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP+     +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPSKDVTGSCDPYAEVKLGNYKGTTRHFEKKTNPEWNQI  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRL-QASVLEVTVKD----------KDMVKDDFIGRVWFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAASVSGADAVANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA LG Q  +T+ + S + +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDL-QPTDKGRYPEVFVKAILGNQALRTRISQSRSINPLWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNE  1750
             AEPF E  L+  + + + P +  VLG  +IPL  ++RR+D + V +RWF  E     + E
Sbjct  258   AEPF-EEPLILSVEDRVAPNKDEVLGRCAIPLQFVDRRLDHKPVNTRWFNLEKHIVVEGE  316

Query  1751  EKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+    L+
Sbjct  317   KKKEIKFASRIHMRVCLEGGYHVLDESTHYSSDLRPTAKQLWKSGIGVLEVGILNAHGLM  376

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMK + G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGVFD+ 
Sbjct  377   PMKNINGRGTTDAYCVAKYGQKWVRTRTIIDSFMPRWNEQYTWEVFDPCTVITIGVFDNC  436

Query  2105  EVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
              +  P+ +   KD R+GKVRIR+STL T +VY +++ L++L  +G+KK GEI+LAVRF  
Sbjct  437   HLHSPDKTGGAKDARIGKVRIRLSTLETDRVYTHSYPLLVLHNSGVKKTGEIQLAVRFTC  496

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ +H+YSQP+LP  H+I PL   Q +SLR  A ++++  LSR+EPPLR+EVV YM
Sbjct  497   SS-LLNMMHMYSQPLLPKRHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYM  555

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD  SH +SMR+ +AN+FRI+ V++A+I V KW D    W+NP  T+L+H L V+LV +P
Sbjct  556   LDVGSHMWSMRRSKANFFRIMGVLSALIAVGKWFDSICNWKNPITTVLIHFLFVILVMYP  615

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W+YR+R R    H DT++S A+S   DELDEEFD  P +RP+D+
Sbjct  616   ELILPTVFLYLFLIGIWHYRWRPRHP-PHMDTRLSHADSSHPDELDEEFDTFPTSRPSDI  674

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C VVA +LY+ P 
Sbjct  675   VRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVVATVLYVTPF  734

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +M+A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   QMVAILTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_009383872.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=1012

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/760 (49%), Positives = 524/760 (69%), Gaps = 38/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V      ++   K    EW++ 
Sbjct  269   STYDLVEQMQYLFVRVVKARDLPAMDVTGSLDPYVEVKVGNYKGTTKHFEKKQNPEWNEV  328

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    +SILE+ + D           D+   +F+G I FD+ ++P R PPDSPLA
Sbjct  329   FAFSREHM-QASILEVVIKD----------KDLLKDDFVGIIRFDLHDVPTRVPPDSPLA  377

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-------RSKVYQS  1399
             P+WYRLE   G   KG+LMLA W+GTQADESFPDAW +D      +       +SKVY +
Sbjct  378   PEWYRLEDKMGDKTKGELMLAVWIGTQADESFPDAWHSDAVARFDASSVISHIKSKVYHA  437

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +++EAQDI  +   ++     +KAQLG QV KT+   + T +P WNEDL+FV
Sbjct  438   PRLWYVRVNIVEAQDI-VIKEKARFPDVYVKAQLGNQVLKTRTVQARTFNPLWNEDLMFV  496

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  VLG   IPL S+E+RVDD  ++  WF  E       
Sbjct  497   AAEPFEDH-LILSVEDRVAPNKDEVLGRVVIPLGSLEKRVDDHIILGHWFDLEKPVLIDV  555

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++ + +  R+ LR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG++  + 
Sbjct  556   DQLKKDK-FSTRIFLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLELGVLNAEG  614

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMK+  GKG++D Y VAKYG KWVRTRT+ D+L PR+NEQYTW VYDP+TV+T+GVFD
Sbjct  615   LHPMKSREGKGTSDTYCVAKYGQKWVRTRTVIDSLSPRYNEQYTWEVYDPATVLTVGVFD  674

Query  2099  SWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             + ++    N  KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGEI LA+RF  
Sbjct  675   NCQLEKGSNGDKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGEIHLAIRF-S  733

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             ST  ++ +++YSQP+LP MH+IRPL  +QQ+ LR  AV+++   L+R EPPLR+EVV YM
Sbjct  734   STSFVNMMYIYSQPLLPKMHYIRPLMMMQQDMLRHQAVQIVAARLNRMEPPLRKEVVEYM  793

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
              D DSH +SMR+ +AN+FR+++V + +  V +W  D   W+NP  T+LVH L ++LV FP
Sbjct  794   SDVDSHLWSMRRSKANFFRLMSVFSGLFSVSRWFGDICKWKNPITTVLVHILFIMLVCFP  853

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+ T   Y+F+ G WNYR+R R    H +TKIS AE++  DELDEEFD+ P +R  ++
Sbjct  854   ELILSTIFLYMFLAGLWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDSFPTSRGAEL  912

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT +F+  C + A +LY+ P 
Sbjct  913   VRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATSVFVLFCLIAALVLYVTPL  972

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A   GFY +RHP FR R+PS  LNFFRRLP+  D ML
Sbjct  973   QVLAALAGFYIMRHPRFRHRIPSAPLNFFRRLPAKTDSML  1012


 Score = 89.0 bits (219),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 74/129 (57%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PK GHG+SSP V + F GQ+ +T    +DLNP W+E   FN++  + 
Sbjct  14   KLGVEVVSAHDLMPKGGHGSSSPCVELHFDGQKFRTTIKEKDLNPVWDERFYFNIADPAS  73

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  V        T     LG+V++    FV   +  ++ YPLE++ + S ++G+
Sbjct  74   LPELALEASVISFNKA--THSKTILGKVRIAGASFVPFADAVVMQYPLEKRGMFSRVKGE  131

Query  512  IGLKIYFVD  538
            + LK++  +
Sbjct  132  LSLKVFLTN  140



>ref|XP_006850085.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
 gb|ERN11666.1| hypothetical protein AMTR_s00022p00218970 [Amborella trichopoda]
Length=1036

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/764 (49%), Positives = 528/764 (69%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+MHYL+V++VKA+ LP +       P  +V +      ++   K L  EW+Q 
Sbjct  291   STYDLVEQMHYLYVRVVKAKDLPASSVTGSCDPYAEVKLGNYKGTTKHFEKKLNPEWNQV  350

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS+LE+ V D            V   ++LG + FD++E+P R PPDSPLA
Sbjct  351   FAFSKER-IQSSMLEVFVKD---------KEMVGRDDYLGRVVFDLNEVPKRVPPDSPLA  400

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G    +G++MLA W+GTQADE+FP+AW  D A     G  + RSKVY SP
Sbjct  401   PQWYRLEDRKGETKVRGEMMLAVWMGTQADEAFPEAWHADAATVQGEGVFSIRSKVYVSP  460

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS  +      +K Q+G QV KTKP+   T +P WNEDL+
Sbjct  461   KLWYLRVNVIEAQDL----QPSDRARVPEASVKVQVGHQVLKTKPSPVRTPNPLWNEDLI  516

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FV AEPF E  L+  + + + P +  VLG  ++PL+  ++R+D R V SRWF  E     
Sbjct  517   FVVAEPFEEQ-LVLMVEDRVSPSKDDVLGKIALPLTIFDKRLDHRPVHSRWFNLEKFGFG  575

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 D+ +E + +  R+HLR+C +GGYHV++E+    SD RPTA+QLWKPP+G +E+GI+
Sbjct  576   VLEGDKRKELK-FSSRIHLRVCLEGGYHVLDESTMYISDLRPTAKQLWKPPIGILEVGIL  634

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
               + LLPMKT  G+ +TD+Y VAKYG KWVRTRTI D+L P+WNEQYTW VYDP TV+T+
Sbjct  635   SAQGLLPMKTKDGRQTTDSYCVAKYGPKWVRTRTIIDSLSPKWNEQYTWEVYDPCTVITL  694

Query  2087  GVFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             GVFD+  +  P +S  D R+GKVRIR+STL T ++Y +++ L++L P+GLKKMGE++LAV
Sbjct  695   GVFDNCHLGTPTSSASDSRIGKVRIRLSTLETDRIYTHSYPLLVLHPSGLKKMGELQLAV  754

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   T  ++ +H+Y  P LP MH+I P    Q ++LR  A+ ++   L R+EPPLR+EV
Sbjct  755   RFT-CTSLVNMVHLYGHPPLPKMHYIHPFSVNQVDNLRYQAINIVAMRLGRAEPPLRKEV  813

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD D+H++SMR+ +AN+FRI+++++ VI V KW DD   W+NP  T+LVH L ++L
Sbjct  814   VDYMLDFDAHAWSMRRSKANFFRIMSLLSGVISVGKWFDDVCHWKNPITTVLVHILFLIL  873

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             +W+P+LI+PT   Y+F+IG WN+RFR R+   H DTK+S AE++  DELDEEFD+ P +R
Sbjct  874   IWYPELILPTLFLYMFLIGIWNFRFRPRNP-PHMDTKLSWAEAVPPDELDEEFDSFPTSR  932

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P+D+VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRAT ++I  C + A +LY
Sbjct  933   PHDVVRMRYDRLRSVARRIQTVVGDMATQGERFQALLSWRDPRATSLYILFCLIAAVVLY  992

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G + LRHP FR ++PS   NFF+RLP+  D ML
Sbjct  993   VTPFRVVALLLGLFVLRHPRFRSKLPSVPSNFFKRLPAKVDSML  1036


 Score =   124 bits (310),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL+VEVIEA +L+PKDG G+++P+V +DF  QR +T+++ + LNP WNE L FN++   +
Sbjct  2    KLVVEVIEAHDLMPKDGEGSATPFVEVDFENQRIRTKSLEKTLNPHWNEQLIFNVTDPKN  61

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    +E+ VY++K      R NFLG+V+++ +  V++ E+AL  +PLER+ L S+++GD
Sbjct  62   LHNRGIEVYVYNEKR--SLHRRNFLGKVRVSGSSVVRESEKALQTFPLERRTLFSFVKGD  119

Query  512  IGLKIYF  532
            I LKIY 
Sbjct  120  ITLKIYL  126



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/767 (49%), Positives = 525/767 (68%), Gaps = 47/767 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M +LFV++VKAR LP         P V+V V     ++R   K    EW++ 
Sbjct  263   STYDLVEQMQFLFVRVVKARELPPMDITGSLDPYVEVKVGNYKGVTRHFEKKQNPEWNEV  322

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    SS+LE+ V D           D+   +F+G I FD++E+P+R PPDSPLA
Sbjct  323   FAFARDRM-QSSVLEVVVKD----------KDLVKDDFVGIIMFDLNEVPIRVPPDSPLA  371

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDT--------AGNPTSRSKVYQ  1396
             P+WYRL+   G   KG+LMLA W+GTQADE+FPDAW +D         A +   RSKVY 
Sbjct  372   PEWYRLQDKKGEKTKGELMLAVWIGTQADEAFPDAWHSDAVTPTDSSAAASTYIRSKVYH  431

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +VIEAQD+     P++++ F    +K QLG QV KTK   + T SP WNED
Sbjct  432   APRLWYVRVNVIEAQDVI----PTEKNRFPEVYVKVQLGNQVLKTKTVQARTMSPIWNED  487

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQN  1747
             ++ VAAEPF +H L+  + + + P +  ++G   IPL+SIE+R DDR + +RWF  E  +
Sbjct  488   MLLVAAEPFEDH-LVLSVEDRVGPNKNELIGRVIIPLNSIEKRADDRLIHTRWFHLEKPD  546

Query  1748  E-------EKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                     +K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+
Sbjct  547   AAVDVDQLKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGIL  606

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT   KG++D Y VAKYG KWVRTRTI ++L P++NEQYTW VYDP+TV+ +
Sbjct  607   NADGLHPMKTRDRKGTSDTYCVAKYGHKWVRTRTIINSLSPKYNEQYTWEVYDPATVLIV  666

Query  2087  GVFDSWEV----IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             GVFD+ ++     D   +KD ++GKVRIRISTL  G+VY +++ L++L P+G+KKMGE+ 
Sbjct  667   GVFDNSQLGEKGTDGGGNKDNKIGKVRIRISTLEAGRVYTHSYPLLVLHPSGVKKMGELH  726

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +A+RF   T T++ + +YS+P+LP MH+IRPL  +Q + LR  AV ++   LSR+EPPLR
Sbjct  727   MAIRF-SCTSTMNMMFIYSRPLLPKMHYIRPLTIMQLDMLRQQAVNIVAARLSRAEPPLR  785

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
             +EVV YM D DSH +SMR+ +AN+FRI+ V + ++ V KW  D   W+NP  T+LVH L 
Sbjct  786   KEVVEYMSDVDSHMWSMRRSKANFFRIVAVFSGLLAVGKWLGDVCIWKNPITTVLVHVLY  845

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
             V+ V FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS AE +  DELDEEFD  P
Sbjct  846   VMFVCFPELILPTVFLYMFLIGLWNFRYRPRYP-PHMNTRISCAEGLHPDELDEEFDTFP  904

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              +R  ++VR RYD+LR +  RVQT++GD+ATQGERVQAL++WRDPRAT IF+  C + A 
Sbjct  905   TSRSQELVRMRYDRLRSVAGRVQTVVGDIATQGERVQALLSWRDPRATAIFVMFCLIAAL  964

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +LY+ P +++A+  G Y++RHP FR ++PS  +NFFRRLP+  D ML
Sbjct  965   VLYVTPFQVVAVVIGIYWMRHPRFRHKLPSVPINFFRRLPARTDSML  1011


 Score =   119 bits (297),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NL+PKDG G+S+ +V + F GQR +T T  +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVVSAHNLIPKDGQGSSNAFVELHFDGQRFRTTTKEKDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            I    L LD Y   N+  T   +FLG+V+L  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   I--QNLSLDAYVYNNIKATHSRSFLGKVRLTGTSFVPYSDAVVLHYPLEKRGIFSRVKGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/764 (51%), Positives = 524/764 (69%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP+        P V+V V     I++   K    EW++ 
Sbjct  272   STYDLVEQMKYLFVRVVKARELPSKDVTGSLDPYVEVRVGNYKGITKHFEKKQNPEWNEV  331

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    SS+LE+ V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  332   FAFARDRM-QSSVLEVVVKD----------KDLVKDDFVGIVRFDMNEIPTRVPPDSPLA  380

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS---------RSKVY  1393
             P+WYRLE   G   KG+LMLA W GTQADE+FPDAW +D A  PT          RSKVY
Sbjct  381   PEWYRLEDKKGNKDKGELMLAVWYGTQADEAFPDAWHSD-AVTPTDSSSAISAHIRSKVY  439

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKES--SFQIKAQLGFQVQKTKPASSATGSPSWNED  1567
              SP+LWY+R +VIEAQD   L  P K       +K Q+G Q+ KTK   + T +P WNED
Sbjct  440   HSPRLWYVRVNVIEAQD---LIVPDKNRFPDTYVKVQIGNQILKTKMVQTRTMNPIWNED  496

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +   +G   IPL+S+E+R DDR + SRWF  E   
Sbjct  497   LMFVAAEPFEDH-LVLSVEDRVGPNKDESIGKVVIPLNSVEKRADDRIIRSRWFNLEKSI  555

Query  1739  ----DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                 D+++ K+  +  R+HLR+  DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI
Sbjct  556   SAAMDEHQAKKDKFSSRLHLRVVLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGI  615

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG++D Y VAKYG KWVRTRTI ++L P++NEQYTW VYDP+TV+T
Sbjct  616   LNADGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTIINSLSPKYNEQYTWEVYDPATVLT  675

Query  2084  IGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             IGVFD+  +     ++D+++GKVRIRISTL TG+VY +++ L++L  +G+KKMGE+ +A+
Sbjct  676   IGVFDNSHIGGSNGNRDIKIGKVRIRISTLETGRVYTHSYPLLVLHSSGVKKMGELHMAI  735

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   T   + + +Y++P+LP MH+ RPL  +QQ+ LR  AV ++   LSR+EPPLR+EV
Sbjct  736   RF-SYTSMANMMFLYTRPLLPKMHYTRPLTVMQQDLLRHQAVNIVAARLSRAEPPLRKEV  794

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM DADSH +SMR+ +AN+FR+++V + +  V KW  +   W+NP  T+LVH L V+L
Sbjct  795   VEYMSDADSHLWSMRRSKANFFRLMSVFSGLFSVGKWFGEVCMWKNPITTVLVHLLFVML  854

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V FP+LI+PT   Y+F+IG WNYRFR R    H +T+IS A+++  DELDEEFD  P TR
Sbjct  855   VCFPELILPTVFLYMFLIGFWNYRFRPRYP-PHMNTRISCADAVHPDELDEEFDTFPTTR  913

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               ++VR RYD+LR +  R+QT++GD+ATQGERVQ+L++WRDPRAT IF+  CFV A +LY
Sbjct  914   SPEIVRMRYDRLRSVAGRIQTVVGDVATQGERVQSLLSWRDPRATTIFLTFCFVAAVVLY  973

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               P +++A+  GFY +RHP FR R PS  +NFFRRLP+  D ML
Sbjct  974   ATPFQVLALVAGFYSMRHPRFRHRTPSIPINFFRRLPARTDSML  1017


 Score =   102 bits (255),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            +L VEV+ A +L+PKDG G++S +V I F  Q+ +T T  +DLNP WNE   FN+S  ++
Sbjct  5    RLGVEVVGAHDLMPKDGQGSASAFVEIHFDHQKFRTTTKEKDLNPVWNESFYFNISDPNN  64

Query  332  IFGDMLELDVY-HDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    LE  VY H K     T  + LG+V+L  T FV   +  +++YPLE++ L S ++G
Sbjct  65   LSNLTLEAYVYNHGKE---NTTKSCLGKVRLTGTSFVPYSDAVVLHYPLEKRGLFSRVKG  121

Query  509  DIGLKIYFVD  538
            ++GLK++  D
Sbjct  122  ELGLKVFVTD  131



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/764 (50%), Positives = 523/764 (68%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW+Q 
Sbjct  32    STYDLVEQMQYLYVRVVKAKELPAKDVTGSLDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LEI V D           D+A  +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKDRL-QASMLEIIVKD----------KDLAKDDFVGRVVFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   +G++MLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  141   PQWYRLEDRKGDKVRGEVMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  200

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA+LG QV +T+ + S + +P WNEDL+
Sbjct  201   KLWYLRVNVIEAQDL----QPSDKGRYPEVYVKAKLGNQVLRTRVSQSRSINPLWNEDLM  256

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P +  VLG   IPL  ++RR+D + V +RW   E     
Sbjct  257   FVAAEPFEEP-LILSVEDRVAPNKDEVLGHCGIPLQYVDRRLDHKPVNTRWHNLERYIIV  315

Query  1739  --DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
               +Q ++   +  R+HLR+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  316   EGEQKKKDTKFASRIHLRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGILELGILSA  375

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + LLPMKT  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  376   QGLLPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFMPRWNEQYTWEVFDPCTVITIGV  435

Query  2093  FDSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +   +    ++D ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAV
Sbjct  436   FDNCHLHGGDKNGPARDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAV  495

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YS P+LP MH+I PL   Q +SLR  A  +++  LSR+EPPLR+EV
Sbjct  496   RFTCSS-LLNMMHMYSHPLLPKMHYIHPLTVSQLDSLRHQATLIVSMRLSRAEPPLRKEV  554

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++L
Sbjct  555   VEYMLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICHWKNPITTVLIHILFIIL  614

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+FMIG W YR+R R    H DT++S A+S   DELDEEFD  P +R
Sbjct  615   VIYPELILPTIFLYLFMIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSR  673

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  674   PTDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  733

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  734   VTPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  777



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/761 (50%), Positives = 521/761 (68%), Gaps = 42/761 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE M +LFV++VKAR LP+        P V+V V     ++    K    EW+  
Sbjct  263   STYDLVEPMQFLFVRVVKARDLPSKDVTGSLDPYVEVRVGNYRGVTSHFEKRQNPEWNAV  322

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS +E+ V D           D+   +F+G I FD+ E+P+R PPDSPLA
Sbjct  323   FAFAKDRI-QSSFVEVVVKD----------KDMLKDDFVGMIRFDLQEVPMRVPPDSPLA  371

Query  1247  PQWYRLE--GGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-------RSKVYQS  1399
             P+WY LE   G   KG+LMLA W+GTQADE++PDAW +D AG   S       RSKVY S
Sbjct  372   PEWYHLESKNGKKKKGELMLAVWMGTQADEAYPDAWHSDAAGPVDSSVFSSLIRSKVYHS  431

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDL  1570
             P+LWY+R +VIEAQD+      S+E+ F    +K Q+G QV +TK   + T +  WNEDL
Sbjct  432   PRLWYVRVNVIEAQDLII----SEETRFPDVYVKVQVGNQVLRTKAVQTRTMNVLWNEDL  487

Query  1571  VFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE----  1738
             +FVAAEP  E YL+  + + + P ++ V G   IPL ++ERR DDR V S+WF  +    
Sbjct  488   MFVAAEPL-EDYLILSVEDRVGPNKEDVFGRVIIPLKTVERRADDRIVHSKWFNLQKPGA  546

Query  1739  -DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              D +E K+  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELG++  
Sbjct  547   TDVHETKKDKFASRLHLRVCLDGGYHVLDESTHCSSDLRPTAKQLWKPPIGILELGVLSA  606

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
               L PMKT  G+G++D Y VAKYG KWVRTRTI D++ P++NEQYTW V+DPSTV+T+GV
Sbjct  607   NGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTIIDSMNPKYNEQYTWEVFDPSTVLTVGV  666

Query  2093  FDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             FDS +V    N KDVR+GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF 
Sbjct  667   FDSSDVGSNGN-KDVRIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRF-  724

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               T   + + +YS+P LP MH++RPL  +QQE LR  AV ++   LSR+EPPLR+EVV Y
Sbjct  725   SCTSMANMMFLYSRPPLPKMHYVRPLNIMQQEMLRHQAVNIVAARLSRAEPPLRKEVVEY  784

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M DADSH +SMR+ +AN+FR+++V   +  V KW  +   W+NP  T LVH L  +L+ F
Sbjct  785   MTDADSHLWSMRRSKANFFRLMSVCNGLFAVGKWFGEVCMWKNPVTTSLVHVLFAMLICF  844

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WNYR+R +    H +T+IS A+++  DELDEEFD  P T+ +D
Sbjct  845   PELILPTVFLYMFVIGIWNYRYRPKYP-PHMNTRISYADAVHPDELDEEFDTFPTTKSSD  903

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GDLATQGER+QAL++WRDPRAT IF+  C V A +LY+ P
Sbjct  904   LVRMRYDRLRSVAGRIQTVVGDLATQGERIQALLSWRDPRATAIFVTFCLVAAIVLYVTP  963

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              + +A+  GFY +RHP FR ++P   LNFFRRLP+  D ML
Sbjct  964   FQALALMAGFYVMRHPRFRHKLPPVPLNFFRRLPARTDSML  1004


 Score = 98.2 bits (243),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLL KDG G+SS +V + F GQ+ +T     DLNP WNE   F +S   +
Sbjct  5    KLGVEVVSAHNLLAKDGQGSSSAFVELKFDGQKFRTTVKENDLNPYWNETFCFTISNPDE  64

Query  332  IFGDMLELDVY-HDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    L + VY ++KN  P +    LG+V+++ T FV   +  + +YPLE+ ++ S  +G
Sbjct  65   LLNHTLVVHVYNNNKNGQPKS---CLGKVQISGTSFVPYSDAVVFHYPLEKVSIFSRSRG  121

Query  509  DIGLKIYFVD  538
            ++GLK++  D
Sbjct  122  ELGLKVFITD  131



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/762 (50%), Positives = 530/762 (70%), Gaps = 39/762 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I++   K    EW+  
Sbjct  270   STYDLVERMQYLFVRVVKARDLPNMDITGSLDPFVEVRVGNYRGITKHFEKQRNPEWNAV  329

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    +S++E+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  330   FAFSRERM-QASVVEVLVKD----------KDLVRDDFVGMVRFDLNDVPVRVPPDSPLA  378

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAG--NPTS----RSKVYQSP  1402
             P+WYRL  + G   +G+LMLA WVGTQADE+FPDAW +D A   +P++    +SKVY +P
Sbjct  379   PEWYRLVHKDGDKSRGELMLAVWVGTQADEAFPDAWHSDAATLEDPSAVTHMKSKVYHAP  438

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQDI           F ++AQ+G Q  +TKP  +   +P WNEDL+FVA
Sbjct  439   RLWYLRVNIIEAQDILIHDKTRYPDVF-VRAQVGHQHGRTKPVQARNFNPFWNEDLMFVA  497

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQN  1747
             AEPF +H L+  L + + P +   LG   IPL+ I+RR DDR V  +WF  E     D +
Sbjct  498   AEPFEDH-LILSLEDRVAPNKDETLGRIIIPLTMIDRRADDRIVHGKWFNLEKPVLVDVD  556

Query  1748  EEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             + KR  +  R+HLRLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELG++G + ++
Sbjct  557   QLKREKFSSRLHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGVLGAQGIV  616

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMKT  GKGS+D Y VAKYGSKWVRTRTI +N  P++NEQYTW VYDP+TV+TIG FD+ 
Sbjct  617   PMKTRDGKGSSDTYCVAKYGSKWVRTRTIMNNPNPKFNEQYTWEVYDPATVLTIGAFDNG  676

Query  2105  EVID-----PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             ++ D     P + KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF
Sbjct  677   QLGDRNGEKPSSGKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRF  736

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
               ST  ++ L++YS+P+LP MH+ RP+  +Q + LR  AV+++   LSR EPPLR+EVV 
Sbjct  737   -SSTSLVNMLYLYSRPLLPKMHYARPIPVLQVDMLRHQAVQIVAARLSRMEPPLRKEVVE  795

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YM D DSH +SMR+ +AN+FR++NV + +  + KW     AW+NP  T+LVH L ++LV 
Sbjct  796   YMSDFDSHLWSMRRSKANFFRLMNVFSGLFAISKWFSGVCAWKNPITTVLVHILFIMLVC  855

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             FP+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R  
Sbjct  856   FPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRSQ  914

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             ++VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT IF+  CF+ A +LY+ 
Sbjct  915   EIVRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCFIAAIVLYVT  974

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  975   PLQVLAALGGFYAMRHPRFRHRLPSTPVNFFRRLPARTDSML  1016


 Score = 99.8 bits (247),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV  A +L+PKDG G++S  V + F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVASAHDLMPKDGQGSASACVELTFDGQRFRTAIKEKDLNPVWNERFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+       +R +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYVYNIHKSVEGSR-SFLGKVRIAGTSFVPFTDAVIMHYPLEKRGMFSRVKGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  +
Sbjct  124  LGLKVYITN  132



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/765 (49%), Positives = 530/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M +LFV++VKAR LP         P V+V +     +++   K    EW+  
Sbjct  257   STYDLVEQMQFLFVRVVKARELPAMDVTGSLDPYVEVKIGNYKGVTKHMEKKQNPEWNVV  316

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ V D           D+   +F+G   FD++E+P+R PPDSPLA
Sbjct  317   FAFSRDRM-QASVLEVVVKD----------KDLVKDDFVGRARFDLNEVPMRVPPDSPLA  365

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D+A    S        RSKVY 
Sbjct  366   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFPDAWHSDSATPVDSSAAASTLIRSKVYH  425

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R ++IEAQD+     P++++ F    +K  +G QV KTK   + + +  WNED
Sbjct  426   APRLWYVRVNIIEAQDL----VPTEKNRFPDVYVKVHIGNQVMKTKTVQARSLTTLWNED  481

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  +LG   IPLS+++RR DDR + SRW+  E   
Sbjct  482   LLFVAAEPFEDH-LILSVEDRVGPGKDEILGRVIIPLSTVDRRADDRMIHSRWYNLEKPI  540

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HL++C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+
Sbjct  541   AVDVDQLKKEK-FSSRLHLQVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGIL  599

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  GKG++D Y VAKYG KW+RTRTI DNLCPR+NEQYTW V+DP+TV+T+
Sbjct  600   NAVGLHPMKTRDGKGTSDTYCVAKYGHKWIRTRTIVDNLCPRYNEQYTWEVFDPATVLTV  659

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +     +KD+++GKVRIRISTL TG+VY +++ L++L P+G+KKMGE+ +A
Sbjct  660   GVFDNSQLGEKGSNGNKDLKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHMA  719

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T  ++ L++YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+E
Sbjct  720   IRF-SCTSFVNMLYIYSRPLLPKMHYVRPFSVMQLDMLRHQAVNIVAARLGRAEPPLRKE  778

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR++++ + +  V KW  D   WRNP  T+LVH L ++
Sbjct  779   VVEYMSDVDSHLWSMRRSKANFFRLMSIFSGLFAVGKWFGDICMWRNPITTVLVHVLFLM  838

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  P +
Sbjct  839   LVCFPELILPTVFLYMFLIGVWNFRYRPRYP-PHMNTRISQADAVHPDELDEEFDTFPTS  897

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  ++VR RYD+LR +  R+QT++GD+ATQGERVQ+L++WRDPRAT IF+  C V A +L
Sbjct  898   RSPELVRLRYDRLRSVAGRIQTVVGDVATQGERVQSLLSWRDPRATAIFVTFCLVAALVL  957

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P ++IA   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  958   YVTPFQVIAALAGFYMMRHPRFRYRLPSAPINFFRRLPARTDSML  1002


 Score =   112 bits (281),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NL+PKDG G+SS +V + F GQ+ +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLMPKDGQGSSSAFVELYFDGQKFRTTIKEKDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LDVY   N   T   +FLG+V L  T FV   +  +++YP+E++ + S ++G+
Sbjct  65   L--HYLTLDVYIYNNTKATNSRSFLGKVSLTGTSFVPYSDAVVLHYPVEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/755 (50%), Positives = 518/755 (69%), Gaps = 34/755 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+MHYL+V++VKA+ LP      +  P V+V +     +++   K    EW+Q 
Sbjct  31    CTYDLVEQMHYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGMTKHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +SILE+ V D           DV   + +G   FD++EIP R PPDSPLA
Sbjct  91    FAFSKDRI-QASILEVIVKD----------KDVVLDDLIGRALFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A     G    RSKVY SPK
Sbjct  140   PQWYRLEDRHGNKVKGELMLAVWMGTQADEAFPDAWHSDAATVGPDGVANIRSKVYLSPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAA  1585
             LWY+R +VIEAQD+           F +KA LG Q  +T+ + + T +P WNEDL+FV A
Sbjct  200   LWYVRVNVIEAQDLVPHDKTRYPEVF-VKAMLGNQALRTRISPTKTLNPMWNEDLMFVVA  258

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ----NEE  1753
             EPF E  L+  L + + P +   LG   IPL +++RR+D R + SRWF  E       E+
Sbjct  259   EPFEEP-LILSLEDRVAPNKDETLGRCMIPLQNVQRRLDHRPLNSRWFNLEKHILVDGEK  317

Query  1754  KRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPM  1930
             K V +  R+HLR+  +GGYHV++E+ H  SD +PTA+QLWKP +G +E+GII    L+PM
Sbjct  318   KEVKFASRIHLRIFLEGGYHVLDESTHYSSDLKPTAKQLWKPSIGILEVGIISAHGLMPM  377

Query  1931  KTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEV  2110
             KT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVFD+  +
Sbjct  378   KTKDGRGTTDAYCVAKYGQKWVRTRTIVDSFMPKWNEQYTWEVFDPCTVITIGVFDNGHI  437

Query  2111  IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTL  2290
                   KD R+GKVRIR+STL   +VY +++ L+    +G+KKMGE++LA+RF  S+  +
Sbjct  438   --GGGGKDSRIGKVRIRLSTLEAERVYTHSYPLLAFHQSGVKKMGEVQLAIRFTCSS-LM  494

Query  2291  DFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADS  2470
             + LH+YSQP+LP MH+I PL  +Q +SLR  A+ +++  L+R+EPPL +EVV YMLD DS
Sbjct  495   NMLHMYSQPLLPRMHYIHPLSVIQLDSLRHQAMNIVSMRLNRAEPPLHKEVVEYMLDVDS  554

Query  2471  HSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIP  2650
             H +SMR+ +AN+FRI++V++ +I + KW D    WRNP  TIL+H L ++LV +P+LI+P
Sbjct  555   HMWSMRRSKANFFRIMSVLSGLIAIGKWFDQICNWRNPITTILIHVLFIILVLYPELILP  614

Query  2651  TFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARY  2830
             T   Y+F+IG WN+R+R R    H DT++S A+++  DELDEEFD  P +RP+D+VR RY
Sbjct  615   TVFLYLFLIGIWNFRWRPRHP-PHMDTRLSHADAVHPDELDEEFDTFPTSRPSDIVRMRY  673

Query  2831  DKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAM  3010
             D+LR +  RVQT++GDLATQGER Q+L++WRDPRAT +F+  C V A +LY+ P +++A+
Sbjct  674   DRLRSIAGRVQTVIGDLATQGERFQSLLSWRDPRATTLFVMFCLVAAVVLYVTPFQVVAL  733

Query  3011  AFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
               G Y LRHP FR ++PS  LNFFRRLP+ +D ML
Sbjct  734   LTGIYVLRHPRFRYKLPSAPLNFFRRLPARSDSML  768



>ref|XP_006653047.1| PREDICTED: uncharacterized protein LOC102701166 [Oryza brachyantha]
Length=1009

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/763 (50%), Positives = 531/763 (70%), Gaps = 41/763 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I+R   K    EW+  
Sbjct  263   STYDLVERMQYLFVRVVKARELPDMDVTGSLDPYVEVRVGNYRGITRHFEKQKNPEWNAV  322

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    ++ILE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  323   FAFSRDRM-QATILEVIVRD----------KDLLKDDFVGLVRFDLNDVPMRVPPDSPLA  371

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             P+WYRL  + G   +G+LMLA W+GTQADE+FPDAW +D A           +SKVY +P
Sbjct  372   PEWYRLVHKTGDKSRGELMLAVWIGTQADEAFPDAWHSDAATLDDASAVTHMKSKVYHAP  431

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQDI A+T  ++     ++AQ+G Q  +TKP  +   +P WNEDL+FVA
Sbjct  432   RLWYLRVNIIEAQDI-AITDKTRYPDVFVRAQVGHQHGRTKPVQARNFNPFWNEDLMFVA  490

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------D  1741
             AEPF +H L+  L + + P +  VLG   IPL+ I+RR DDR V  +WF  E       D
Sbjct  491   AEPFEDH-LILSLEDRVAPNKDEVLGRVFIPLTMIDRRADDRIVHGKWFNLEKPVLIDVD  549

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             Q ++++ +  R+HLRLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELGI+G + +
Sbjct  550   QLKKEK-FSTRIHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGILGAQGI  608

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKGS+D Y VAKYGSKWVRTRT+ +N  P++NEQYTW VYDP+TV+TIG FD+
Sbjct  609   VPMKTRDGKGSSDTYCVAKYGSKWVRTRTVVNNPNPKFNEQYTWEVYDPATVLTIGAFDN  668

Query  2102  WEVIDP-----ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
              ++ D       + KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+R
Sbjct  669   GQLGDKGGEKTSSCKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  ST  ++ +++YS+P+LP MH+ RP+  +Q + LR  AV+++   LSR EPPLR+EVV
Sbjct  729   F-SSTSLVNMMYLYSRPLLPKMHYARPIPVLQVDMLRHQAVQIVAARLSRMEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM D DSH +SMR+ +AN+FR+++V + +  V KW +   +WRNP  T+LVH L ++LV
Sbjct  788   EYMSDFDSHLWSMRRSKANFFRLMSVFSGLFAVSKWFNGVCSWRNPITTVLVHILFIMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRS  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              ++VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT IF+  C + A +LY+
Sbjct  907   PEIVRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCLIAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  967   TPLQVLAALAGFYVMRHPRFRYRLPSIPVNFFRRLPARTDSML  1009


 Score =   102 bits (254),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G++S  V ++F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVVSAHDLMPKDGQGSASACVELNFDGQRFRTAIKDKDLNPVWNERFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  +Y + N       +FLGRV++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYIY-NINKSMDGSKSFLGRVRIAGTSFVPFPDAVVMHYPLEKRGMFSRVKGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  +
Sbjct  124  LGLKVYITN  132



>ref|XP_009626688.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana tomentosiformis]
 ref|XP_009626690.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana tomentosiformis]
Length=1001

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/766 (49%), Positives = 526/766 (69%), Gaps = 44/766 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEW  1057
             M   ++DLVEKMH+LFV++VKAR LP      +  P V+V +     I++   K+    W
Sbjct  255   MSGCTYDLVEKMHFLFVRVVKARELPAMDVTGSVDPYVEVRIGNYKGITKHIEKSQNPLW  314

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             +  FAF R+    +S+LE+ V D           D+   +F+G   FD++E+P+R PPDS
Sbjct  315   NVVFAFTRERM-QASVLEVVVKD----------KDLLKDDFVGLCRFDLNEVPMRVPPDS  363

Query  1238  PLAPQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTD------TAGNPTSRSKVY  1393
             PLAP+WYRL  + G   KG+LMLA W+GTQADE+FPDAW +D      TA +   RSKVY
Sbjct  364   PLAPEWYRLADKKGEKIKGELMLAVWIGTQADEAFPDAWHSDAALSVDTAASTLIRSKVY  423

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P++++ F    +K Q+G QV KTKP  + T +P WNE
Sbjct  424   HAPRLWYVRVNVVEAQDLL----PTEKTRFPDAYVKVQIGNQVLKTKPVQARTFNPLWNE  479

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             DL+FVAAEPF E  L+  + + + P +  ++G   IPLS +E+R DD+ + SRWF  E  
Sbjct  480   DLLFVAAEPF-EDNLVLTVEDRVAPGKDEIIGRVIIPLSMVEKRADDKMIHSRWFNLEKP  538

Query  1739  -----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                  DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELG+
Sbjct  539   VAIDIDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGV  597

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG++D Y VAKYG KWVRTRTI DNLCP++NEQYTW V+DP+TV+T
Sbjct  598   LNAVGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTIVDNLCPKYNEQYTWEVFDPATVLT  657

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             +GVFD+  + D     +KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ L
Sbjct  658   VGVFDNSHLGDKGSNGTKDLKVGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGELHL  717

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF   T   + L+ YS P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+
Sbjct  718   AIRFT-CTSFANMLYKYSCPLLPKMHYVRPFTVMQLDMLRHQAVNIVAMRLGRAEPPLRK  776

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YM D DSH +SMR+ +AN+FR++++   +  V KW  D   W+NP  T+LVH L +
Sbjct  777   EVVEYMSDVDSHLWSMRRSKANFFRLMSIFTGLFAVGKWFGDICLWKNPITTVLVHVLFL  836

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV FP+LI+PT   Y+F+IG WNYR+R R    H +TK+S AES+  DELDEEFD  P 
Sbjct  837   MLVSFPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTKLSQAESVHPDELDEEFDTFPT  895

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R  ++VR RYD+LR +  R+QT++GD+ATQGER Q+L++WRDPRAT +F+  C + A +
Sbjct  896   SRGPELVRMRYDRLRSVAGRIQTVVGDVATQGERFQSLLSWRDPRATALFVTFCLIAALV  955

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P ++IA   G Y +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  956   LYVTPFQVIAALIGIYMMRHPRFRHRLPSVPINFFRRLPARTDSML  1001


 Score =   118 bits (295),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLLPKDG G+SS +V + F GQR +T    +DL+P WNE   FN+S  S+
Sbjct  7    KLGVEVVGAHNLLPKDGQGSSSSFVELYFDGQRFRTTIKEKDLSPVWNETFYFNISDPSN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +   ML LD Y   N+  T   +FLG++ +N T FV   +  +++YPLE++++ S ++G+
Sbjct  67   L--HMLVLDAYVYNNIRATQSRSFLGKITINGTSFVPYSDSVVLHYPLEKRSIFSRVRGE  124

Query  512  IGLKIYFVD  538
            +GLK+Y +D
Sbjct  125  LGLKVYIID  133



>ref|XP_003538346.1| PREDICTED: uncharacterized protein LOC100777951 isoform X1 [Glycine 
max]
 ref|XP_006590523.1| PREDICTED: uncharacterized protein LOC100777951 isoform X2 [Glycine 
max]
 ref|XP_006590524.1| PREDICTED: uncharacterized protein LOC100777951 isoform X3 [Glycine 
max]
Length=1006

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/765 (49%), Positives = 527/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I+R   K    EW+Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEVRIGNYKGITRHFDKNQSPEWNQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+L++ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSKDRM-QASVLDVVIKD----------KDLIKDDFVGIVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             P+WYRLE   G  +KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  370   PEWYRLEDKKGEKNKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTHAISAVMRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     P++++ F     K Q+G QV KTK   + T S  WNED
Sbjct  430   APRLWYVRVNVVEAQDL----VPTEKNRFPDVYAKVQIGNQVLKTKTVPARTLSALWNED  485

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPL+S+ERR DDR + SRWF  E   
Sbjct  486   LLFVAAEPFEDH-LIISVEDRVSPGKDEIIGRIIIPLNSVERRADDRIIHSRWFNLEKPV  544

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+ LRLC DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELG++
Sbjct  545   AIDVDQLKKEK-FSSRIQLRLCLDGGYHVLDESTHYSSDLRPTAKQLWKPPIGVLELGVL  603

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRTI+DNLCP++NEQYTW V+D +TV+T+
Sbjct  604   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTIADNLCPKYNEQYTWEVFDHATVLTV  663

Query  2087  GVFDSWEVIDPEN--SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +  N  SKD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA
Sbjct  664   GVFDNSQLGEKANGSSKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLA  723

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + L++YS+P+LP MH++RP    Q + LR  A+ ++   L R+EPPLR+E
Sbjct  724   IRF-SCTSFANMLYLYSRPLLPKMHYVRPFSVTQLDMLRHQAMNIVAARLGRAEPPLRKE  782

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR++ V + V  V KW  D   WRNP  T+LVH L ++
Sbjct  783   VVEYMSDVDSHLWSMRRSKANFFRLMTVFSGVFAVGKWFGDICMWRNPITTVLVHVLFLM  842

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS AE++  DELDEEFD  P +
Sbjct  843   LVCFPELILPTIFLYMFLIGVWNFRYRPRYP-PHMNTRISQAEAVHPDELDEEFDTFPTS  901

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GDLA+QGER+QAL++WRDPRAT IFI L  + A +L
Sbjct  902   RSPDLVRMRYDRLRSVAGRIQTVVGDLASQGERIQALLSWRDPRATSIFITLSLLSALVL  961

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P + +A   GFY +RHP FR R+P   +NFFRRLPS  D ML
Sbjct  962   YVTPFQAVAGLAGFYIMRHPRFRHRLPCTPVNFFRRLPSRTDTML  1006


 Score =   112 bits (279),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+S+ +V + F GQ+ +T    RDLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSNAFVELYFDGQKYRTTIKERDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    + LDVY   +   T   +FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYMALDVYIHCHTKATNSTSFLGKVSLTGTSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            IGLK+Y  +
Sbjct  123  IGLKVYITN  131



>ref|XP_004298739.1| PREDICTED: uncharacterized protein LOC101313699 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=1007

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/762 (48%), Positives = 528/762 (69%), Gaps = 40/762 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+  +     I++   K     W+Q 
Sbjct  262   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEARIGNYRGITKHYEKQQNPVWNQV  321

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  322   FAFSKDRM-QASVLEVVVKD----------KDLLKDDFVGIVRFDINEVPLRVPPDSPLA  370

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTA--------GNPTSRSKVYQ  1396
             P+WYRL  + G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  371   PEWYRLADKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSSPAASAVIRSKVYH  430

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             +P+LWY+R +VIEAQD+FA T  ++     +K Q+G QV KTK   +   +P WNEDL+F
Sbjct  431   APRLWYVRVNVIEAQDLFA-TEKNRFPDAYVKVQIGNQVMKTKTLQARNLNPLWNEDLLF  489

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VA+EPF +H L+  + + + P +  +LG   +PL+S++RR DDR + SRWF  E      
Sbjct  490   VASEPFEDH-LVISVEDRVGPGKDEILGRVILPLNSVDRRADDRMIHSRWFNLEKPVAVD  548

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+   
Sbjct  549   VDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPAIGVLELGILNAV  607

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+G++D Y VAKYG KWVRTRT+ DNLCP++NEQYTW V+DPSTV+T+GVF
Sbjct  608   GLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLCPKYNEQYTWEVFDPSTVLTVGVF  667

Query  2096  DSWEVIDPENS--KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             D+ ++ D +++  KD+++GKVRIRISTL  G++Y +++ L++L PAG+KKMGE+ LA+RF
Sbjct  668   DNSQLGDKDSNGHKDLKIGKVRIRISTLEAGRIYTHSYPLLVLHPAGVKKMGELHLAIRF  727

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
                T  ++ L+ YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EVV 
Sbjct  728   -SCTSFVNMLYTYSKPLLPKMHYVRPFNVMQLDMLRHQAVNIVAARLGRAEPPLRKEVVE  786

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YM D DSH +SMR+ +AN+FR++ V + V  + KW  D   W+NP  T+LVH L ++LV+
Sbjct  787   YMSDVDSHLWSMRRSKANFFRLMTVFSGVFAIGKWFTDICMWKNPITTVLVHVLFLMLVF  846

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             FP+LI+PT   Y+F+IG WN+R+R R    H +TKIS A+ +  DELDEEFD  P +R  
Sbjct  847   FPELILPTAFLYMFLIGVWNFRYRPRYP-PHMNTKISQADLVHPDELDEEFDTFPTSRNP  905

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             ++VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT +F+  C + A ++Y+ 
Sbjct  906   ELVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATALFVTFCLIAALVMYVT  965

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++A   GF+ +RHP FR RMPS  +NFFRRLP+  D ML
Sbjct  966   PFQVVAALAGFFMMRHPRFRHRMPSAPINFFRRLPARTDSML  1007


 Score =   106 bits (264),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+S  +V + F GQR ++    +DLNP WNE   FN++  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSDAFVELYFDGQRFRSTIKEKDLNPVWNESFYFNIADPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+  NV  T   +FLG++ +    FV   +  +++YPLE++ + S ++G+
Sbjct  65   LHYLTLEAYVYN--NVKATHSRSFLGKISVTGNSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYVTD  131



>ref|XP_009779007.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana sylvestris]
 ref|XP_009779009.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana sylvestris]
Length=1002

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/766 (49%), Positives = 524/766 (68%), Gaps = 44/766 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEW  1057
             M   ++DLVEKMH+LFV++VKAR LP      +  P V+V +     I++   K     W
Sbjct  256   MSGCTYDLVEKMHFLFVRVVKARELPAMDVTGSVDPYVEVRIGNYKGITKHIEKNQNPSW  315

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             +  FAF R+    +S+LE+ V D           D+   +F+G   FD++E+P+R PPDS
Sbjct  316   NVVFAFSRERM-QASVLEVVVKD----------KDLLKDDFVGLCRFDLNEVPMRVPPDS  364

Query  1238  PLAPQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTD------TAGNPTSRSKVY  1393
             PLAP+WYRL  + G   KG+LMLA W+GTQADE+FPDAW +D      TA +   RSKVY
Sbjct  365   PLAPEWYRLADKKGEKIKGELMLAVWIGTQADEAFPDAWHSDAALSVDTAASTLIRSKVY  424

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P++++ F    +K Q+G QV KTKP  + T +P WNE
Sbjct  425   HAPRLWYVRVNVVEAQDLI----PTEKTRFPDAYVKVQIGNQVLKTKPVQARTFNPLWNE  480

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             DL+FVAAEPF E  L+  + + + P +  ++G   IPLS +E+R DD+ + SRWF  E  
Sbjct  481   DLLFVAAEPF-EDNLVLTVEDRVAPGKDEIIGRVIIPLSMVEKRADDKMIHSRWFNLEKP  539

Query  1739  -----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                  DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELG+
Sbjct  540   VAIDIDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGV  598

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG++D Y VAKYG KWVRTRTI DNLCP++NEQYTW V+DP+TV+T
Sbjct  599   LNAVGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTIVDNLCPKYNEQYTWEVFDPATVLT  658

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             +GVFD+  + D     +KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ L
Sbjct  659   VGVFDNSHLGDKGSNGTKDLKVGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGELHL  718

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF   T   + L+ YS P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+
Sbjct  719   AIRFT-CTSFANMLYKYSCPLLPKMHYVRPFTVMQLDMLRHQAVNIVAMRLGRAEPPLRK  777

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YM D DSH +SMR+ +AN+FR++++   +  V KW  D   W+N   T+LVH L +
Sbjct  778   EVVEYMSDVDSHLWSMRRSKANFFRLMSIFTGLFAVGKWFGDICMWKNSITTVLVHVLFL  837

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV FP+LI+PT   Y+F+IG WNYR+R R    H +TK+S AES+  DELDEEFD  P 
Sbjct  838   MLVSFPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTKLSQAESVHPDELDEEFDTFPT  896

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R  ++VR RYD+LR +  R+QT++GD+ATQGER Q+L++WRDPRAT +F+  C + A +
Sbjct  897   SRSPELVRMRYDRLRSVAGRIQTVVGDVATQGERFQSLLSWRDPRATALFVTFCLIAALV  956

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P ++IA   G Y +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  957   LYVTPFQVIAALIGIYMMRHPRFRHRLPSVPINFFRRLPARTDSML  1002


 Score =   118 bits (295),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLLPKDG G+SS +V + F GQR +T    +DL+P WNE   FN+S  S+
Sbjct  7    KLGVEVVGAHNLLPKDGQGSSSSFVELYFDGQRFRTTIKEKDLSPVWNETFYFNISDPSN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +   ML LD Y   N+  T   +FLG++ +N T FV   +  +++YPLE++++ S ++G+
Sbjct  67   L--HMLVLDAYIYNNIRATQSRSFLGKITINGTSFVPYSDSVVLHYPLEKRSIFSRVRGE  124

Query  512  IGLKIYFVD  538
            +GLK+Y +D
Sbjct  125  LGLKVYIID  133



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/763 (50%), Positives = 525/763 (69%), Gaps = 41/763 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I++   K    EW+  
Sbjct  263   STYDLVERMQYLFVRVVKARDLPDMDITGSLDPFVEVRVGNYRGITKHFEKQRNPEWNAV  322

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  323   FAFARDRM-QASVLEVLVKD----------KDLVKDDFVGMVRFDLNDVPIRVPPDSPLA  371

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             P+WYRL  + G   +G+LMLA WVGTQADE+FPDAW +D A           +SKVY +P
Sbjct  372   PEWYRLVHKSGDKSRGELMLAVWVGTQADEAFPDAWHSDAATLDDASAVTHMKSKVYHAP  431

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQDI           F ++AQ+G Q  +TKP  +   +P WNEDL+FVA
Sbjct  432   RLWYLRVNIIEAQDILIHDKTRYPDVF-VRAQVGHQHGRTKPVQARNFNPFWNEDLMFVA  490

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------D  1741
             AEPF +H L+  L + + P +  +LG   IPL+ +ERR DDR V  +WF  E       D
Sbjct  491   AEPFEDH-LILTLEDRVGPNKDEMLGRIIIPLTMVERRADDRIVHGKWFNLEKPVLVDVD  549

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             Q ++++ +  R+HLRLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELG++G + +
Sbjct  550   QLKKEK-FSSRLHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGVLGAQGI  608

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKGS+D Y VAKYGSKW+RTRTI +N  P++NEQYTW VYDP+TV+TIG FD+
Sbjct  609   VPMKTRDGKGSSDTYCVAKYGSKWIRTRTIMNNPNPKFNEQYTWEVYDPATVLTIGAFDN  668

Query  2102  WEVIDPE-----NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
              ++ D       N KD ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+R
Sbjct  669   GQLGDKNGEKTSNGKDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  ST  ++ L++YS+P+LP MH+ RP+   Q + LR  AV+++   LSR EPPLR+EVV
Sbjct  729   F-SSTSLVNMLYLYSRPLLPKMHYARPIPVHQVDMLRHQAVQIVAARLSRMEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM D DSH +SMR+ +AN+FR+++V + +  V KW     AW+NP  T+LVH L ++LV
Sbjct  788   EYMSDFDSHLWSMRRSKANFFRLMSVFSGLFAVSKWFSGVCAWKNPITTVLVHILFIMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRS  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              ++VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT IF+  CF  A +LY+
Sbjct  907   QEIVRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCFTAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A   GFY +RHP FR R+PS  +NFFRR+P+  D ML
Sbjct  967   TPLQVLAALGGFYAMRHPRFRHRLPSIPVNFFRRMPARTDSML  1009


 Score =   104 bits (260),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV  A +L+PKDGHG++S  V ++F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVASAHDLMPKDGHGSASACVELNFDGQRFRTAIKEKDLNPVWNEHFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY + N    +  +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYVY-NVNKSVESSRSFLGKVRIAGTSFVPFPDAVIMHYPLEKRGMFSRVRGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  +
Sbjct  124  LGLKVYITN  132



>ref|XP_004244612.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
 ref|XP_010324629.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
 ref|XP_010324630.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=1000

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/766 (49%), Positives = 524/766 (68%), Gaps = 44/766 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEW  1057
             M   ++DLVEKMH+LFV++VKAR LP      +  P V+V +     I++   K     W
Sbjct  254   MSGCTYDLVEKMHFLFVRVVKARELPAMDITGSVDPYVEVRIGNYKGITKHIEKNQNPMW  313

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             +  FAF R+    +S+LE+ V D           D+   +F+G   FD++E+P+R PPDS
Sbjct  314   NVVFAFSRERM-QASVLEVVVKD----------KDLVKDDFVGLCRFDLNEVPMRVPPDS  362

Query  1238  PLAPQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTD------TAGNPTSRSKVY  1393
             PLAP+WYRL  + G   KG+LMLA W+GTQADE++PDAW +D      T  +   RSKVY
Sbjct  363   PLAPEWYRLADKKGEKIKGELMLAVWIGTQADEAYPDAWHSDAALSVDTVASTLIRSKVY  422

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P+ ++ F    +KAQ+G QV KTKP  + T +P WNE
Sbjct  423   HAPRLWYVRVNVVEAQDL----VPTDKTRFPDTYVKAQIGNQVLKTKPVQARTFNPLWNE  478

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             DL+FVAAEPF E  L+  + + + P +  ++G   IPLS +E+R DDR + SRWF  E  
Sbjct  479   DLLFVAAEPF-EDNLVLTVEDRVAPGKDEIIGRVIIPLSMVEKRADDRMIHSRWFNLEKP  537

Query  1739  -----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                  DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELG+
Sbjct  538   VVVDIDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGV  596

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG++D Y VAKYG KW+RTRTI DNLCP++NEQYTW V+DP+TV+T
Sbjct  597   LNAVGLHPMKTRDGKGTSDTYCVAKYGHKWIRTRTIVDNLCPKYNEQYTWEVFDPATVLT  656

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             +GVFD+ ++ +     +KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ L
Sbjct  657   VGVFDNTQLGEKGSNGTKDLKVGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGELHL  716

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF   T   + L+ YS P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+
Sbjct  717   AIRFT-CTSFANMLYKYSCPLLPKMHYVRPFTVMQLDMLRHQAVNIVAMRLGRAEPPLRK  775

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YM D DSH +SMR+ +AN+FR++++   +    KW  D   W+NP  T+LVH L +
Sbjct  776   EVVEYMSDVDSHLWSMRRSKANFFRLMSIFTGLFAAGKWFGDICMWKNPITTVLVHVLFL  835

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV FP+LI+PT   Y+F+IG WNYR+R R    H +TK+S AES+  DELDEEFD  P 
Sbjct  836   MLVSFPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTKLSQAESVHPDELDEEFDTFPT  894

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R  ++VR RYD+LR +  R+QT++GD+ATQGER+Q+L++WRDPRAT +F+  C V A  
Sbjct  895   SRSPELVRMRYDRLRSVAGRIQTVVGDVATQGERLQSLLSWRDPRATALFVTFCLVAALA  954

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +Y+ P ++IA   G Y +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  955   MYVTPFQVIAALIGIYMMRHPRFRHRLPSVPVNFFRRLPARTDSML  1000


 Score =   117 bits (294),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLLPKDG G+SS +V + F GQR +T    +DL+P WNE   FN+S  S+
Sbjct  7    KLGVEVVGAHNLLPKDGQGSSSSFVELYFDGQRFRTTIKEKDLSPVWNETFYFNISDPSN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            I   ML LD Y   N+  +   +FLG++ +N T FV   +  +++YPLE++++ S ++G+
Sbjct  67   I--HMLTLDAYVYNNIRASQSRSFLGKITINGTSFVPYSDAVVLHYPLEKRSIFSRVRGE  124

Query  512  IGLKIYFVD  538
            +GLK+Y +D
Sbjct  125  LGLKVYVID  133



>ref|XP_006574306.1| PREDICTED: uncharacterized protein LOC100817962, partial [Glycine 
max]
Length=947

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/765 (50%), Positives = 525/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I+R   K    EW+Q 
Sbjct  202   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEVRIGNYKGITRHFDKNQSPEWNQV  261

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+L++ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  262   FAFSKDRM-QASVLDVVIKD----------KDLIKDDFVGIVRFDINEVPLRVPPDSPLA  310

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  311   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTHAISAVMRSKVYH  370

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     P++++ F     K Q+G QV KTK   + T S  WNED
Sbjct  371   APRLWYVRVNVVEAQDL----VPTEKNRFPDVYAKVQIGNQVLKTKTVPARTLSALWNED  426

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L   + + + P +  V+G   IPL+S+ERR DDR + SRWF  E   
Sbjct  427   LLFVAAEPFEDH-LTISVEDRVSPGKDEVIGRIIIPLNSVERRADDRIIHSRWFNLEKLV  485

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+ LRLC DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELG++
Sbjct  486   AIDVDQLKKEK-FSSRIQLRLCLDGGYHVLDESTHYSSDLRPTAKQLWKPPIGVLELGVL  544

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRTI+DNLCP++NEQYTW V+D +TV+T+
Sbjct  545   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTIADNLCPKYNEQYTWEVFDHATVLTV  604

Query  2087  GVFDSWEVIDPEN--SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +  N  SKD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA
Sbjct  605   GVFDNSQLGEKGNGSSKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLA  664

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + L++YS+P+LP MH++RP    Q + LR  A+ ++   L R+EPPLR+E
Sbjct  665   IRF-SCTSLANMLYLYSRPLLPKMHYVRPFSVTQLDMLRHQAMNIVAARLGRAEPPLRKE  723

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR+++V + V  V KW  D   WRNP  T LVH L ++
Sbjct  724   VVEYMSDVDSHLWSMRRSKANFFRVMSVFSGVFAVGKWFGDICMWRNPITTALVHVLFLM  783

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS AE++  DELDEEFD  P  
Sbjct  784   LVCFPELILPTVFLYMFLIGVWNFRYRPRYP-PHMNTRISQAEAVHPDELDEEFDTFPTN  842

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GDLA+QGER+QAL++WRDPRAT IFI LC + A +L
Sbjct  843   RSPDLVRMRYDRLRSVAGRIQTVVGDLASQGERIQALLSWRDPRATSIFITLCLLSALVL  902

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P + +A   GFY +RHP FR R+P   +NFFRRLP+  D ML
Sbjct  903   YVTPFQAVAGLAGFYIMRHPRFRHRLPCTPVNFFRRLPARTDCML  947


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  347  LELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGDIGLKI  526
            L LD Y   +   T   +FLG+V L  T FV   +  +++YPLE++ + S ++G+IGLK+
Sbjct  9    LTLDAYVHCHTKATNSTSFLGKVSLTGTSFVPYSDAIVLHYPLEKRGIFSRVRGEIGLKV  68

Query  527  YFVD  538
            Y  +
Sbjct  69   YITN  72



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/761 (50%), Positives = 527/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V      ++   K    EW + 
Sbjct  260   STYDLVEQMQYLFVRVVKARDLPAMDVTGSLDPFVEVRVGNYRGNTKHFEKKQNPEWKEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    SS+L++ V D           ++   +F+G I FD++++P R PPDSPLA
Sbjct  320   FAFSRDR-MQSSVLDVVVKD----------KNLVKDDFVGFIRFDLNDVPTRVPPDSPLA  368

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTD-------TAGNPTSRSKVYQS  1399
             P+WYRLE   G   KG+LMLA W GTQADE+FPDAW++D       +  +   RSKVY +
Sbjct  369   PEWYRLEDKKGDKTKGELMLAVWFGTQADEAFPDAWQSDVVMPVDASVVSSHIRSKVYHA  428

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+  ++IEAQDI  +   ++     +KA +G Q+ +T+   + T +P WNE+ +FV
Sbjct  429   PRLWYVYVNIIEAQDII-IADKTRFPDVFVKAHIGNQLLRTRMVQARTFNPLWNEEFMFV  487

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
              AEPF +H L+  + + + P +  V+G   IPL S+E+R DDR +  RWF  E       
Sbjct  488   VAEPFEDH-LILSVEDKVGPNKDEVIGRVVIPLGSMEKRADDRMIHGRWFNLEKPVAVDV  546

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + 
Sbjct  547   DQIKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLELGILNAEG  605

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KWVRTRTI ++L P++NEQYTW VYDP+TV+T+GVFD
Sbjct  606   LHPMKTRDGKGTSDTYCVAKYGQKWVRTRTIINSLSPKYNEQYTWEVYDPATVLTVGVFD  665

Query  2099  SWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             + ++ +  P  ++DV++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF 
Sbjct  666   NCQLGEKGPNGNRDVKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRF-  724

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              ST  ++ + +YS+P+LP MH+IRPL   Q + LR  AV+++   LSR EPPLRREVV Y
Sbjct  725   SSTSLINMMCIYSRPLLPKMHYIRPLTVRQLDMLRHQAVQIVAARLSRMEPPLRREVVEY  784

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR+++V + +  V KW  D  AW+NP  T+LVH L ++LV F
Sbjct  785   MSDVDSHLWSMRRSKANFFRLMSVFSGLFAVGKWFGDVCAWKNPITTVLVHILFLMLVCF  844

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R  D
Sbjct  845   PELILPTIFLYMFLIGLWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRSAD  903

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IF+  C + A +LY+ P
Sbjct  904   LVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLMAALVLYVTP  963

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A+  GFY +RHP FR RMPSP LNFFRRLP+  D ML
Sbjct  964   FQVLAVLAGFYIMRHPRFRHRMPSPPLNFFRRLPARTDSML  1004


 Score =   102 bits (255),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEVI A +L+PKDG G++SP V + F GQ+ +T    +DLNP WNE   FN+S  + 
Sbjct  5    KLGVEVISAHDLMPKDGQGSASPCVELHFDGQKFRTTIKEKDLNPVWNERFYFNISDPAS  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+      +   +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPDLALEAFVYNINKAAHS--RSFLGKVRIAGTSFVPFADAVVMHYPLEKRGIFSRVKGE  122

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  123  LGLKVFLTD  131



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/759 (50%), Positives = 513/759 (68%), Gaps = 36/759 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  34    NTYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  93

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   +S             + +    D    +F+G + FD++EIP R PPDSPLA
Sbjct  94    FAFSKDRIQASV-----------VEVVVKDKDFVKDDFMGMVLFDLNEIPKRVPPDSPLA  142

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS-----RSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A  P       RSKVY SPK
Sbjct  143   PQWYRLEDRKGEKVKGELMLAVWMGTQADEAFPDAWHSDAATVPGDGLANIRSKVYLSPK  202

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVAA  1585
             LWY+R ++IEAQD+     P     F +KA +G Q  +T+ + S   +P WNEDL+FV A
Sbjct  203   LWYVRVNIIEAQDLLLNAKPGFPEVF-VKATIGNQTLRTRISPSRCPNPLWNEDLMFVVA  261

Query  1586  EPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQNE  1750
             EPF EH L+  + E + P +  VLG A I L  +ERR D R + SRW+  E     D  +
Sbjct  262   EPFEEH-LILSVEERIGPNKDEVLGKAVIHLQKVERRFDCRIINSRWYHLEKHVAADGEQ  320

Query  1751  EKRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
             +K V +  R+HLRLC DGGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+  + LLP
Sbjct  321   KKEVKFASRIHLRLCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGILELGILTAQGLLP  380

Query  1928  MKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             MKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+T+GVFD+  
Sbjct  381   MKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFSPKWNEQYTWEVYDPCTVITVGVFDNCH  440

Query  2108  VI--DPEN-SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             +   D  N +KD R+GKVRIR+STL T KVY +++ L++L   G+KKMGE+ LAVRF  S
Sbjct  441   LQGGDKANGAKDNRIGKVRIRLSTLETDKVYTHSYPLLVLHTTGVKKMGEVHLAVRFSCS  500

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +  L+ LH YS+P+LP MH++ PL   Q + LR  + ++++T L R+EPPLR+EVV YML
Sbjct  501   S-LLNMLHTYSRPLLPKMHYLHPLTVTQLDYLRHQSTQIVSTRLGRAEPPLRKEVVEYML  559

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D  SH +SMR+ +AN+FRIINV++ +I   +W      W+NP  T+L+H L V+LV +P+
Sbjct  560   DVGSHMWSMRRSKANFFRIINVLSGLIATGRWFGQICLWKNPITTVLIHVLYVILVLYPE  619

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG W YR+R R K  H DT++S A++   DELDEEFD  P +RP ++V
Sbjct  620   LILPTMFLYLFLIGVWYYRWRPR-KPPHMDTRLSHADTAHPDELDEEFDTFPTSRPPEIV  678

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  RVQT++GDLATQGER Q+L++WRDPRAT +F+  C   A +LY+ P +
Sbjct  679   RMRYDRLRSVAGRVQTVVGDLATQGERFQSLLSWRDPRATALFLIFCLAAAIVLYVTPFQ  738

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++A+  GFY LRHP FR R+PS  LNFFRRLP+  D ML
Sbjct  739   VVALLTGFYVLRHPRFRHRLPSVPLNFFRRLPARTDSML  777



>ref|XP_010032396.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Eucalyptus grandis]
Length=798

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/766 (49%), Positives = 525/766 (69%), Gaps = 43/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKAR LP +       P V+V +      +R   K +  EW+Q 
Sbjct  48    STYDLVEQMFYLYVRVVKARDLPPSSITGSCDPYVEVKLGNYRGRTRHFEKKMNPEWNQV  107

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   SS+ LE+ V D            V   +++G + FD++EIP R PP+SPLA
Sbjct  108   FAFSKDRIQSST-LEVFVKD---------KEMVGRDDYVGRVVFDLNEIPTRVPPNSPLA  157

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   GGG  +G++MLA W+GTQADE+FP+AW +D +     G    RSKVY SP
Sbjct  158   PQWYRLEDRRGGGKLRGEMMLAVWMGTQADEAFPEAWHSDASSVYGEGVHNVRSKVYVSP  217

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+      S+     +KAQ+G QV +TK   + T +P WNEDLVFVA
Sbjct  218   KLWYLRVNVIEAQDVLP-NDRSRLPDLFVKAQVGSQVLRTKICPTRTTNPLWNEDLVFVA  276

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--------  1738
             AEPF E  L+  + + + P ++ ++G   +PL + E+R+D R V SRWF  E        
Sbjct  277   AEPF-EELLVITVEDRVHPSKEEMMGKIILPLDTFEKRLDHRPVHSRWFNLEKYGFGALE  335

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              D+ +E + +  R+HLR+C +GGYHV++E+    SD RPT+RQLWKPPVG +E+GI+  +
Sbjct  336   ADRRKELK-FSSRIHLRVCLEGGYHVLDESTLYISDQRPTSRQLWKPPVGILEVGILSAQ  394

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              LLPMK   G+G+TDAY VAKYG KWVRTRTI D + P+W+EQYTW VYDP TV+T+GVF
Sbjct  395   GLLPMKMKDGRGTTDAYCVAKYGQKWVRTRTILDTMNPKWSEQYTWEVYDPCTVMTLGVF  454

Query  2096  DSWEVIDPENS------KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             D+  +   E S      +D ++GKVRIR+STL   ++Y +++ L++L P G+KKMGE++L
Sbjct  455   DNCHLGGGEKSATGSAARDSQIGKVRIRLSTLEAHRIYTHSYPLLVLQPQGVKKMGELQL  514

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A RF  +    + ++VY  P+LP MH+++P    Q +SLR  A+ ++   L R+EPPLR+
Sbjct  515   AFRFT-TLSLANMIYVYGHPLLPKMHYLQPFTVNQVDSLRYQAMNIVALRLGRAEPPLRK  573

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLD DSH +SMR+ +AN+FRI+++++ +I++ +W  D   W+NP  ++LVH L +
Sbjct  574   EVVEYMLDVDSHLWSMRRSKANFFRIMSLLSGMINMGRWFGDVGNWKNPMTSVLVHILFL  633

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +L+W+P+LI+PT  FY+F+IG WNYRFR R    H DTKIS AE+   DELDEEFD  P 
Sbjct  634   ILIWYPELILPTLFFYMFLIGLWNYRFRPRHP-PHMDTKISWAEAAYPDELDEEFDTFPT  692

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +RP+D+VR RYD+LR +  R+QT++GD+ATQGER+Q+L+ WRDPRATG+FI  C   A +
Sbjct  693   SRPHDVVRMRYDRLRSVAGRIQTVVGDIATQGERLQSLLVWRDPRATGLFIMFCLCAAVV  752

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P K++A+  G YYLRHP FR ++PS   NFF+RLP+  D +L
Sbjct  753   LYVTPFKVVALVTGLYYLRHPRFRSKLPSVPSNFFKRLPARTDGLL  798



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 520/763 (68%), Gaps = 53/763 (7%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP-----TAGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  29    STYDLVEQMQYLYVRVVKAKDLPPKDVTGSCDPYVEVKMGNYKGTTRHFEKKTNPEWNQV  88

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS+LE++V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  89    FAFSKDRI-QSSVLEVTVKD----------KDFVKDDFMGRVLFDLNEIPKRVPPDSPLA  137

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   +G+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  138   PQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGIEGLANIRSKVYLSP  197

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P+ +  F    +KAQLG Q  +T+ ++S T +P WNEDL+
Sbjct  198   KLWYLRVNVIEAQDL----QPTDKGRFPEVYVKAQLGNQALRTRVSASRTINPMWNEDLM  253

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF EH L+  + + + P +  VLG   IPL  +++R+D + V +RW+  E     
Sbjct  254   FVAAEPFEEH-LILTVEDRVAPNKDEVLGKCMIPLQYVDKRLDHKPVNTRWYNLEKHIVV  312

Query  1742  QNEEKR--VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+   +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  313   EGEKKKDTKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQ  372

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  373   GLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSPTPKWNEQYTWEVFDPCTVITIGVF  432

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   +    ++D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  433   DNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLYPNGVKKMGEIHLAVR  492

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH++ PL   Q +SLR  A ++++  LSR+EPPLR+EVV
Sbjct  493   FTCSS-LLNMMHMYSQPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVV  551

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR++ +           +I V KW D    W+NP  T+L+H L ++LV
Sbjct  552   EYMLDVGSHMWSMRRILSG----------IIAVGKWFDQICNWKNPITTVLIHILFIILV  601

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP
Sbjct  602   LYPELILPTVFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRP  660

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  661   SDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYV  720

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  721   TPFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  763



>ref|XP_007040201.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
 gb|EOY24702.1| C2 calcium/lipid-binding plant phosphoribosyltransferase family 
protein [Theobroma cacao]
Length=1007

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/765 (50%), Positives = 526/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+MH+L+V++VKAR LP         P V+V V     I++   K    EW+Q 
Sbjct  262   STYDLVERMHFLYVRVVKARELPAMDVTGSIDPFVEVKVGNYKGITKHFEKKQNPEWNQV  321

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ + D           D+   +F+G I FD+SE+PLR PPDSPLA
Sbjct  322   FAFSRDRM-QASVLEVVIKD----------KDLVKDDFVGIIRFDISEVPLRVPPDSPLA  370

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA----GNPTS----RSKVYQ  1396
             P+WYRL+   G   KG+LMLA W+GTQADE+F DAW +D A      P +    RSKVY 
Sbjct  371   PEWYRLKDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTPATFTVLRSKVYH  430

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             SP+LWY+R +V+EAQD+     P++++ F    +KAQ+G QV KTKP  + T +  WNED
Sbjct  431   SPRLWYVRVNVVEAQDL----VPTEKNRFPDVYVKAQIGNQVLKTKPCQARTLNAIWNED  486

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G A IPL+SIE+R DDR + SRWF  E   
Sbjct  487   LLFVAAEPFEDH-LVLSVEDRVAPGKDEIIGRAIIPLNSIEKRADDRIIHSRWFNLEKPV  545

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELGI+
Sbjct  546   AVDVDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGIL  604

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KW+RTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  605   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWIRTRTLVDNLSPKYNEQYTWEVFDPATVLTV  664

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +     +KD+++GKVRIRISTL  G+VY +++ L++L P G+KKMGE+ LA
Sbjct  665   GVFDNSQLGEKGSNGNKDLKIGKVRIRISTLEAGRVYTHSYPLLVLHPTGVKKMGELHLA  724

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T  ++ L  YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+E
Sbjct  725   IRFT-CTSFVNMLCQYSRPLLPKMHYVRPFSVMQLDMLRHQAVNIVAARLGRAEPPLRKE  783

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMRK +AN+FR++ V + +  V KW  D   W+NP  T+LVH L ++
Sbjct  784   VVEYMSDVDSHLWSMRKSKANFFRLMTVFSGLFAVGKWFGDICMWKNPITTVLVHVLFLM  843

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             L   P+LI+PT   Y+F+IG WN+R R R    H +TKIS AE++  DELDEEFD  P +
Sbjct  844   LACLPELILPTVFLYMFLIGVWNFRHRPRYP-PHMNTKISQAEAVHPDELDEEFDTFPTS  902

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             +  ++VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRAT IFI  C V A +L
Sbjct  903   KSPELVRMRYDRLRSVAGRIQTVIGDVATQGERFQALLSWRDPRATAIFITFCLVAAIVL  962

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++ P ++IA   GFY +RHP FR R+P   +NFFRRLP+  D ML
Sbjct  963   FVTPFQVIAALTGFYVMRHPRFRYRLPPVPINFFRRLPARTDGML  1007


 Score =   110 bits (275),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G++S +V + F GQ+ +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSASSFVELYFDGQKFRTTIKEKDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD Y   N+  +   +FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYLSLDAYVYNNIKGSNTRSFLGKVCLTGTSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_006476597.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Citrus sinensis]
Length=1006

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/764 (49%), Positives = 527/764 (69%), Gaps = 45/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K    +W Q 
Sbjct  262   STYDLVERMYFLYVRVVKARELPAMDLTGSIDPFVEVKIGNYKGITKHYEKNQNPQWHQV  321

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  322   FAFSRDRM-QASVLEVVIKD----------KDLVKDDFVGIVRFDINEVPLRVPPDSPLA  370

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  371   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTPAITAVIRSKVYH  430

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             SP+LWY+R +V+EAQD+     P++++ F    +KAQ+G QV KTK   + T S  WNED
Sbjct  431   SPRLWYVRVNVVEAQDL----VPTEKNHFPDVYVKAQIGNQVLKTKICQARTLSAVWNED  486

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPLS+IE+R D+R + SRWF  E   
Sbjct  487   LLFVAAEPFEDH-LVLTVEDRVGPGKDEIIGRVIIPLSAIEKRADERIIHSRWFNLEKPV  545

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+
Sbjct  546   AVDVDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPSIGILELGIL  604

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  605   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTV  664

Query  2087  GVFDSWEVIDPEN-SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             GVFD+ ++ +  N +KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+
Sbjct  665   GVFDNSQLGEKSNGNKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLAI  724

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   T   + L++YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EV
Sbjct  725   RF-SCTSFANMLYLYSRPLLPKMHYVRPFSIMQLDMLRHQAVNIVAARLGRAEPPLRKEV  783

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM D DSH +SMR+ +AN+FR++ V + +  V KW  D   W+NP  T+LVH L ++L
Sbjct  784   VEYMSDVDSHLWSMRRSKANFFRLMTVFSGLFAVGKWFADICMWKNPITTVLVHVLYLML  843

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
               FP+LI+PT   Y+F+IG WNYR+R R    H + KIS AE++  DELDEEFD  P +R
Sbjct  844   ACFPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNIKISQAEAVHPDELDEEFDTFPTSR  902

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               +MVR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IFI  C V A +L+
Sbjct  903   SPEMVRMRYDRLRSVAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLF  962

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             L P ++IA   GF+ +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  963   LTPFQVIAALAGFWVMRHPRFRRRLPSVPINFFRRLPARTDSML  1006


 Score =   112 bits (279),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQR +T    +DLNP WNE   FN+S  S 
Sbjct  6    KLGVQVVGAHNLLPKDGKGSSSAFVELYFDGQRFRTTIKEKDLNPVWNESFYFNISDASK  65

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L L+ Y   N+G T   +FLG+V L    FV   +  +++YPLE++ + S ++G+
Sbjct  66   L--HYLTLEAYIYNNLGDTNSRSFLGKVCLTGNSFVPLSDSVVLHYPLEKRGIFSHVRGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  124  LGLKVYITD  132



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/761 (50%), Positives = 522/761 (69%), Gaps = 38/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M+YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMYYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRI-QASVLEVTVKD----------KDFVKDDFMGRVLFDLNEVPRRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRL+   G   KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  140   PQWYRLDDRKGDKVKGELMLAVWMGTQADEAFPEAWNSDAATVSGADGLANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR ++IEAQD+   T   +     +KA LG Q  +T+ + S T +P WNEDL+FVA
Sbjct  200   KLWYLRVNIIEAQDL-QPTDKGRYPEVFVKAILGNQALRTRISQSRTINPMWNEDLMFVA  258

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED-----QN  1747
             AEPF E  L+  + + + P +  VLG  +IPL  I+RR+D R V +RWF  E      + 
Sbjct  259   AEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYIDRRLDHRAVNTRWFNLEKHVVVVEG  317

Query  1748  EEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             E+K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  + L
Sbjct  318   EKKKEIKFSSRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKNSIGVLELGILNAQGL  377

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  G+G+TDAY VAKYG KW+RTRTI D+  P+WNEQYTW V+DP TV+TIGVFD+
Sbjct  378   MPMKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFIPKWNEQYTWEVFDPCTVITIGVFDN  437

Query  2102  WEV---IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
               +        SKD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF 
Sbjct  438   CHLHGGDKGGGSKDARIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFT  497

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              S+  L+ LH+YS P+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+EVV Y
Sbjct  498   CSS-LLNMLHMYSHPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEY  556

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLD  SH +SMR+ +AN+FRI+ V + +I V KW D    WRNP  T+L+H L ++LV +
Sbjct  557   MLDVGSHMWSMRRSKANFFRIMGVFSGLIAVGKWFDQICNWRNPITTVLIHILFIILVMY  616

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG W+YR+R R    H DT++S A+S   DELDEEFD  P +RP D
Sbjct  617   PELILPTIFLYLFLIGVWHYRWRPRHP-PHMDTRLSHADSSHPDELDEEFDTFPTSRPAD  675

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRA+ +F+  C V A +LY+ P
Sbjct  676   IVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRASALFVIFCLVSAIVLYVTP  735

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  736   FQVVALLSGIYVLRHPRFRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_006439584.1| hypothetical protein CICLE_v10023869mg [Citrus clementina]
 gb|ESR52824.1| hypothetical protein CICLE_v10023869mg [Citrus clementina]
Length=1005

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/761 (49%), Positives = 524/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K    +W Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDLTGSIDPFVEVKIGNYKGITKHYEKNQNPQWHQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSRDRM-QASVLEVVIKD----------KDLVKDDFVGIVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  370   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTPAITAVIRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             SP+LWY+R +V+EAQD+   T  +      +KAQ+G QVQKTK   + T S  WNEDL+F
Sbjct  430   SPRLWYVRVNVVEAQDLVP-TEKNHYPDVYVKAQIGNQVQKTKICQARTLSAVWNEDLLF  488

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF +H L+  + + + P +  ++G   IPLS+IE+R D+R + SRWF  E      
Sbjct  489   VAAEPFEDH-LVLTVEDRVGPGKDEIIGRVIIPLSAIEKRADERIIHSRWFNLEKPVAVD  547

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+   
Sbjct  548   VDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPSIGILELGILNAV  606

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+GVF
Sbjct  607   GLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTVGVF  666

Query  2096  DSWEVIDPEN-SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             D+ ++ +  N +KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+RF 
Sbjct  667   DNSQLGEKSNGNKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLAIRF-  725

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               T   + L++YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EVV Y
Sbjct  726   SCTSFANMLYLYSRPLLPKMHYVRPFSIMQLDMLRHQAVNIVAARLGRAEPPLRKEVVEY  785

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR++ V + +  V KW  D   W+NP  T+LVH L ++L  F
Sbjct  786   MSDVDSHLWSMRRSKANFFRLMTVFSGLFAVGKWFADICMWKNPITTVLVHVLYLMLACF  845

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WNYR+R R    H + KIS AE++  DELDEEFD  P +R  +
Sbjct  846   PELILPTVFLYMFLIGIWNYRYRPRYP-PHMNIKISQAEAVHPDELDEEFDTFPTSRSPE  904

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IFI  C V A +L+L P
Sbjct  905   LVRMRYDRLRSVAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLFLTP  964

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              ++IA   GF+ +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  965   FQVIAALAGFWVMRHPRFRRRLPSVPINFFRRLPARTDSML  1005


 Score =   111 bits (278),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQR +T     DLNP WNE   FN+S  S 
Sbjct  5    KLGVQVVGAHNLLPKDGKGSSSAFVELYFDGQRFRTTIKENDLNPVWNESFYFNISDASK  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L L+ Y   N+G T   +FLG+V L    FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYLTLEAYIYNNIGDTNSRSFLGKVCLTGNSFVPLSDSVVLHYPLEKRGIFSHVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/766 (49%), Positives = 524/766 (68%), Gaps = 47/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP+     +  P V+V +      +R   K    EW+Q 
Sbjct  29    STYDLVEQMQYLYVRVVKAKELPSKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  88

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  89    FAFSKDRI-QASVLEVFVKD----------KDFVKDDFIGRVWFDLNEIPKRVPPDSPLA  137

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   + K  G+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  138   PQWYRLEDRKSDKVKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  197

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  F    +KA LG Q  +T+ + S + +P WNEDL+
Sbjct  198   KLWYLRVNVIEAQDL----QPSDKGRFPEVYVKAILGNQTLRTRISQSRSINPMWNEDLM  253

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P ++ +LG   IPL  ++RR+D + V +RWF  E     
Sbjct  254   FVAAEPFEEP-LILSVEDRVAPNKEELLGKCVIPLQMMDRRLDHKPVNTRWFNIEKHVVI  312

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                D+ +E + +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+ 
Sbjct  313   MEGDKKKEIK-FASRIHMRVCLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLEVGILN  371

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
                L+PMK+  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIG
Sbjct  372   ASGLMPMKSNNGRGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIG  431

Query  2090  VFDSWEVI----DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             VFD+  +      P   +D ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI+L
Sbjct  432   VFDNCHLHHGGDKPGGQRDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIQL  491

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             AVRF  S+  L+ +H+YS P+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+
Sbjct  492   AVRFTCSS-LLNMMHMYSNPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRK  550

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L +
Sbjct  551   EVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWKNPITTVLIHILFI  610

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P 
Sbjct  611   ILVMYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPT  669

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             TRP+D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +
Sbjct  670   TRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIV  729

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  730   LYVTPFQVVALLSGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|NP_001168012.1| uncharacterized protein LOC100381735 [Zea mays]
 gb|ACN26830.1| unknown [Zea mays]
 tpg|DAA35284.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays]
 tpg|DAA35285.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays]
Length=1012

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/763 (50%), Positives = 532/763 (70%), Gaps = 41/763 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP----TAG-RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP    T G  P V+V V     I++   K    EW+  
Sbjct  266   STYDLVERMQYLFVRVVKARDLPDMDVTGGLDPYVEVRVGNYRGITKHFEKQKNPEWNAV  325

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  326   FAFSRDRM-QASVLEVVVKD----------KDLIKDDFVGFVRFDLNDVPIRVPPDSPLA  374

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAG--NPTS----RSKVYQSP  1402
             P+WYRL  + G    G+LMLA WVGTQADE+FPDAW +D A   +P++    +SKVY +P
Sbjct  375   PEWYRLVSKSGDKSMGELMLAVWVGTQADEAFPDAWHSDAATLEDPSAVTHMKSKVYHAP  434

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQD+  L        F ++AQ+G Q+ +TKP  +   +P WNED++FVA
Sbjct  435   RLWYLRVNIIEAQDVAILDKTRYPDVF-VRAQVGHQLGRTKPVQARNFNPFWNEDIMFVA  493

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------D  1741
             AEPF +H L+  L + + P +  +LG   IPL+ I+RR DDR V  +WF  E       D
Sbjct  494   AEPFEDH-LVLTLEDRVGPNKDEMLGRVIIPLAMIDRRADDRIVHGKWFNLEKPVLVDVD  552

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             Q ++++ +  R+HLRLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELG++G + +
Sbjct  553   QLKKEK-FSTRLHLRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGVLGAQGI  611

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKGS+D Y VAKYGSKWVRTRTI +N  PR+NEQYTW VYDP+TV+T+GVFD+
Sbjct  612   VPMKTRDGKGSSDTYCVAKYGSKWVRTRTIMNNPNPRFNEQYTWEVYDPATVLTVGVFDN  671

Query  2102  WEVIDP-----ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
              ++ +       + KD ++GKVRIR+STL TG+VY +++ L++L  +G+KKMGE+ LA+R
Sbjct  672   GQLGEKTGEKTSSGKDGKIGKVRIRLSTLETGRVYTHSYPLLVLHSSGVKKMGELHLAIR  731

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  ST  ++ L++YS+P+LP MH++RP+  +Q + LR  AV+++   LSR EPPLR+EVV
Sbjct  732   F-SSTSLVNMLYLYSRPLLPKMHYVRPIPVLQVDMLRHQAVQIVAARLSRMEPPLRKEVV  790

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM D DSH +SMRK +AN+FR++ V + +  V KW     +WRNP  T+LVH L ++LV
Sbjct  791   EYMTDFDSHLWSMRKSKANFFRLMTVFSGLFAVSKWFSGVCSWRNPITTVLVHILFIMLV  850

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE++  DELDEEFD  P +R 
Sbjct  851   CFPELILPTVFLYMFLIGIWNFRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRN  909

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              ++VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRAT +F+  C V A + Y+
Sbjct  910   PEVVRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATAVFVLFCLVAAIVFYV  969

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P ++IA   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  970   TPLQVIAALGGFYVMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012


 Score =   100 bits (249),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV  A +L+PKDG G++S  V + F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVASAHDLMPKDGQGSASACVELTFDGQRFRTAVKEKDLNPVWNERFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+      ++R +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYVYNVNKTLESSR-SFLGKVRIAGTSFVPFPDAVVMHYPLEKRGMFSRVKGE  123

Query  512  IGLKIYFVD  538
            +G+K+Y  +
Sbjct  124  LGMKVYITN  132



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/764 (49%), Positives = 523/764 (68%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYTEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +SILE++V D           DV   +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRI-QASILEVTVKD----------KDVVRDDFIGRVLFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA LG Q  +T+ + S T +P WNED++
Sbjct  199   KLWYLRVNVIEAQDL----QPSDKGRYPEVFVKATLGNQTLRTRISQSRTINPMWNEDMM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + +   ++  LG  +IPL  ++RR+D + V ++W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVASNKEESLGRCAIPLQMVDRRLDHKPVNTKWYNIEKHVVI  313

Query  1742  -QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              + E+K+  K   ++H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  314   MEGEKKKEIKFSSKIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNA  373

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + L+PMKT  GKG+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  374   QGLMPMKTKDGKGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIGV  433

Query  2093  FDSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +     P  +KD ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAV
Sbjct  434   FDNCHLHGGDKPGGAKDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAV  493

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YS P+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+
Sbjct  494   RFTCSS-LLNMMHMYSLPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRKEI  552

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++L
Sbjct  553   VEYMLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWKNPITTVLIHILFIIL  612

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P TR
Sbjct  613   VMYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTTR  671

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
              +D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  672   HSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  731

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   VTPFQVVALLSGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/763 (50%), Positives = 521/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +S+LE++V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  91    FAFSKERI-QASMLEVTVKD----------KDLVKDDFIGRVLFDMNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  140   PQWYRLEDRKGDKFKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDSLANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA LG QV +T+ + S + +P WNEDL+
Sbjct  200   KLWYLRVNVIEAQDL----VPSDQGRYPEVYVKAILGNQVLRTRVSPSRSINPMWNEDLM  255

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVA+EPF E  L+  + + + P +  VLG  +IP+  ++RR+D   V +RWF  E     
Sbjct  256   FVASEPFEEP-LILSVEDRIAPNKDEVLGRCAIPMHHVDRRLDHNPVNTRWFNLEKHVIV  314

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  315   EGEKKKEIKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKHSIGVLELGILNAQ  374

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMK   G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  375   GLMPMKPKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVFDPCTVITIGVF  434

Query  2096  DSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +     P  S+D R+GKVRIR+STL T +VY +++ L++L   G+KKMGEI LAVR
Sbjct  435   DNCHLHGGDKPGGSRDSRIGKVRIRLSTLETDRVYTHSYPLLVLHRNGVKKMGEIHLAVR  494

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YS P+LP MH+I PL   Q +SLR  A  +++  LSRSEPPLR+E+V
Sbjct  495   FTCSS-LLNMMHMYSHPLLPKMHYIHPLTVSQLDSLRHQATVIVSVRLSRSEPPLRKEIV  553

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+NV   +I + KW D    W+NP  T+L+H L ++LV
Sbjct  554   EYMLDVGSHMWSMRRSKANFFRIMNVFGGLIALGKWFDQICNWKNPITTVLIHILFIILV  613

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W+YR RSR    H DT++S AES   DELDEEFD  P ++ 
Sbjct  614   LYPELILPTIFLYLFLIGVWHYRRRSRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSQS  672

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  673   ADIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYI  732

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  733   TPFQVVAVLIGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/759 (50%), Positives = 518/759 (68%), Gaps = 36/759 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPGKDMTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S LE +V D           D    + +G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDR-IQASFLEATVKD----------KDFVKDDLIGRVVFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKVKGELMLAVWFGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA +G Q  +T+ + S T +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDLIP-TDKQRYPEVYVKAIVGNQALRTRVSQSRTINPMWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQN  1747
             AEPF E  L+  + + + P +  VLG  +IPL  ++RR D + V SRW+  E     D  
Sbjct  258   AEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYLDRRFDHKPVNSRWYNLEKHIMVDGE  316

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
             +++  +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+    L+P
Sbjct  317   KKETKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPNIGVLELGILNATGLMP  376

Query  1928  MKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             MKT  G+G+TDAY VAKYG KW+RTRTI D+  PRWNEQYTW V+DP TVVT+GVFD+  
Sbjct  377   MKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFTPRWNEQYTWEVFDPCTVVTVGVFDNCH  436

Query  2108  VIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             +   E    +KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF  S
Sbjct  437   LHGGEKIGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFTCS  496

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +  L+ +++YSQP+LP MH+I PL   Q ++LR  A ++++  L+R+EPPLR+EVV YML
Sbjct  497   S-LLNMMYMYSQPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLTRAEPPLRKEVVEYML  555

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D  SH +SMR+ +AN+FRI+ V++ +I V KW +    W+NP  T+L+H L ++LV +P+
Sbjct  556   DVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFEQICNWKNPITTVLIHLLFIILVLYPE  615

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP+D+V
Sbjct  616   LILPTIFLYLFLIGIWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIV  674

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A ILY+ P +
Sbjct  675   RMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQ  734

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   VVALCIGIYALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>gb|KHN35016.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=1005

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/765 (49%), Positives = 527/765 (69%), Gaps = 47/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I+R   K    EW+Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEVRIGNYKGITRHFDKNQSPEWNQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+L++ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSKDRM-QASVLDVVIKD----------KDLIKDDFVGIVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             P+WYRLE   G  +KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  370   PEWYRLEDKKGEKNKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTHAISAVMRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     P++++ F     K Q+G QV KTK   + T S  WNED
Sbjct  430   APRLWYVRVNVVEAQDL----VPTEKNRFPDVYAKVQIGNQVLKTKTVPARTLSALWNED  485

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPL+S+ERR DDR + SRWF  E   
Sbjct  486   LLFVAAEPFEDH-LIISVEDRVSPGKDEIIGRIIIPLNSVERRADDRIIHSRWFNLEKPV  544

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+ LRLC DGGYHV++E+ H  SD RPTA+QLWKPP+G +ELG++
Sbjct  545   AIDVDQLKKEK-FSSRIQLRLCLDGGYHVLDESTHYSSDLRPTAKQLWKPPIGVLELGVL  603

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRTI+DNLCP++NEQYTW V+D +TV+T+
Sbjct  604   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTIADNLCPKYNEQYTWEVFDHATVLTV  663

Query  2087  GVFDSWEVIDPEN--SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +  N  SKD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA
Sbjct  664   GVFDNSQLGEKANGSSKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLA  723

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + L++YS+P+LP MH++RP    Q + LR  A+ ++   L R+EPPLR+E
Sbjct  724   IRF-SCTSLANMLYLYSRPLLPKMHYVRPFSVTQLDMLRHQAMNIV-ARLGRAEPPLRKE  781

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR++ V + V  V KW  D   WRNP  T+LVH L ++
Sbjct  782   VVEYMSDVDSHLWSMRRSKANFFRLMTVFSGVFAVGKWFGDICMWRNPITTVLVHVLFLM  841

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS AE++  DELDEEFD  P +
Sbjct  842   LVCFPELILPTIFLYMFLIGVWNFRYRPRYP-PHMNTRISQAEAVHPDELDEEFDTFPTS  900

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GDLA+QGER+QAL++WRDPRAT IFI L  + A +L
Sbjct  901   RSPDLVRMRYDRLRSVAGRIQTVVGDLASQGERIQALLSWRDPRATSIFITLSLLSALVL  960

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P + +A   GFY +RHP FR R+P   +NFFRRLPS  D ML
Sbjct  961   YVTPFQAVAGLAGFYIMRHPRFRHRLPCTPVNFFRRLPSRTDTML  1005


 Score =   112 bits (279),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+S+ +V + F GQ+ +T    RDLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSNAFVELYFDGQKYRTTIKERDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    + LDVY   +   T   +FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYMALDVYIHCHTKATNSTSFLGKVSLTGTSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            IGLK+Y  +
Sbjct  123  IGLKVYITN  131



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/763 (49%), Positives = 523/763 (69%), Gaps = 41/763 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLV+KM YLFV++VKAR LP         P V+V +      +R   K    EW++ F
Sbjct  262   TYDLVQKMQYLFVRVVKARDLPHMDVTGSLDPYVEVRIGNYKGTTRHFEKKQNPEWNEVF  321

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF ++  + SS+L++ V D           D+   +F+G + FD+ E+P R PPDSPLAP
Sbjct  322   AFAKEN-EQSSVLDVVVKD----------KDLLKDDFVGLVRFDLHEVPTRVPPDSPLAP  370

Query  1250  QWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQS  1399
             +WYRL  + G   KG+LMLA W GTQADE+FPDAW +D  G            RSKVY S
Sbjct  371   EWYRLANKDGKKEKGELMLAVWYGTQADEAFPDAWHSDAIGPDDGSSVAYGHIRSKVYHS  430

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +VIEAQD+  L+  S+      K Q+G Q+ KTKP  S   +P WNEDL+FV
Sbjct  431   PRLWYVRVNVIEAQDL-VLSDKSRFPDAYAKVQIGNQILKTKPVQSRVMNPMWNEDLMFV  489

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +   LG  +IPL++IE+R DDR++  RW+  E       
Sbjct  490   AAEPFDDH-LIISIEDRVGPSKDETLGKVAIPLNTIEKRADDRKIRDRWYNLEKHMSDAM  548

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                 + ++K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+ 
Sbjct  549   EGEQRKKDKDKFFSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKSNIGVLELGILN  608

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
              + L PMKT  GKG++D Y VAKYG KWVRTRTI+++  P++NEQYTW V+DP+TV+T+G
Sbjct  609   AEGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTINNSQSPKYNEQYTWEVFDPATVLTVG  668

Query  2090  VFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             VFD+ ++ +P  S KD+++GKVRIRISTL TG+VY + + L++L P+G+KKMGE+ LA+R
Sbjct  669   VFDNSQIGNPNGSGKDMKIGKVRIRISTLETGRVYTHNYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F   T  ++ +  YS+P+LP MH++RPL  VQQ+ LR  AV ++   LSR+EPPLR+EVV
Sbjct  729   F-SCTSLVNMMFKYSRPLLPKMHYVRPLTVVQQDMLRYQAVNIVAARLSRAEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM DADSH +SMR+ +AN+FR+++V + +  + KW  +   W+NP  T LVH L V+LV
Sbjct  788   EYMSDADSHLWSMRRSKANFFRLMSVFSGLFAIGKWFGEVCMWKNPITTALVHVLFVMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNWRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTSRG  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT ++I  C V A +LY+
Sbjct  907   SDIVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++ +  G Y +RHP FR +MPS  +NFFRRLP+  D ML
Sbjct  967   TPFQVLVLLGGVYLMRHPRFRGKMPSAPVNFFRRLPARTDSML  1009


 Score =   107 bits (266),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG GASS +V + F  QR +T T  RDLNP WNE   F++S  ++
Sbjct  4    KLGVEVVAAHDLMPKDGQGASSAFVELHFDHQRFRTTTKERDLNPVWNETFYFHISDPNN  63

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  +YH    G      FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  64   LPNLTLEAFIYHH---GKANSKAFLGKVVLTGTSFVPYSDAVVLHYPLEKRGIFSRVKGE  120

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  121  LGLKVFVTD  129



>gb|KDO76164.1| hypothetical protein CISIN_1g045058mg [Citrus sinensis]
Length=1005

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/764 (49%), Positives = 527/764 (69%), Gaps = 45/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K    +W Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDLTGSIDPFVEVKIGNYKGITKHYEKNQNPQWHQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSRDRM-QASVLEVVIKD----------KDLVKDDFVGIVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  370   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAATPVDSTPAITAVIRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             SP+LWY+R +V+EAQD+     P++++ F    +KAQ+G QV KTK   + T S  WNED
Sbjct  430   SPRLWYVRVNVVEAQDL----VPTEKNHFPDVYVKAQIGNQVLKTKICQARTLSAVWNED  485

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPLS+IE+R D+R + SRWF  E   
Sbjct  486   LLFVAAEPFEDH-LVLTVEDRVGPGKDEIIGRVIIPLSAIEKRADERIIHSRWFNLEKPV  544

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+
Sbjct  545   AVDVDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPSIGILELGIL  603

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  604   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTV  663

Query  2087  GVFDSWEVIDPEN-SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             GVFD+ ++ +  N +KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+
Sbjct  664   GVFDNSQLGEKSNGNKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLAI  723

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF   T   + L++YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EV
Sbjct  724   RF-SCTSFANMLYLYSRPLLPKMHYVRPFSIMQLDMLRHQAVNIVAARLGRAEPPLRKEV  782

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM D DSH +SMR+ +AN+FR++ V + +  V KW  D   W+NP  T+LVH L ++L
Sbjct  783   VEYMSDVDSHLWSMRRSKANFFRLMTVFSGLFAVGKWFADICMWKNPITTVLVHVLYLML  842

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
               FP+LI+PT   Y+F+IG WNYR+R R    H + KIS AE++  DELDEEFD  P +R
Sbjct  843   ACFPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNIKISQAEAVHPDELDEEFDTFPTSR  901

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               ++VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IFI  C V A +L+
Sbjct  902   SPELVRMRYDRLRSVAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLF  961

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             L P ++IA   GF+ +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  962   LTPFQVIAALAGFWVMRHPRFRRRLPSVPINFFRRLPARTDSML  1005


 Score =   112 bits (279),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQR +T     DLNP WNE   FN+S  S 
Sbjct  5    KLGVQVVGAHNLLPKDGKGSSSAFVELYFDGQRFRTTIKENDLNPVWNESFYFNISDASK  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L L+ Y   N+G T   +FLG+V L    FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYLTLEAYIYNNIGDTNSRSFLGKVCLTGNSFVPLSDSVVLHYPLEKRGIFSHVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/763 (49%), Positives = 523/763 (69%), Gaps = 41/763 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLV+KM YLFV++VKAR LP         P V+V +      +R   K    EW++ F
Sbjct  262   TYDLVQKMQYLFVRVVKARDLPHMDVTGSLDPYVEVRIGNYKGTTRHFEKKQNPEWNEVF  321

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF ++  + SS+L++ V D           D+   +F+G + FD+ E+P R PPDSPLAP
Sbjct  322   AFAKEN-EQSSVLDVVVKD----------KDLLKDDFVGLVRFDLHEVPTRVPPDSPLAP  370

Query  1250  QWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQS  1399
             +WYRL  + G   KG+LMLA W GTQADE+FPDAW +D  G            RSKVY S
Sbjct  371   EWYRLANKDGKKEKGELMLAVWYGTQADEAFPDAWHSDAIGPDDGSSVAYGHIRSKVYHS  430

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +VIEAQD+  L+  S+      K Q+G Q+ KTKP  S   +P WNEDL+FV
Sbjct  431   PRLWYVRVNVIEAQDL-VLSDKSRFPDAYAKVQIGNQILKTKPVQSRVMNPMWNEDLMFV  489

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +   LG  +IPL++IE+R DDR++  RW+  E       
Sbjct  490   AAEPFDDH-LIISIEDRVGPSKDETLGKVAIPLNTIEKRADDRKIRDRWYNLEKHMSDAM  548

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                 + ++K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+ 
Sbjct  549   EGEQRKKDKDKFFSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKSNIGVLELGILN  608

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
              + L PMKT  GKG++D Y VAKYG KWVRTRTI+++  P++NEQYTW V+DP+TV+T+G
Sbjct  609   AEGLHPMKTRDGKGTSDTYCVAKYGHKWVRTRTINNSQSPKYNEQYTWEVFDPATVLTVG  668

Query  2090  VFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             VFD+ ++ +P  S KD+++GKVRIRISTL TG+VY + + L++L P+G+KKMGE+ LA+R
Sbjct  669   VFDNSQIGNPNGSGKDMKIGKVRIRISTLETGRVYTHNYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F   T  ++ +  YS+P+LP MH++RPL  VQQ+ LR  AV ++   LSR+EPPLR+EVV
Sbjct  729   F-SCTSLVNMMFKYSRPLLPKMHYVRPLTVVQQDMLRYQAVNIVAARLSRAEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM DADSH +SMR+ +AN+FR+++V + +  + KW  +   W+NP  T LVH L V+LV
Sbjct  788   EYMSDADSHLWSMRRSKANFFRLMSVFSGLFAIGKWFGEVCMWKNPITTALVHVLFVMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNWRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTSRG  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT ++I  C V A +LY+
Sbjct  907   SDIVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++ +  G Y +RHP FR +MPS  +NFFRRLP+  D ML
Sbjct  967   TPFQVLVLLGGVYLMRHPRFRGKMPSAPVNFFRRLPARTDSML  1009


 Score =   110 bits (274),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG GASS +V + F  QR +T T  RDLNP WNE   FN+S  ++
Sbjct  4    KLGVEVVAAHDLMPKDGQGASSAFVELHFDHQRFRTTTKERDLNPVWNETFYFNISDPNN  63

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            I    LE  +YH    G      FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  64   IPNLTLEAFIYHH---GKANSKAFLGKVVLTGTSFVPYSDAVVLHYPLEKRGIFSRVKGE  120

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  121  LGLKVFVTD  129



>ref|XP_008806876.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008806877.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=1002

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/761 (50%), Positives = 528/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++VKAR LP         P V+V V     I++   K    EW++ 
Sbjct  258   STYDLVEQMQYLFVRVVKARDLPAMDVTGSLDPYVEVRVGNYRGITKHFEKKQNPEWNEV  317

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    SSILE+ V D           D+   +F+G I FD++++P R PPDSPLA
Sbjct  318   FAFSRDR-MQSSILEVVVKD----------KDLVKDDFVGFIRFDLNDVPTRVPPDSPLA  366

Query  1247  PQWYRLEGGGAHKGDL--MLATWVGTQADESFPDAWKTDTAG-------NPTSRSKVYQS  1399
             P+WYRLE     K     MLA W+GTQADE+FPDAW +D A        N   RSKVY +
Sbjct  367   PEWYRLEDKKGDKKKGELMLAVWIGTQADEAFPDAWHSDAAAPVDASVVNSHIRSKVYHA  426

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+  ++IEAQDI  +   ++     +KAQ+G Q+ +T+ A + T +P WNE+L+FV
Sbjct  427   PRLWYVYVNIIEAQDII-IADKTRYPDVFVKAQIGNQLSRTRIAQARTFNPLWNEELMFV  485

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  V+G   IPL SIE+R DDR +  RWF+ E       
Sbjct  486   AAEPFEDH-LILSVEDRVGPNKDEVIGRVVIPLGSIEKRADDRMIYGRWFSLEKPVAVDV  544

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTARQLWKP +G +ELGI+  + 
Sbjct  545   DQIKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTARQLWKPSIGLLELGILNAEG  603

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  GKG++D Y VAKYG KWVR+RTI ++L P++NEQYTW V+DP+TV+T+GVFD
Sbjct  604   LHPMKTRDGKGTSDTYCVAKYGQKWVRSRTIINSLSPKYNEQYTWEVFDPATVLTVGVFD  663

Query  2099  SWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             + ++ +  P  ++D ++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+ LA+RF 
Sbjct  664   NCQLGEKGPNGNRDAKIGKVRIRLSTLETGRVYTHSYPLLVLHPSGVKKMGELHLAIRF-  722

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              ST  ++ +++YS+P+LP MH+IRPL   Q + LR  AV+++   LSR EPPLR+EVV Y
Sbjct  723   SSTSLINMMYIYSRPLLPKMHYIRPLTVRQLDMLRHQAVQMVAARLSRMEPPLRKEVVEY  782

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR+++V++ +    KW  +  AW+NP  T+LVH L ++LV F
Sbjct  783   MSDVDSHLWSMRRSKANFFRLMSVVSGLFAAGKWFGNVCAWKNPITTVLVHILFLILVCF  842

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE++  DELDEEFD  P +R  D
Sbjct  843   PELILPTIFLYMFLIGLWNYRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRGAD  901

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT IF+  C V A +LY+ P
Sbjct  902   LVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLVAALVLYVTP  961

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A   GFY +RHP FR RMPS  +NFFRRLP+  D ML
Sbjct  962   FQVLAALAGFYIMRHPRFRHRMPSAPVNFFRRLPARTDSML  1002


 Score =   101 bits (251),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G++SP V + F GQ+ +T    +DLNP WNE   FN+S  + 
Sbjct  5    KLGVEVLSAHDLMPKDGQGSASPSVELHFDGQKFRTTIKEKDLNPVWNERFYFNISDPAS  64

Query  332  IFGDMLELDVYHDKNVGPTTRN-NFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    LE  VY   N+   T + +FLG+V++  T FV   +  +++YPL+++ + S ++G
Sbjct  65   LPDLALEAFVY---NINKATHSRSFLGKVRIAGTSFVPFSDAVVMHYPLDKRGIFSRVKG  121

Query  509  DIGLKIYFVD  538
            +IGLK++  +
Sbjct  122  EIGLKVFLTN  131



>ref|XP_010228332.1| PREDICTED: uncharacterized protein LOC100828926 [Brachypodium 
distachyon]
Length=1054

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/788 (52%), Positives = 532/788 (68%), Gaps = 55/788 (7%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAGRPvvkvvvsgsh--visRPARKTLLFEWDQT  1066
             +E S  DLV+KM YLFV++V+AR LP    P V+V V+G      +R AR+   FEWDQT
Sbjct  275   VEPSKHDLVDKMPYLFVRVVRARGLPAGAHPHVRVAVAGGGRHASTREARRGAFFEWDQT  334

Query  1067  FAFGRDAPDSSS--ILEISVWDPLSSKSLDPTSDVA---GHNFLGGICFDVSEIPLRDPP  1231
             FAF RD  DS +   +E+SVWD      L P +DV+     +FLGG+CFD +++  RDPP
Sbjct  335   FAFARDPADSQTGPTMEVSVWD------LPPDADVSVADDRSFLGGLCFDTADVHARDPP  388

Query  1232  DSPLAPQWYRLEGG--GAHKGDLMLATWVGTQADESFPDAWKTDT------------AGN  1369
             D PLA QWYRLEGG       DLM+ATW GTQADE+F DAWK D+            + +
Sbjct  389   DGPLATQWYRLEGGRRNERAADLMVATWAGTQADEAFADAWKADSPPAHASSSTATASSS  448

Query  1370  PTSRSKVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSAT--  1543
              +S +KVY SPKLW LR +VIEAQD   L A   ++   ++  LGFQ  KT+  ++ T  
Sbjct  449   ASSSAKVYVSPKLWLLRLTVIEAQDT--LMAARADAGIAVRGTLGFQSLKTRTTAAVTRN  506

Query  1544  GSPSWNEDLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISR  1723
             G PSWNEDL+FVAAEPFT+       +E    K+   +G AS+ L SIERRVDDR+V S+
Sbjct  507   GGPSWNEDLLFVAAEPFTDGDCFEISLEVRHGKDAFTVGSASVSLGSIERRVDDRKVASK  566

Query  1724  WFTFEDQNEEK-------------RVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQ  1864
             W      +E                V+ GR+H+R+C DGGYHV +E  +  SD+RP+ARQ
Sbjct  567   WLDLLPSDEAAATRKANGKFRMPAHVHGGRLHVRVCLDGGYHVADEPPYASSDFRPSARQ  626

Query  1865  LWKPPVGTVELGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQ  2044
             LW+ PVG VELG++GCK LLPM+   GKG TDAYAVAKYG KW RTRTISD+  P WNEQ
Sbjct  627   LWRQPVGLVELGVVGCKGLLPMRAADGKGCTDAYAVAKYGPKWARTRTISDSFDPAWNEQ  686

Query  2045  YTWRVYDPSTVVTIGVFDSWEVIDPEN-----SKDVRMGKVRIRISTLATGKVYRNTFSL  2209
             YTW VYDP TV+T+GVFD       ++     +    MGKVRIR+STL  G+VYR ++ L
Sbjct  687   YTWPVYDPCTVLTVGVFDDPPPPPSDDADAAVTPSRPMGKVRIRLSTLENGRVYRGSYPL  746

Query  2210  ILLSPAGLKKMGEIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAV  2389
             +++ P G K+MG++ELAVRF  S   LD LH Y QP LP M+++RP+ A  +E LR AA 
Sbjct  747   LMMLPTGAKRMGDVELAVRFATSGTFLDTLHGYLQPSLPPMNNLRPIPAAHREPLRLAAA  806

Query  2390  KLLTTHLSRSEPPLRREVVAYMLDADSHSFS-----MRKVRANWFRiinviaavidvvKW  2554
             ++   HL+R+EPPLRREV  +MLDA   S S     MRK+RANW R  + +  V  V +W
Sbjct  807   RITAGHLARAEPPLRREVATWMLDAGPGSGSSSSFSMRKLRANWNRAASALTWVSGVARW  866

Query  2555  ADDTRAWRNPTATILVHALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTK  2734
             A++TR WR+P AT + HA+LVLL W PDL+IPT A +V  +GAW YR R R    H   +
Sbjct  867   AEETRTWRSPAATGMAHAVLVLLAWHPDLVIPTLALHVAAVGAWRYRRRPRAPAPHPCVR  926

Query  2735  ISLAES-IDRDELDEEFDAVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQAL  2911
              S+AE+  +R+ELDEEFD VP  RP + VRARYD+ R++GAR+Q ++GD+ATQ ERVQAL
Sbjct  927   ASMAEAPAEREELDEEFDPVPSARPPETVRARYDRARVVGARLQAMVGDVATQAERVQAL  986

Query  2912  VTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRL  3091
             V+WRDPRATG+F+ALC  +A +LY+VP K++ +  GFYYLRHP+FRDR P+PA+NFFRRL
Sbjct  987   VSWRDPRATGMFVALCVALAMVLYVVPLKVVVVVAGFYYLRHPMFRDRTPAPAVNFFRRL  1046

Query  3092  PSLADRML  3115
             PS+A+R++
Sbjct  1047  PSMAERII  1054


 Score =   168 bits (425),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  140  GTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLS  319
            GT RKL+VEV+EAR+L PKDG G SSPY   DF GQR+KTRTV+RDLNP WNE LEF   
Sbjct  5    GTVRKLVVEVVEARDLQPKDGFGTSSPYARADFDGQRRKTRTVVRDLNPVWNEPLEFTFP  64

Query  320  KHSDIF------GDMLELDVYHDKNVGPTTRNNFLGRVKLNATQ-FVKKGEEALIYYPLE  478
                        G+ LE+ V HD  VGP+ R+ FLGRV+L+A + FV+KGEEALIY+PLE
Sbjct  65   GPGTGVLDPVGGGEPLEVSVLHDLRVGPSRRSTFLGRVRLDARRFFVRKGEEALIYFPLE  124

Query  479  RKNLLSWIQGDIGLKIYFVD  538
            +K+   W++G+IGLK+Y+VD
Sbjct  125  KKSFFGWVRGEIGLKVYYVD  144



>emb|CAB39932.1| putative phosphoribosylanthranilate transferase [Arabidopsis 
thaliana]
 emb|CAB78204.1| putative phosphoribosylanthranilate transferase [Arabidopsis 
thaliana]
Length=857

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/759 (48%), Positives = 521/759 (69%), Gaps = 37/759 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP      +  P V+V V     I+R   K    EW+Q 
Sbjct  115   STYDLVERMYFLYVRVVKARELPIMDITGSVDPFVEVRVGNYKGITRHFEKRQHPEWNQV  174

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +S+LE+ V D           D+   +++G + FD++++PLR PPDSPLA
Sbjct  175   FAFAKERM-QASVLEVVVKD----------KDLLKDDYVGFVRFDINDVPLRVPPDSPLA  223

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             PQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  224   PQWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAAMPVDCSPAISAVLRSKVYH  283

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             +P+LWY+R +VIEAQD+   T  ++     +KAQLG QV KT+P  + T    WNED +F
Sbjct  284   APRLWYVRVNVIEAQDLIP-TDKTRFPDVYVKAQLGNQVMKTRPCQARTLGAVWNEDFLF  342

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----D  1741
             V AEPF +H L+  + + + P +  ++G   IPL+++E+R DD  + +RW+  E     D
Sbjct  343   VVAEPFEDH-LVLTVEDRVAPGKDEIVGRTYIPLNTVEKRADDHMIHARWYNLERPVIVD  401

Query  1742  QNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
              ++ KR  +  R+HLR+C +GGYHV++E+ H  SD RP+AR LW+ P+G +ELGI+    
Sbjct  402   VDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLRPSARPLWRQPIGVLELGILNAVG  461

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  G+G++D + V KYG KWVRTRT+ DNLCP++NEQYTW V+DP+TV+T+GVFD
Sbjct  462   LHPMKTREGRGTSDTFCVGKYGQKWVRTRTMVDNLCPKYNEQYTWEVFDPATVLTVGVFD  521

Query  2099  SWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             + ++ +  N +DV++GK+RIR+STL TG++Y +++ L++L P G+KKMGE+ +AVRF   
Sbjct  522   NGQLGEKGN-RDVKIGKIRIRLSTLETGRIYTHSYPLLVLHPTGVKKMGELHMAVRFT-C  579

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
                 + L+ YS+P+LP MH++RP   +QQ+ LR  AV ++   L R+EPPLR+E++ +M 
Sbjct  580   ISFANMLYQYSKPLLPKMHYVRPFSVMQQDMLRHQAVNIVAARLGRAEPPLRKEIIEFMS  639

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D DSH +SMRK +AN+FR++ V + VI V KW  D  +WRNP  T+LVH L ++LV  P+
Sbjct  640   DTDSHLWSMRKSKANFFRMMTVFSGVIAVGKWFSDICSWRNPITTVLVHVLFLMLVCLPE  699

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG WNYRFR R    H +TKIS AE++  DELDEEFD  P TR  DMV
Sbjct  700   LILPTMFLYMFLIGLWNYRFRPRYP-PHMNTKISQAEAVHPDELDEEFDTFPTTRNPDMV  758

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  R+QT++GDLATQGER QAL++WRDPRAT IF+ LCF+ A + ++ P +
Sbjct  759   RLRYDRLRSVAGRIQTVIGDLATQGERFQALLSWRDPRATAIFVILCFIAAIVFFITPIQ  818

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++    GF+ +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  819   IVVALAGFFTMRHPRFRHRLPSVPVNFFRRLPARTDSML  857



>emb|CDX86768.1| BnaA09g21580D [Brassica napus]
Length=1010

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/763 (49%), Positives = 525/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQ  1063
             RS++DLVE+M++L+V++VKAR LP      +  P V+V V     I+R   K    EW+Q
Sbjct  267   RSTYDLVERMYFLYVRVVKARELPIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQ  326

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              FAF ++    +S+LE+ V D           D+   +++G + FD+++IPLR PPDSPL
Sbjct  327   VFAFAKERM-QASVLEVVVKD----------KDLLKDDYVGFVRFDINDIPLRVPPDSPL  375

Query  1244  APQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVY  1393
             APQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY
Sbjct  376   APQWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAAMPVDCSPAISAVLRSKVY  435

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P+++  F    +KAQLG QV KT+P  + T    WNE
Sbjct  436   HAPRLWYVRVNVVEAQDL----VPTEKHRFPDVYVKAQLGNQVMKTRPCQARTLGAVWNE  491

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             D +FVAAEPF +H L+  + + + P +  +LG   IPL+++E+R DD  + SRW+  E  
Sbjct  492   DFLFVAAEPFEDH-LVLTVEDRVAPGKDEILGRTYIPLNTVEKRADDHMIHSRWYNLERP  550

Query  1739  ---DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                D ++ KR  +  R+HLR+C +GGYHV++E+ H  SD RP+AR LW+ P+G +ELGI+
Sbjct  551   VIVDVDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLRPSARPLWRQPIGVLELGIL  610

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D + VAKYG KWVRTRT+ DNLCP++NEQYTW V+DP+TV+T+
Sbjct  611   NAVGLHPMKTREGRGTSDTFCVAKYGQKWVRTRTMVDNLCPKYNEQYTWEVFDPATVLTV  670

Query  2087  GVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             GVFD+ ++ +  N +DV++GK+RIR+STL TG++Y +++ L++L P G+KKMGE+ +AVR
Sbjct  671   GVFDNGQLSEKGN-RDVKIGKIRIRLSTLETGRIYTHSYPLLVLHPTGVKKMGELHMAVR  729

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F       + L+ YS+P+LP MH++RP   +QQ+ LR  AV ++   L R+EPPLR+E++
Sbjct  730   FT-CVSFANMLYQYSKPLLPKMHYVRPFSVMQQDMLRHQAVNIVAARLGRAEPPLRKEII  788

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              +M D DSH +SMRK +AN+FR++ V + VI V KW  D  +WRNP  T+LVH L ++LV
Sbjct  789   EFMSDTDSHLWSMRKSKANFFRMMTVFSGVIAVGKWFSDICSWRNPITTVLVHVLFLMLV  848

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
               P+LI+PT   Y+F+IG WNYRFR R    H +TKIS AE++  DELDEEFD  P TR 
Sbjct  849   CLPELILPTMFLYMFLIGLWNYRFRPRYP-PHMNTKISQAEAVHADELDEEFDTFPTTRN  907

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER QAL++WRDPRAT I++  CF+ A + ++
Sbjct  908   PDLVRLRYDRLRSVAGRIQTVIGDLATQGERFQALLSWRDPRATAIYVIFCFLAAMVFFI  967

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  968   TPIQIVVALAGFYMMRHPRFRHRLPSVPVNFFRRLPARTDSML  1010


 Score =   105 bits (261),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M +  KL V+VI A NL PKDG G ++ +V + F GQ+ +T    RDLNP WNE   FN+
Sbjct  2    MMSNLKLGVDVIGAHNLFPKDGQGTANAFVELYFDGQKHRTTIKDRDLNPVWNESFFFNI  61

Query  317  SKHSDIFGDMLELDVY-HDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
            S  S +    LE   Y H++   PT   +FLG+V L  T FV   +  ++++P+E++ + 
Sbjct  62   SDPSRLHYLTLEAQAYSHNR---PTNGRSFLGKVSLPGTSFVPHSDAVVLHFPMEKRGIF  118

Query  494  SWIQGDIGLKIYFVD  538
            S ++G++GLK+Y  D
Sbjct  119  SRVRGELGLKVYITD  133



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/761 (49%), Positives = 524/761 (69%), Gaps = 41/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP---TAGR--PvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP    AG   P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVAGSCDPYVEVRLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+++ D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVNIKD----------KDFVKDDFIGRVVFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE       KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  139   PQWYRLEDRKNEKAKGELMLAVWMGTQADEAFPEAWHSDAAAVSGADGLSNIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +S F    +KA LG Q  +T+ + + + +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDL----QPSDKSRFPEVYVKAILGNQALRTRVSMNKSINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG   +PL  ++RR+D + V +RW+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKDEVLGRCGVPLQYVDRRLDHKPVNTRWYNLEKHVMV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   ++H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELG++  +
Sbjct  314   EGEKKKEVKFASKIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGVLNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+ +TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TVVTIGVF
Sbjct  374   GLSPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDSFSPKWNEQYTWEVFDPCTVVTIGVF  433

Query  2096  DSWEVIDPE-NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             D+      + N +D R+GKVRIR+STL T +VY +++ L++L P+G+KKMGEI LAVRF 
Sbjct  434   DNCHTQGGDKNGRDARIGKVRIRLSTLETDRVYTHSYPLLVLHPSGVKKMGEIHLAVRFT  493

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
              S+  ++ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  L+R+EPPLR+EVV +
Sbjct  494   CSS-LVNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSLRLTRAEPPLRKEVVEF  552

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             MLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++LV +
Sbjct  553   MLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWKNPITTVLIHILFLILVMY  612

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG W YR+R R    H DT++S A++   DELDEEFD  P +RP D
Sbjct  613   PELILPTVFLYLFLIGVWYYRWRPRHP-PHMDTRLSCADNAHPDELDEEFDTFPTSRPAD  671

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+ P
Sbjct  672   IVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTP  731

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   FQVVALLTGFYVLRHPRFRYKLPSVPLNFFRRLPARTDCML  772



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/763 (50%), Positives = 517/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSLDPYVEVRLGNYRGTTRHFEKKSNPEWSQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVNVKD----------KDFIKDDFVGRVMFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGN------PTSRSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP++W +D+A         T RSKVY SP
Sbjct  139   PQWYRLEDRHGNKVKGELMLAVWMGTQADEAFPESWHSDSAAVTGADALATIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P   S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLI----PGDRSRFPEVYVKAILGNQALRTRVSMSKTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P    VLG  +IPL  IERR+D R V S+W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRIAPNNDVVLGRCAIPLQYIERRLDHRPVTSKWYNLEKHIII  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+RL  +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+   
Sbjct  314   EGEKKKEIKFASRIHMRLYLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAH  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              + PMKT  G+ +TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GISPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   + S   KD R+GKVR+R+STL TG+VY +++ L++L P G+KKMGEI LAVR
Sbjct  434   DNCHLQVGDKSGGAKDSRIGKVRVRLSTLETGRVYTHSYPLLVLHPTGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHMYSQPLLPKMHYIYPLTVSQLDNLRHQATQIVSLRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN FRI+ V+  +I + KW D    W+NP  T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRRSKANVFRIMGVLGGLIAIGKWFDQICNWKNPITTVLIHILFLILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S A++   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSCADNAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A  LY+
Sbjct  672   PDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIALYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  +NFFRRLP+  D ML
Sbjct  732   TPFQVVALVNGFYVLRHPRFRHKLPSTPVNFFRRLPARTDCML  774



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/763 (50%), Positives = 521/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSLDPYVEVRLGNYRGTTRHFEKKSNPEWSQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVTVKD----------KDLVKDDFVGRVMFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLE--GGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP++W +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRNGNKVKGELMLAVWMGTQADEAFPESWHSDAATVSGADALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P   S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLI----PGDRSRFPEVYVKAILGNQALRTRVSMSKTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  I+RR+D R + S+W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYIDRRLDHRPINSKWYNLEKHIIV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+RL  +GGYHV++E+ H  SD RPTA+QLWK  +G +ELG++  +
Sbjct  314   EGEKKKEIKFASRLHMRLYLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGVLNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+ +TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLSPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   + S   +D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  434   DNCHLHGGDKSGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  L+R+EPPLR+E+V
Sbjct  494   FTCSS-LMNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLNRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMRK +AN+FRI+ V+  +I + KW D    W+NP  T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRKSKANFFRIMGVLGGLIAIGKWFDQICNWKNPITTVLIHILFLILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R+   H DT++S A++   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRNP-PHMDTRLSCADNAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   PDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLTGFYVLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/759 (49%), Positives = 517/759 (68%), Gaps = 36/759 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPGKDMTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S LE +V D           D    + +G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDR-IQASFLEATVKD----------KDFVKDDLIGRVVFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKVKGELMLAVWFGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA +G Q  +T+ + S T +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDLIP-TDKQRYPEVYVKAIVGNQALRTRVSQSRTINPMWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQN  1747
             AEPF E  L+  + + + P +   LG  +IPL  ++RR D + V SRW+  E     D  
Sbjct  258   AEPFEEP-LILSVEDRVAPNKDEALGRCAIPLQYLDRRFDHKPVNSRWYNLEKHIMVDGE  316

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
             +++  +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+    L+P
Sbjct  317   KKETKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPNIGVLELGILNATGLMP  376

Query  1928  MKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             MKT  G+G+TDAY VAKYG KW+RTRTI D+  PRWNEQYTW V+DP TVVT+GVFD+  
Sbjct  377   MKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFTPRWNEQYTWEVFDPCTVVTVGVFDNCH  436

Query  2108  VIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             +   E    +KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF  S
Sbjct  437   LHGGEKIGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFTCS  496

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +  L+ +++YSQP+LP MH+I PL   Q ++LR  A ++++  L+R+EPPLR+EVV YML
Sbjct  497   S-LLNMMYMYSQPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLTRAEPPLRKEVVEYML  555

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D  SH +SMR+ +AN+FRI+ V++ +I V KW +    W+NP  T+L+H L ++LV +P+
Sbjct  556   DVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFEQICNWKNPITTVLIHLLFIILVLYPE  615

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP+D+V
Sbjct  616   LILPTIFLYLFLIGIWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIV  674

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A ILY+ P +
Sbjct  675   RMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQ  734

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   VVALCIGIYALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/762 (50%), Positives = 519/762 (68%), Gaps = 42/762 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP----TAG-RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP    T G  P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMQYLYVRVVKAKELPGKDVTGGCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S LE+ V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  91    FAFSKDRV-QASFLEVVVKD----------KDFVKDDFMGRVVFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRL+   + K  G+LMLA W GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  140   PQWYRLDDRKSDKVKGELMLAVWFGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +K  LG Q  +T+ + S T +P WNEDL+
Sbjct  200   KLWYLRVNVIEAQDLI----PSDKGRYPEAYVKVILGTQALRTRISQSRTINPMWNEDLM  255

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  ++RR D + V SRW+  E     
Sbjct  256   FVAAEPFEEP-LILSVDDRVAPNKDEVLGKCAIPLQYVDRRFDHKPVNSRWYNLEKHVMV  314

Query  1742  QNEEKRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             + E+K + +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+    
Sbjct  315   EGEKKEIKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELGILNATG  374

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L+PMK   G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+D  TV+TIGVFD
Sbjct  375   LMPMKNKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPRWNEQYTWEVFDTCTVITIGVFD  434

Query  2099  SWEVIDPE---NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             +  +  P+    +KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF
Sbjct  435   NCHLHGPDKGGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRF  494

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
               S+  ++ +H+YS P+LP MH+I PL   Q ++LR  A ++++  L R+EPPLR+EVV 
Sbjct  495   TCSS-LINMMHMYSHPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLHRAEPPLRKEVVE  553

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             YMLD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++LV 
Sbjct  554   YMLDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWKNPITTVLIHILFIILVL  613

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
             +P+LI+PT   Y+F+IG W YR+R R    + DT++S A+S   DELDEEFD  P +RP+
Sbjct  614   YPELILPTIFLYLFLIGVWYYRWRPRHP-PYMDTRLSHADSAHPDELDEEFDTFPTSRPS  672

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             D+VR RYD+LR +  R+QT++GDLATQGER Q+L++WRDPRAT +F+  C V A +LY+ 
Sbjct  673   DIVRMRYDRLRSIAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVIFCLVAAIVLYVT  732

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  733   PFQVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/766 (50%), Positives = 525/766 (69%), Gaps = 47/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP+     +  P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPSKDVTGSCDPYVEVKLGNYKGTTRHFEKKTNPEWSQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V             DV   +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDR-IQASVLEVTV----------KDKDVVKDDFIGRVWFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  F    +KA LG Q  +T+ + S + +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDL----QPSDKGRFPEVYVKAILGIQTLRTRISQSRSINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P ++ +LG   IPL  ++RR+D + V +RWF  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKEELLGKCVIPLQIMDRRLDHKPVNTRWFNIEKHVVI  313

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                D+ +E + +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+ 
Sbjct  314   MEGDKKKEIK-FASRIHMRVCLEGGYHVLDESTHHSSDLRPTAKQLWKSSIGVLEVGILS  372

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
              + L+PMKT  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIG
Sbjct  373   AQGLMPMKTSNGRGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIG  432

Query  2090  VFDSWEVI----DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             VFD+  +      P   KD ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI+L
Sbjct  433   VFDNCHLHGGGDKPGGQKDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIQL  492

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             AVRF  S+  L+ +H+YS P+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+
Sbjct  493   AVRFTCSS-LLNMMHMYSNPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRK  551

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YMLD  SH +SMR+ +AN+FRI+ V++ ++ V KW D    W+NP  TIL+H L V
Sbjct  552   EVVEYMLDVGSHMWSMRRSKANFFRIMGVLSGIVAVGKWFDQICHWKNPITTILIHILFV  611

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P 
Sbjct  612   ILVMYPELILPTIFLYLFLIGIWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPT  670

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             TRP+D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +
Sbjct  671   TRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIV  730

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  731   LYVTPFQVVALLTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  776



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/759 (49%), Positives = 518/759 (68%), Gaps = 36/759 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPGKDMTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S LE +V D           D    + +G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDR-IQASFLEATVKD----------KDFVKDDLIGRVVFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKVKGELMLAVWFGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA +G Q  +T+ + S T +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDLIP-TDKQRYPEVYVKAIVGNQALRTRVSQSRTINPMWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQN  1747
             AEPF E  L+  + + + P +  VLG  +IPL  ++RR D + V SRW+  E     D  
Sbjct  258   AEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYLDRRFDHKPVNSRWYNLEKHIMVDGE  316

Query  1748  EEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLP  1927
             +++  +  R+H+R+C +GGYHV++E+ H  SD RPTA+QLWKP +G +ELGI+    L+P
Sbjct  317   KKETKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKPNIGVLELGILNATGLMP  376

Query  1928  MKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWE  2107
             MKT  G+G+TDAY VAKYG KW+RTRTI D+  PRWNEQYTW V+DP TVVT+GVFD+  
Sbjct  377   MKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFTPRWNEQYTWEVFDPCTVVTVGVFDNCH  436

Query  2108  VIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRS  2278
             +   E    +KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF  S
Sbjct  437   LHGGEKIGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFTCS  496

Query  2279  TPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYML  2458
             +  L+ +++YSQP+LP MH+I PL   Q ++LR  A ++++  L+++EPPLR+EVV YML
Sbjct  497   S-LLNMMYMYSQPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLTQAEPPLRKEVVEYML  555

Query  2459  DADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPD  2638
             D  SH +SMR+ +AN+FRI+ V++ +I V KW +    W+NP  T+L+H L ++LV +P+
Sbjct  556   DVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFEQICNWKNPITTVLIHLLFIILVLYPE  615

Query  2639  LIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMV  2818
             LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP+D+V
Sbjct  616   LILPTIFLYLFLIGIWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIV  674

Query  2819  RARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSK  2998
             R RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A ILY+ P +
Sbjct  675   RMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQ  734

Query  2999  MIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   VVALCIGIYALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_010529567.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Tarenaya hassleriana]
Length=1008

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/762 (49%), Positives = 527/762 (69%), Gaps = 43/762 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M++L+V++VKA  LP         P V+V V     I+R   K    EW+Q 
Sbjct  266   TTYDLVERMYFLYVRVVKAHELPIMDITGSIDPFVEVRVGNYRGITRHFEKRQNPEWNQV  325

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +SILE+ V D           D+   +++G + FD+++IPLR PPDSPLA
Sbjct  326   FAFAKERM-QASILEVVVKD----------KDLVKDDYVGFVRFDINDIPLRVPPDSPLA  374

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             PQWYRL+   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  375   PQWYRLDDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAAMPVDCTPAISAVLRSKVYH  434

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     P++++ F    +KAQ+G QV KT+   + T S  WNED
Sbjct  435   APRLWYVRVNVVEAQDL----VPTEKTRFPDVYVKAQIGNQVMKTRTCQARTLSALWNED  490

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  +LG + IPL+++E+R DDR + SRW+  E   
Sbjct  491   LLFVAAEPFEDH-LVLTVEDRVAPGKDEILGRSIIPLTTVEKRADDRMIHSRWYNLEKPV  549

Query  1739  --DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
               D ++ KR  +  R+HLR+C +GGYHV++E+ H  SD RP+AR LW+ P+G +ELGI+ 
Sbjct  550   VVDVDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLRPSARPLWRQPIGILELGILN  609

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
                L PMKT  G+G++D + VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+G
Sbjct  610   AVGLHPMKTREGRGTSDTFCVAKYGQKWVRTRTMVDNLSPKYNEQYTWEVFDPATVLTLG  669

Query  2090  VFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             VFD+ ++ +  N +DV++GK+RIR+STL TG++Y +++ L++L PAG+KKMGE+ LAVRF
Sbjct  670   VFDNGQLGEKGN-RDVKIGKIRIRLSTLETGRIYTHSYPLLVLHPAGVKKMGELHLAVRF  728

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
                    + L+ YS+P+LP MH+IRP   +QQ+ LR  AV ++   L R+EPPLR+EV+ 
Sbjct  729   T-CVSFANMLYEYSKPLLPKMHYIRPFSVMQQDMLRHQAVHIVAARLGRAEPPLRKEVIE  787

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             +M D DSH +SMRK +AN+FR++ V +  + V KW  D  +WRNP  T+LVH L ++LV 
Sbjct  788   FMSDTDSHLWSMRKSKANFFRLMTVFSGFLAVGKWFSDICSWRNPITTVLVHVLFLMLVC  847

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
              P+LI+PT   Y+F+IG WNYRFR R    H +TKIS AE+++ DELDEEFD  P TR  
Sbjct  848   LPELILPTMFLYMFLIGLWNYRFRPRYP-PHMNTKISQAEAVNPDELDEEFDTFPTTRSP  906

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             DMVR RYD+LR +  R+QT++GDLATQGER+QAL++WRDPRAT IF+  CFV A + ++ 
Sbjct  907   DMVRMRYDRLRSVAGRIQTVIGDLATQGERIQALLSWRDPRATAIFVIFCFVSAIVFFVT  966

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++    GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  967   PFQVVVALVGFYVMRHPRFRHRLPSVPVNFFRRLPARTDSML  1008


 Score =   106 bits (265),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M +  KL V+VI A NLLPKDG G+SS +V + F GQ+ +T    +DLNP WNE   FN+
Sbjct  2    MMSNLKLGVDVIGAHNLLPKDGLGSSSAFVELFFDGQKFRTTIKEKDLNPVWNESFFFNI  61

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            S  S +    LE  VY   ++  T   +FLG+V L+ T FV   +  +++YPLE++ + S
Sbjct  62   SDPSRLHYLTLEAYVY--SHIRSTNGRSFLGKVSLSGTSFVPHSDAVVLHYPLEKRGIFS  119

Query  497  WIQGDIGLKIYFVD  538
             ++G++G+K+Y  D
Sbjct  120  RVKGELGMKVYVSD  133



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/764 (50%), Positives = 523/764 (68%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYTEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +SILE++V             DV   +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDR-IQASILEVTV----------KDKDVVKDDFIGRVLFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR ++IEAQD+     PS +  +    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNIIEAQDL----QPSDKGRYPEVFVKATLGNQTLRTRISQSRTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P ++  LG  +IPL  ++RR+D + V ++W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKEESLGKCAIPLQMVDRRLDQKPVNTKWYNIEKYIVI  313

Query  1742  -QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              + E+K+  K   ++H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  314   MEGEKKKEIKFSSKIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNA  373

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + L+PMKT  GKG+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  374   QGLMPMKTKDGKGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIGV  433

Query  2093  FDSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +     P  +KD ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAV
Sbjct  434   FDNCHLHGGDKPGGAKDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAV  493

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YS P+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+
Sbjct  494   RFTCSS-LLNMMHMYSLPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRKEI  552

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V+  +I V KW D    W+NP  T+L+H L ++L
Sbjct  553   VEYMLDVGSHMWSMRRSKANFFRIMGVLGGLIAVGKWFDQICNWKNPITTVLIHILFIIL  612

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P TR
Sbjct  613   VMYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTTR  671

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P+D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  672   PSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  731

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   VTPFQIVALFTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_010529565.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010529566.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Tarenaya hassleriana]
Length=1010

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/762 (49%), Positives = 527/762 (69%), Gaps = 43/762 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             +++DLVE+M++L+V++VKA  LP         P V+V V     I+R   K    EW+Q 
Sbjct  268   TTYDLVERMYFLYVRVVKAHELPIMDITGSIDPFVEVRVGNYRGITRHFEKRQNPEWNQV  327

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +SILE+ V D           D+   +++G + FD+++IPLR PPDSPLA
Sbjct  328   FAFAKERM-QASILEVVVKD----------KDLVKDDYVGFVRFDINDIPLRVPPDSPLA  376

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             PQWYRL+   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY 
Sbjct  377   PQWYRLDDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAAMPVDCTPAISAVLRSKVYH  436

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     P++++ F    +KAQ+G QV KT+   + T S  WNED
Sbjct  437   APRLWYVRVNVVEAQDL----VPTEKTRFPDVYVKAQIGNQVMKTRTCQARTLSALWNED  492

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  +LG + IPL+++E+R DDR + SRW+  E   
Sbjct  493   LLFVAAEPFEDH-LVLTVEDRVAPGKDEILGRSIIPLTTVEKRADDRMIHSRWYNLEKPV  551

Query  1739  --DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
               D ++ KR  +  R+HLR+C +GGYHV++E+ H  SD RP+AR LW+ P+G +ELGI+ 
Sbjct  552   VVDVDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLRPSARPLWRQPIGILELGILN  611

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
                L PMKT  G+G++D + VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+G
Sbjct  612   AVGLHPMKTREGRGTSDTFCVAKYGQKWVRTRTMVDNLSPKYNEQYTWEVFDPATVLTLG  671

Query  2090  VFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRF  2269
             VFD+ ++ +  N +DV++GK+RIR+STL TG++Y +++ L++L PAG+KKMGE+ LAVRF
Sbjct  672   VFDNGQLGEKGN-RDVKIGKIRIRLSTLETGRIYTHSYPLLVLHPAGVKKMGELHLAVRF  730

Query  2270  IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVA  2449
                    + L+ YS+P+LP MH+IRP   +QQ+ LR  AV ++   L R+EPPLR+EV+ 
Sbjct  731   T-CVSFANMLYEYSKPLLPKMHYIRPFSVMQQDMLRHQAVHIVAARLGRAEPPLRKEVIE  789

Query  2450  YMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVW  2629
             +M D DSH +SMRK +AN+FR++ V +  + V KW  D  +WRNP  T+LVH L ++LV 
Sbjct  790   FMSDTDSHLWSMRKSKANFFRLMTVFSGFLAVGKWFSDICSWRNPITTVLVHVLFLMLVC  849

Query  2630  FPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPN  2809
              P+LI+PT   Y+F+IG WNYRFR R    H +TKIS AE+++ DELDEEFD  P TR  
Sbjct  850   LPELILPTMFLYMFLIGLWNYRFRPRYP-PHMNTKISQAEAVNPDELDEEFDTFPTTRSP  908

Query  2810  DMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLV  2989
             DMVR RYD+LR +  R+QT++GDLATQGER+QAL++WRDPRAT IF+  CFV A + ++ 
Sbjct  909   DMVRMRYDRLRSVAGRIQTVIGDLATQGERIQALLSWRDPRATAIFVIFCFVSAIVFFVT  968

Query  2990  PSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             P +++    GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  969   PFQVVVALVGFYVMRHPRFRHRLPSVPVNFFRRLPARTDSML  1010


 Score =   106 bits (265),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M +  KL V+VI A NLLPKDG G+SS +V + F GQ+ +T    +DLNP WNE   FN+
Sbjct  2    MMSNLKLGVDVIGAHNLLPKDGLGSSSAFVELFFDGQKFRTTIKEKDLNPVWNESFFFNI  61

Query  317  SKHSDIFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLS  496
            S  S +    LE  VY   ++  T   +FLG+V L+ T FV   +  +++YPLE++ + S
Sbjct  62   SDPSRLHYLTLEAYVY--SHIRSTNGRSFLGKVSLSGTSFVPHSDAVVLHYPLEKRGIFS  119

Query  497  WIQGDIGLKIYFVD  538
             ++G++G+K+Y  D
Sbjct  120  RVKGELGMKVYVSD  133



>ref|XP_010943582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=806

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/765 (49%), Positives = 517/765 (68%), Gaps = 41/765 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S +DLVE+M+YL+V++VKAR LPT     +  P  +V +      ++   K    EW Q 
Sbjct  56    SPYDLVEQMYYLYVRVVKARDLPTNAITGSCDPYAEVKLGNYRGTTKHLEKRTNPEWHQV  115

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++   S++ LE+ V D            VA  +++G + FD++E+P R PPDSPLA
Sbjct  116   FAFSKERIQSTA-LEVFVRD---------REMVARDDYVGKVVFDLNEVPTRVPPDSPLA  165

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G G  +G++MLA W+GTQADE+FP+AW  D A     G   +RSKVY SP
Sbjct  166   PQWYRLEDRRGDGKVRGEIMLAVWMGTQADEAFPEAWHADAASVHGEGVFNTRSKVYVSP  225

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+    A  +     IKAQ+G QV KT+  S+ + SP WNEDLVFV 
Sbjct  226   KLWYLRVNVIEAQDV-QPNAKGRYPEVLIKAQVGNQVLKTRVCSTRSLSPMWNEDLVFVV  284

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--------  1738
             AEPF EH L+  + + + P +  VLG  ++PL+  E+R+D R V SRWF  E        
Sbjct  285   AEPFEEH-LVLTVEDRVQPTKDEVLGRIALPLTLFEKRLDHRPVHSRWFNLERFGFGVLE  343

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
              Q  ++  +  RVHLR+C +G YHV++E+    SD RPTARQLWK P+G +E+GI+  + 
Sbjct  344   GQQRKELRFSSRVHLRVCLEGAYHVMDESTMYISDTRPTARQLWKQPIGVLEVGILSAQG  403

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L+PMK   G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW VYDP TV+T+GVFD
Sbjct  404   LIPMKMKDGRGTTDAYCVAKYGQKWVRTRTIIDSFSPKWNEQYTWEVYDPCTVITLGVFD  463

Query  2099  SWEVIDPEN------SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             +  +   +       +KD+R+GKVRIR+STL   ++Y + + LI+L P+G+KKMGE++LA
Sbjct  464   NCHLGGNDKPAGGGPAKDLRIGKVRIRLSTLEMDRIYTHAYPLIVLQPSGVKKMGELQLA  523

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             VRF       + +++Y   +LP MH+I P    Q ++LR  A+ ++   L R+EPPLR+E
Sbjct  524   VRFT-CLSLANVIYLYGHTLLPKMHYIHPFTVKQVDNLRYQAMSIVAARLGRAEPPLRKE  582

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YMLD DSH +SMR+ +AN+FRI+++++  + + +W  +   W+NP  TILVH L ++
Sbjct  583   VVEYMLDVDSHMWSMRRSKANFFRIMSLLSGTVGICRWFHNVCHWKNPITTILVHVLFLI  642

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             L+ +P+LI+PT   Y+FMIG WNYRFR R    H DTK+S AE+I  DELDEEFD  P +
Sbjct  643   LLCYPELILPTMFLYMFMIGLWNYRFRPRHP-PHMDTKLSWAEAIHPDELDEEFDTFPTS  701

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             +P+D+VR RYD+LR +  R+QT++GD+ATQGER Q+L++WRDPRATG+F+  C V A +L
Sbjct  702   KPHDLVRMRYDRLRSVAGRIQTVVGDMATQGERFQSLLSWRDPRATGLFVMFCLVAAVVL  761

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P ++IA+  G Y LRHP FR ++PS + NFF+RLPS  D ML
Sbjct  762   YVTPFRVIALVAGLYTLRHPRFRSKLPSVSGNFFKRLPSRIDSML  806



>ref|XP_008356954.1| PREDICTED: uncharacterized protein LOC103420681 [Malus domestica]
Length=1009

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 519/763 (68%), Gaps = 41/763 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLVEKM YLFV++VKAR LP         P V+V V     I+R   K    EW+Q F
Sbjct  262   TYDLVEKMEYLFVRVVKARDLPHMDITGSLDPYVEVRVGNFKGITRHFEKRQNPEWNQVF  321

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF +D    SS+L++ V D           D+   +F+G + F++ E+P R PPDSPLAP
Sbjct  322   AFAKDN-QQSSVLDVVVKD----------KDLLKDDFVGFVRFEILEVPRRFPPDSPLAP  370

Query  1250  QWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQS  1399
             +WYRL  + G   KG+LMLA W+GTQADE+FP+AW +D  G            RSKVY S
Sbjct  371   EWYRLADKDGKKDKGELMLAVWIGTQADEAFPEAWHSDAIGPDDGSLVAYGHIRSKVYHS  430

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +VIEAQD+  L+  S+      K Q+G QV KTKP  S   +P WNEDL+FV
Sbjct  431   PRLWYVRVNVIEAQDL-VLSDRSRFPDAYAKVQIGNQVLKTKPVQSRAMNPMWNEDLMFV  489

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  +LG   IPL+++ERR DDR +  RWF  E       
Sbjct  490   AAEPFDDH-LIISVEDRVGPSKDEILGRVVIPLNAVERRADDRLIRGRWFNLEKHMSDAM  548

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                 + ++K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+ 
Sbjct  549   EGEQRKKDKDKFSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKSHIGMLELGILN  608

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
              + L PMKT  GKG +D Y VAKYG KWVRTRTI+++L P++NEQYTW VYDP+TV+T+G
Sbjct  609   AEGLHPMKTRDGKGVSDTYCVAKYGQKWVRTRTINNSLSPKYNEQYTWEVYDPATVLTVG  668

Query  2090  VFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             VFD+ ++ +   S +DV++GKVRIRISTL TG+VY + + L++L P+G+KKMGE+ LA+R
Sbjct  669   VFDNSQIGNTNGSGRDVKIGKVRIRISTLETGRVYTHNYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F   T  ++ +  YS+P+LP MH+ RPL   QQ+ LR  AV ++   LSR+EPPLR+EVV
Sbjct  729   F-SCTSFVNMMFKYSKPLLPKMHYARPLSVXQQDMLRHQAVNIVAARLSRAEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM DADSH +SMR+ +AN+FR++ V + +    KW  +   W+NP  T+LVH L ++LV
Sbjct  788   EYMSDADSHLWSMRRSKANFFRLMAVFSGLFAXAKWFGEVCKWKNPITTVLVHVLFMMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNWRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTSRG  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT ++I  C V A +LY+
Sbjct  907   SDIVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++ +  G Y +RHP FR +MPS  +NFFRRLP+  D ML
Sbjct  967   TPFQVLVLLGGIYLMRHPRFRGKMPSAPINFFRRLPARTDSML  1009


 Score =   108 bits (271),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG GA++ +V + F  QR +T    +DLNP WNE   FN+S   D
Sbjct  4    KLGVEVVAAHDLMPKDGQGAANAFVELHFDHQRFRTTIKEKDLNPVWNESFYFNISDPXD  63

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  +YH    G    N+FLG+V L  T FV   +  +++YPLE++ L S ++G+
Sbjct  64   LSNLSLEAYIYHH---GKGNSNSFLGKVCLTGTSFVPYSDAVVLHYPLEKRGLFSRVKGE  120

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  121  LGLKVFVTD  129



>ref|XP_008376022.1| PREDICTED: uncharacterized protein LOC103439257 [Malus domestica]
Length=1009

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 519/763 (68%), Gaps = 41/763 (5%)
 Frame = +2

Query  905   SFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQTF  1069
             ++DLVEKM YLFV++VKAR LP         P V+V V     I+R   K    EW+Q F
Sbjct  262   TYDLVEKMEYLFVRVVKARDLPHMDITGSLDPYVEVRVGNFKGITRHFEKRQNPEWNQVF  321

Query  1070  AFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAP  1249
             AF +D    SS+L++ V D           D+   +F+G + F++ E+P R PPDSPLAP
Sbjct  322   AFAKDN-QQSSVLDVVVKD----------KDLLKDDFVGFVRFEILEVPRRFPPDSPLAP  370

Query  1250  QWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQS  1399
             +WYRL  + G   KG+LMLA W+GTQADE+FP+AW +D  G            RSKVY S
Sbjct  371   EWYRLADKDGKKDKGELMLAVWIGTQADEAFPEAWHSDAIGPDDGSLVAYGHIRSKVYHS  430

Query  1400  PKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFV  1579
             P+LWY+R +VIEAQD+  L+  S+      K Q+G QV KTKP  S   +P WNEDL+FV
Sbjct  431   PRLWYVRVNVIEAQDL-VLSDRSRFPDAYAKVQIGNQVLKTKPVQSRAMNPMWNEDLMFV  489

Query  1580  AAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------  1738
             AAEPF +H L+  + + + P +  +LG   IPL+++ERR DDR +  RWF  E       
Sbjct  490   AAEPFDDH-LIISVEDRVGPSKDEILGRVVIPLNAVERRADDRLIRGRWFNLEKHMSDAM  548

Query  1739  ---DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIG  1909
                 + ++K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+ 
Sbjct  549   EGEQRKKDKDKFSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKSHIGMLELGILN  608

Query  1910  CKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIG  2089
              + L PMKT  GKG +D Y VAKYG KWVRTRTI+++L P++NEQYTW VYDP+TV+T+G
Sbjct  609   AEGLHPMKTRDGKGVSDTYCVAKYGQKWVRTRTINNSLSPKYNEQYTWEVYDPATVLTVG  668

Query  2090  VFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             VFD+ ++ +   S +DV++GKVRIRISTL TG+VY + + L++L P+G+KKMGE+ LA+R
Sbjct  669   VFDNSQIGNTNGSGRDVKIGKVRIRISTLETGRVYTHNYPLLVLHPSGVKKMGELHLAIR  728

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F   T  ++ +  YS+P+LP MH+ RPL   QQ+ LR  AV ++   LSR+EPPLR+EVV
Sbjct  729   F-SCTSFVNMMFKYSKPLLPKMHYARPLSVXQQDMLRHQAVNIVAARLSRAEPPLRKEVV  787

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM DADSH +SMR+ +AN+FR++ V + +    KW  +   W+NP  T+LVH L ++LV
Sbjct  788   EYMSDADSHLWSMRRSKANFFRLMAVFSGLFAXAKWFGEVCKWKNPITTVLVHVLFMMLV  847

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  P +R 
Sbjct  848   CFPELILPTVFLYMFLIGIWNWRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTSRG  906

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRAT ++I  C V A +LY+
Sbjct  907   SDIVRMRYDRLRSVAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYV  966

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++ +  G Y +RHP FR +MPS  +NFFRRLP+  D ML
Sbjct  967   TPFQVLVLLGGIYLMRHPRFRGKMPSXPINFFRRLPARTDSML  1009


 Score =   108 bits (271),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 80/129 (62%), Gaps = 3/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG GA++ +V + F  QR +T    +DLNP WNE   FN+S   D
Sbjct  4    KLGVEVVAAHDLMPKDGQGAANAFVELHFDHQRFRTTIKEKDLNPVWNESFYFNISDPXD  63

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  +YH    G    N+FLG+V L  T FV   +  +++YPLE++ L S ++G+
Sbjct  64   LSNLSLEAYIYHH---GKGNSNSFLGKVCLTGTSFVPYSDAVVLHYPLEKRGLFSRVKGE  120

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  121  LGLKVFVTD  129



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/763 (48%), Positives = 522/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+M YL+V++VKA+ LP+        P V+V +     +++   K    EW+Q 
Sbjct  33    CTYDLVEQMQYLYVRVVKAKDLPSKDVTGSLDPYVEVKLGNYKGLTKHFEKKSNPEWNQV  92

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           DV   +F+G + FD++EIP R PPDSPLA
Sbjct  93    FAFSKDRI-QASVLEVIVKD----------KDVISDDFVGRMWFDLNEIPKRVPPDSPLA  141

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPK  1405
             PQWYRLE   G   KG++MLA W+GTQADE+FPD+W +D A          RSKVY SPK
Sbjct  142   PQWYRLEDRKGEKVKGEIMLAVWMGTQADEAFPDSWHSDAAMVGSEAVSNIRSKVYLSPK  201

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     P  ++ F    +K  LG Q  +T+ + S T +P WNEDL+ 
Sbjct  202   LWYVRVNVIEAQDLI----PGDKTRFPEVYVKINLGNQFLRTRVSQSKTMNPMWNEDLML  257

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----Q  1744
             VAAEPF E  L+  + + L P +  VLG   IPL  ++RR+D + V +RWF  E     +
Sbjct  258   VAAEPFEEP-LILSVEDRLGPNKDEVLGRCVIPLQIVQRRLDHKPVNTRWFNLEKHVVVE  316

Query  1745  NEEKRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
              E+K + +  R+HLR+C DGG+HV++E+ H  SD RPTA+QLWKP +G +E+GII  + L
Sbjct  317   GEKKEIKFASRIHLRMCLDGGFHVLDESTHYSSDLRPTAKQLWKPNIGILEVGIISAQGL  376

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  G+G+TDAY VAKYG KW+RTRT+ D+  P+WNEQYTW V+DP TV+TIGVFD+
Sbjct  377   MPMKTRDGRGTTDAYCVAKYGQKWIRTRTLVDSFTPKWNEQYTWEVFDPCTVITIGVFDN  436

Query  2102  WEV-----IDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
               +          SKD R+GKVRIR+STL   +VY +++ L+ L  +G+KK GE++LAVR
Sbjct  437   GHIQGGGEKGGGGSKDSRIGKVRIRLSTLEADRVYTHSYPLLALHTSGVKKTGELQLAVR  496

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ L++YSQP+LP MH+I PL  +Q +SLR  A+++++  LSR+EPPL +EVV
Sbjct  497   FTNSS-FINMLYLYSQPLLPKMHYIHPLSVIQLDSLRHQAMQIVSMRLSRAEPPLSKEVV  555

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD DSH +SMR+ +AN+FRI+ V++ ++   +W D    W+NP  TIL+H L ++LV
Sbjct  556   EYMLDVDSHMWSMRRSKANFFRIMKVLSGLVAFGRWFDQICNWKNPITTILIHVLFIILV  615

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG WN+R+R R    H DT++S A++   DELDEEFD  P +R 
Sbjct  616   LYPELILPTIFLYLFLIGIWNFRWRPRHP-PHMDTRLSHADAAHPDELDEEFDTFPTSRS  674

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  RVQ+++GDL TQGER Q+L++WRDPRAT +F+  CFV A +LY+
Sbjct  675   SDIVRMRYDRLRSIAGRVQSVVGDLGTQGERFQSLLSWRDPRATTLFVTFCFVAAIVLYV  734

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++++  GF+ LRHP FR ++PS  LNFFRRLP+ +D ML
Sbjct  735   TPFQVVSLLIGFFMLRHPRFRHKLPSVPLNFFRRLPARSDSML  777



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/763 (50%), Positives = 522/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSLDPYVEVRLGNYRGTTRHFEKKSNPEWRQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVTVKD----------KDLVKDDFVGCVMFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE    +K  G+LMLA W+GTQADE+FP++W +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRNRNKVKGELMLAVWMGTQADEAFPESWHSDAATVSGADALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P   S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLI----PGDRSRFPEVYVKAILGNQALRTRVSMSKTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  I+RR+D R + S+W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYIDRRLDHRPINSKWYNLEKHIMV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+RL  +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  314   EGEKKKEIKFASRLHMRLYLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+ +TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLSPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   + S   +D R+GKVRIR+STL T +VY +++ L++L PAG+KKMGEI LAVR
Sbjct  434   DNCHLHGGDKSGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPAGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+E+V
Sbjct  494   FTCSS-LMNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+ V+  +I + +W D    W+NP  T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRRSKANFFRIMGVLGGLIAIGRWFDQICHWKNPITTVLIHILFLILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R+   H DT++S A++   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRNP-PHMDTRLSCADNAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   PDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLTGFYVLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>gb|KHG10339.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=1011

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/765 (49%), Positives = 529/765 (69%), Gaps = 46/765 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLP----TAG-RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+MH+L+V++VKAR LP    T G  P V+V V     I++   K    EW+Q 
Sbjct  266   STYDLVERMHFLYVRVVKARELPSVDVTGGIDPFVEVKVGNYKGITKHFEKKQNPEWNQV  325

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +SILE+ + D   S   D T        +G + FD++E+PLR PPDSPLA
Sbjct  326   FAFSRDRM-QASILEVVIKD--KSMVKDET--------VGIVRFDINEVPLRVPPDSPLA  374

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA----GNPTS----RSKVYQ  1396
             PQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A     +P +    RSKVY 
Sbjct  375   PQWYRLEDKKGDKVKGELMLAVWIGTQADEAFSDAWHSDAATPVDSSPATFAVLRSKVYH  434

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             SP+LWY+R +++EAQD+     P++++ F    +KAQ+G QV KTKP  + T +  WNED
Sbjct  435   SPRLWYVRVNIVEAQDL----VPTEKNRFPDVYVKAQIGHQVLKTKPCQARTLNAIWNED  490

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPL+S+++R DDR + SRWF  E   
Sbjct  491   LLFVAAEPFEDH-LVLSVEDRVAPGKDEIIGRVIIPLNSVDKRADDRIIHSRWFNLEKPV  549

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELGI+
Sbjct  550   AVDVDQLKKEK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGIL  608

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  609   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTV  668

Query  2087  GVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             GVFD+ ++ +     +KD+++GKVRIRISTL  G+VY +++ L++L P G+KKMGE+ LA
Sbjct  669   GVFDNSQLGEKGSNGNKDLKIGKVRIRISTLEAGRVYTHSYPLLVLHPTGVKKMGELHLA  728

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF      ++ L+ YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+E
Sbjct  729   IRFT-CISFVNMLYQYSRPLLPKMHYVRPFSVMQLDMLRHQAVNIVAARLGRAEPPLRKE  787

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             V+ YM D DSH +SMRK +AN+FR++ V + +  + KW  D   W+NP  T+LVH L ++
Sbjct  788   VIEYMSDVDSHLWSMRKSKANFFRLMTVFSGLFAIGKWFGDICMWKNPITTVLVHVLFLM  847

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             L   P+LI+PT   Y+F+IG WN+R+R R    H +TK+S AE++  DELDEEFD  P +
Sbjct  848   LACLPELILPTVFLYMFLIGVWNFRYRPRYP-PHMNTKVSQAEAVHPDELDEEFDTFPTS  906

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             +  ++VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRAT IFI  C + A +L
Sbjct  907   KSPELVRMRYDRLRSVAGRIQTVIGDIATQGERFQALLSWRDPRATAIFITFCLIAAIVL  966

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ++ P ++IA   GFY +RHP FR R+P+  +NFFRRLP+  D ML
Sbjct  967   FVTPFQVIAALAGFYAMRHPRFRYRLPAVPINFFRRLPARTDSML  1011


 Score =   110 bits (274),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQ+ +T    +DLNP WNE   FN+S  S 
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSSAFVELYFDGQKYRTTIKEKDLNPVWNESFYFNISDPSM  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+  N+  T    FLG+V L  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LHFHTLEAYVYN--NIRGTNTRAFLGKVCLTGTSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/760 (50%), Positives = 525/760 (69%), Gaps = 40/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+M YL+V++VKA+ LP      +  P V+V +      ++   K    EW+Q 
Sbjct  31    CTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGTTKHFEKKSNPEWNQC  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           DV   + +G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRI-QASVLEVLVKD----------KDVVLDDLIGRVMFDLNEVPKRIPPDSPLA  139

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G     G+LMLA W+GTQADE+FPDAW +D A     G    RSKVY SP
Sbjct  140   PQWYRLEDRKGDKVKTGELMLAVWMGTQADEAFPDAWHSDAATVSGEGVANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWY+R ++IEAQD+     PS +S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  200   KLWYVRVNIIEAQDLL----PSDKSRFPEVFVKAILGNQASRTRISQSKTINPMWNEDLM  255

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P +  VLG   IPL +++RR+D + V +RWF  E     
Sbjct  256   FVAAEPF-EEPLILTVEDRVAPNKDEVLGKCLIPLQAVQRRLDHKPVNTRWFNLEKHVIV  314

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             D  +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG++    
Sbjct  315   DGEKKETKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGILELGVLSAHG  374

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+T+GVFD
Sbjct  375   LTPMKTKDGRGTTDAYCVAKYGQKWVRTRTIVDSFGPRWNEQYTWEVFDPCTVITVGVFD  434

Query  2099  S-WEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             +          KD R+GKVRIR+STL T +VY +++ L++L P+G++KMGE++LAVRF  
Sbjct  435   NGHIHGQGGGGKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPSGVRKMGEVQLAVRFTC  494

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  ++ LH+YSQP+LP MH+I PL  +Q +SLR  A+++++  L+R+EPPLR+EVV YM
Sbjct  495   SS-LINMLHMYSQPLLPKMHYIHPLSVIQLDSLRHQAMQIVSIRLNRAEPPLRKEVVEYM  553

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD DSH +SMR+ +AN+FRI+ V++++I V KW D    W+NP  TIL+H L ++LV +P
Sbjct  554   LDVDSHMWSMRRSKANFFRIMGVLSSLISVGKWFDQICNWKNPLTTILIHILFIILVLYP  613

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG WN+R+R R    H DT++S AE+   DELDEEFD  P T+ +D+
Sbjct  614   ELILPTVFLYLFLIGIWNFRWRPRHP-PHMDTRLSHAEAAHPDELDEEFDTFPTTKGSDI  672

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  RVQT++GDLATQGER Q+L++WRDPRAT +F+  C + A +LY+ P 
Sbjct  673   VRMRYDRLRSIAGRVQTVIGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPF  732

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  G Y LRHP FR ++PS  LNFFRRLP+ +D ML
Sbjct  733   QVVALLAGIYVLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/764 (50%), Positives = 528/764 (69%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMQYLYVRVVKAKDLPGKDVTGTCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   +S+ LE+ V D           D    +F+G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRIQASA-LEVVVKD----------KDFVKDDFMGRVIFDLNEVPKRFPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPK  1405
             PQWYRLE   G   KG++MLA W+GTQADE+FP+AW +D A     G  T RSKVY SPK
Sbjct  140   PQWYRLEDRKGEKVKGEVMLAVWMGTQADEAFPEAWHSDAATVSSDGLATIRSKVYLSPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWYLR +VIEAQD+     PS ++ +    +KA LG Q  +T+ + S + +P WNEDL+F
Sbjct  200   LWYLRVNVIEAQDL----QPSDKARYPEVYVKAILGNQALRTRVSQSKSINPLWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VAAEPF EH L+  + + + P +  +LG   IPL  ++RR+D + V +RWF  E      
Sbjct  256   VAAEPFEEH-LVLSVEDRVAPNKDEILGKCVIPLQYVDRRLDYKPVNTRWFNLEKHVVVA  314

Query  1739  --DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
               +Q ++   +  R+HLR+C +GGYHV++E+ H  SD RPT +QLWKP +G +ELGI+  
Sbjct  315   EGEQKKKDTKFSSRIHLRICLEGGYHVLDESTHYSSDLRPTGKQLWKPSIGVLELGILSA  374

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + L+PMKT  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  375   QGLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPRWNEQYTWEVFDPCTVITIGV  434

Query  2093  FDSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +   +    +KD R+GKVRIR+STL T +VY +++ L++L  +G+KKMGE++LAV
Sbjct  435   FDNCHLQGGDKAGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHSSGVKKMGEVQLAV  494

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YSQP+LP MH++ PL  +Q +SLR  A ++++  LSR+EPPLR+EV
Sbjct  495   RFTCSS-LLNMMHIYSQPLLPKMHYLHPLSVMQLDSLRHQATQIVSMRLSRAEPPLRKEV  553

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD DSH +SMR+ +AN+FRI+ V++ +I V +W D    W+NP  TIL+H L ++L
Sbjct  554   VEYMLDVDSHMWSMRRSKANFFRIMGVLSGLIAVGRWFDQICNWKNPLTTILIHILFLIL  613

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W +R+R R+   H DT++S AE+   DELDEEFD  P +R
Sbjct  614   VLYPELILPTIFLYLFLIGVWYFRWRPRNP-PHMDTRLSHAENAHPDELDEEFDTFPTSR  672

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY
Sbjct  673   PADIVRMRYDRLRSVAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLY  732

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G Y LRHP FR R+PS  LNFFRRLP+  D ML
Sbjct  733   VTPFRVVALLTGIYVLRHPRFRHRLPSVPLNFFRRLPARTDSML  776



>ref|XP_010105960.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC06842.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=1006

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/766 (50%), Positives = 522/766 (68%), Gaps = 47/766 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVEKM YLF+++VKAR LP         P V+V +      ++   K    EW++ 
Sbjct  260   STYDLVEKMQYLFIRVVKARDLPAKDVTGSLDPYVEVKMGNYKGKTKHFEKKQNPEWNEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS+LE+ V D           DV   +F+G + FD+ E+P R PPDSPLA
Sbjct  320   FAFAKDNL-QSSVLEVLVKD----------KDVLIDDFVGLVRFDLHEVPTRVPPDSPLA  368

Query  1247  PQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS---------RSKVY  1393
             P+WYRL  + G   KG+LMLA W+GTQADE+FPDAW +D  G PT          RSKVY
Sbjct  369   PEWYRLADKDGDKKKGELMLAVWLGTQADEAFPDAWHSDAIG-PTENAPASISHIRSKVY  427

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
              SP+LWYLR + +EAQD+  ++  S+     +K Q G Q+ +TKP  + T +P WNEDL+
Sbjct  428   HSPRLWYLRVNAVEAQDL-VVSDKSRFPDVYVKVQCGNQILRTKPVQARTLNPMWNEDLM  486

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQNE-  1750
             FVAAEPF EH L+  + + + P +   +G A I L++IE+R DDR++  RWF  E     
Sbjct  487   FVAAEPFEEH-LVVSVEDRVGPNKDETIGKAVIHLNTIEKRADDRKIRGRWFPLEKSTSA  545

Query  1751  --EKRV--------YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
               E  V        +  R+HL+LC DGGYHV++E+ H  SD RPTA+QLWK  +G +ELG
Sbjct  546   ALEAEVKKDKDKDKFSSRIHLQLCLDGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELG  605

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             I+    L PMK+  G+G++D Y VAKYG KWVRTRTI ++L P++NEQYTW V+DP+TV+
Sbjct  606   ILKADGLHPMKSRDGRGTSDTYCVAKYGHKWVRTRTIINSLNPKYNEQYTWEVFDPATVL  665

Query  2081  TIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             TIGVFD+  + +   +KDV++GKVRIRISTL TG+VY +++ L+ L P+G+KKMGE+ LA
Sbjct  666   TIGVFDNSLIGN--GNKDVKIGKVRIRISTLETGRVYTHSYPLLALHPSGVKKMGELHLA  723

Query  2261  VRF-IRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             +RF   S P + F   YS+P+LP MH+IRPL  +QQE LR  AV ++   LSR+EP LR+
Sbjct  724   IRFSCTSLPNMMF--KYSRPLLPKMHYIRPLSVMQQEMLRHQAVNIVAARLSRAEPSLRK  781

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YM DADSH +SMR+ +AN+FR+++V + +  V KW  +   W+NP  T+LVHAL V
Sbjct  782   EVVEYMSDADSHLWSMRRSKANFFRLMSVFSGMFSVGKWFGEVCTWKNPVTTMLVHALFV  841

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A++++ DELDEEFD  P 
Sbjct  842   MLVCFPELILPTVFLYMFLIGLWNFRYRPRYP-PHMNTRISYADAVNADELDEEFDTFPT  900

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R +D+VR RYD+LR +  R+QT++GD+ATQGER QAL++WRD RAT IFI  C V A +
Sbjct  901   SRGSDIVRMRYDRLRSVAGRIQTVVGDIATQGERFQALLSWRDSRATTIFITFCLVAAVM  960

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             LY+ P +++A+  GFY +RHP FR + PS  LNFFRRLPS AD ML
Sbjct  961   LYVTPFQVLALLAGFYVMRHPRFRRKTPSMPLNFFRRLPSRADSML  1006


 Score =   107 bits (268),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G+SS +V + F  QR +T T  +DLNP WNE   FN+S  ++
Sbjct  5    KLGVEVVGAHDLVPKDGQGSSSAFVELHFDHQRFRTTTKEKDLNPVWNESFYFNISDPNN  64

Query  332  IFGDMLELDVY-HDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQG  508
            +    LE  VY H KN       +FLG+V L  T FV   +  +++YPLE+++ LS ++G
Sbjct  65   LSNLTLEACVYNHSKN---NNSKSFLGKVCLTGTSFVPYSDAVVLHYPLEKRHFLSRVKG  121

Query  509  DIGLKIYFVD  538
            ++GLK++  D
Sbjct  122  ELGLKVFVTD  131



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/764 (50%), Positives = 522/764 (68%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYTEVKLGNYKGTTRHFDKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +SILE++V             DV   +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDR-IQASILEVTV----------KDKDVVKDDFIGRVLFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR ++IEAQD+     PS +  +    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNIIEAQDL----QPSDKGRYPEVFVKAALGNQTLRTRISQSRTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L   + + + P ++  LG  +IPL  ++RR+D + V ++W+  E     
Sbjct  255   FVAAEPFEEP-LTLSVEDRVAPNKEESLGKCAIPLQMVDRRLDQKPVNTKWYNIEKYIVI  313

Query  1742  -QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              + E+K+  K   ++H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  314   MEGEKKKEIKFSSKIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNA  373

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
             + L+PMKT  GKG+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  374   QGLMPMKTKDGKGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIGV  433

Query  2093  FDSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +     P  +KD ++GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAV
Sbjct  434   FDNCHLHGGDKPGGAKDSKIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAV  493

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YS P+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+
Sbjct  494   RFTCSS-LLNMMHMYSLPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRKEI  552

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V+  +I V KW D    W+NP  T+L+H L ++L
Sbjct  553   VEYMLDVGSHMWSMRRSKANFFRIMGVLGGLIAVGKWFDQICNWKNPITTVLIHILFIIL  612

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P TR
Sbjct  613   VMYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTTR  671

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
             P+D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  672   PSDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  731

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   VTPFQIVALFTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/760 (50%), Positives = 522/760 (69%), Gaps = 37/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  32    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYLGKTRVFEKKTNPEWNQV  91

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V             DV   +F+G + FD++E+P R PPDSPLA
Sbjct  92    FAFSKDRL-QASVLEVTV----------KDKDVVKDDFIGKVFFDLNEVPKRVPPDSPLA  140

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  141   PQWYRLEDRQGNKAKGELMLAVWMGTQADEAFPEAWHSDAAVVSGADGLANIRSKVYLSP  200

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+           F ++A LG Q  +T+ + +   +P WNEDL+FVA
Sbjct  201   KLWYLRVNVIEAQDLLPGDKGRYPEVF-VRAILGNQALRTRVSVARGINPMWNEDLMFVA  259

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNE  1750
             AEPF E  L+  + + + P +  VLG  +IPL  ++RR+D + V SRWF  E     + E
Sbjct  260   AEPFEEP-LILSVEDRVAPNKDEVLGKCAIPLQYVDRRLDHKPVNSRWFNLEKHVIVEGE  318

Query  1751  EKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  + L+
Sbjct  319   KKKETKFSSRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILNAQGLM  378

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVFD+W
Sbjct  379   PMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVFDPCTVITIGVFDNW  438

Query  2105  EVIDPE---NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
              +   +    +KD ++GKVRIR+STL T +VY +++ L++L   G+KKMGEI LAVRF  
Sbjct  439   HLHGGDKASGAKDSKIGKVRIRLSTLETDRVYTHSYPLLVLHSNGVKKMGEIHLAVRFTC  498

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ +H+YS P+LP MH++ PL   Q +SLR  A ++++  L R+EPPLR+EVV YM
Sbjct  499   SS-LLNMMHMYSHPLLPKMHYLHPLTVSQLDSLRHQATQIVSMRLGRAEPPLRKEVVEYM  557

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD  SH +SMR+ +AN+FRI+NV++ +I V KW D    W+NP  T+L+H L ++LV +P
Sbjct  558   LDVGSHMWSMRRSKANFFRIMNVLSGLIAVGKWFDQICNWKNPITTVLIHILFIILVLYP  617

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP+D+
Sbjct  618   ELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSSHPDELDEEFDTFPTSRPSDV  676

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY+ P 
Sbjct  677   VRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPF  736

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  737   QVVALLTGFYILRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_009108158.1| PREDICTED: uncharacterized protein LOC103833855 [Brassica rapa]
Length=1012

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/763 (49%), Positives = 525/763 (69%), Gaps = 43/763 (6%)
 Frame = +2

Query  899   RSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQ  1063
             RS++DLVE+M++L+V++VKAR LP      +  P V+V V     I+R   K    EW+Q
Sbjct  269   RSTYDLVERMYFLYVRVVKARELPIMDITGSVDPFVEVKVGNYKGITRHFEKRQHPEWNQ  328

Query  1064  TFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPL  1243
              FAF ++    +S+LE+ V D           D+   +++G + FD+++IPLR PPDSPL
Sbjct  329   VFAFAKERM-QASVLEVVVKD----------KDLLKDDYVGFVRFDINDIPLRVPPDSPL  377

Query  1244  APQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVY  1393
             APQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A         +   RSKVY
Sbjct  378   APQWYRLEDKKGEKIKGELMLAVWIGTQADEAFSDAWHSDAAMPVDCSPAISAVLRSKVY  437

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P+++  F    +KAQLG QV KT+P  + T    WNE
Sbjct  438   HAPRLWYVRVNVVEAQDL----VPTEKHRFPDVYVKAQLGNQVMKTRPCQARTLGAVWNE  493

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             D +FVAAEPF +H L+  + + + P +  +LG   IPL+++E+R DD  + SRW+  E  
Sbjct  494   DFLFVAAEPFEDH-LVLTVEDRVAPGKDEILGRTYIPLNTVEKRADDHMIHSRWYNLERP  552

Query  1739  ---DQNEEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                D ++ KR  +  R+HLR+C +GGYHV++E+ H  SD RP+AR LW+ P+G +ELGI+
Sbjct  553   VIVDVDQLKREKFSMRIHLRVCLEGGYHVLDESTHYSSDLRPSARPLWRQPIGVLELGIL  612

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D + VAKYG KWVRTRT+ DNLCP++NEQYTW V+DP+TV+T+
Sbjct  613   NAVGLHPMKTREGRGTSDTFCVAKYGQKWVRTRTMVDNLCPKYNEQYTWEVFDPATVLTV  672

Query  2087  GVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             GVFD+ ++ +  N +DV++GK+RIR+STL TG++Y +++ L++L P+G+KKMGE+ +AVR
Sbjct  673   GVFDNGQLSEKGN-RDVKIGKIRIRLSTLETGRIYTHSYPLLVLHPSGVKKMGELHMAVR  731

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F       + L+ YS+P+LP MH++RP   +QQ+ LR  AV ++   L R+EPPLR+E++
Sbjct  732   FT-CVSFANMLYQYSKPLLPKMHYVRPFSVMQQDMLRHQAVNIVAARLGRAEPPLRKEII  790

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              +M D DSH +SMRK +AN+FR++ V + VI V KW  D  +WRNP  T+LVH L ++LV
Sbjct  791   EFMSDTDSHLWSMRKSKANFFRMMTVFSGVIAVGKWFSDICSWRNPITTVLVHVLFLMLV  850

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
               P+LI+PT   Y+F+IG WNYRFR R    H +TKIS AE++  DELDEEFD  P TR 
Sbjct  851   CLPELILPTMFLYMFLIGLWNYRFRPRYP-PHMNTKISQAEAVHADELDEEFDTFPTTRN  909

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
               +VR RYD+LR +  R+QT++GDLATQGER QAL++WRDPRAT I++  CF+ A + ++
Sbjct  910   PALVRLRYDRLRSVAGRIQTVIGDLATQGERFQALLSWRDPRATAIYVIFCFLAAMVFFI  969

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++    GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  970   TPIQIVVALAGFYMMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012


 Score =   103 bits (258),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 4/135 (3%)
 Frame = +2

Query  137  MGTERKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNL  316
            M +  KL V+VI A NL PKDG G ++ +V + F GQ+ +T    RDLNP WNE   FN+
Sbjct  2    MMSNLKLGVDVIGAHNLFPKDGQGTANAFVELYFDGQKHRTTIKDRDLNPVWNESFFFNI  61

Query  317  SKHSDIFGDMLELDVY-HDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLL  493
            S  S +    LE   Y H++   PT    FLG+V L  T FV   +  ++++P+E++ + 
Sbjct  62   SDPSRLHYLTLEAQAYSHNR---PTNGRFFLGKVSLPGTSFVPHSDAVVLHFPMEKRGIF  118

Query  494  SWIQGDIGLKIYFVD  538
            S ++G++GLK+Y  D
Sbjct  119  SRVRGELGLKVYITD  133



>ref|XP_007210407.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
 gb|EMJ11606.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
Length=1005

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/761 (49%), Positives = 525/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K     W+Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEVRIGNYRGITKHFEKQQNPVWNQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSKDRM-QASVLEVVIKD----------KDLIKDDFVGLVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   K +LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  370   PEWYRLEDKKGEKIKSELMLAVWIGTQADEAFSDAWHSDAATPADSTPAASTVIRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             +P+LWY+R +VIEAQD+FA        ++ +K QLG QV KTK   +   +P WNEDL+F
Sbjct  430   APRLWYVRVNVIEAQDLFAAEKNRFPDAY-VKVQLGNQVLKTKTLQARNLNPLWNEDLLF  488

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VA+EPF +H L+  + + + P +  ++G   +PL+S++RR DDR + SRWF  E      
Sbjct  489   VASEPFEDH-LVISVEDRVGPGKDEIIGRVILPLNSVDRRADDRMIHSRWFNLEKPVVVD  547

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+   
Sbjct  548   IDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPSIGVLELGILNAV  606

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+GVF
Sbjct  607   GLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTVGVF  666

Query  2096  DSWEVIDPE-NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             D+ ++ D + + KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+RF 
Sbjct  667   DNSQLGDKDSHGKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLAIRF-  725

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               T  ++ L+VYS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EVV Y
Sbjct  726   SCTSFVNMLYVYSKPLLPKMHYVRPFNVIQLDMLRHQAVNIVAARLGRAEPPLRKEVVEY  785

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR++ V + V  V KW  D   W+NP  T+LVH L ++LV F
Sbjct  786   MSDVDSHLWSMRRSKANFFRLMTVFSGVFAVGKWFTDICMWKNPITTVLVHVLFLMLVCF  845

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE +  DELDEEFD  P +R  +
Sbjct  846   PELILPTAFLYMFLIGIWNFRYRPRYP-PHMNTKISQAELVHPDELDEEFDTFPTSRNPE  904

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRA+ +F+ LC + A ++Y+ P
Sbjct  905   LVRMRYDRLRSVAGRIQTVVGDIATQGERFQALLSWRDPRASALFVTLCLIAALVMYVTP  964

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A   GF+ +RHP FR R+PS  +NFFRRLPS  D ML
Sbjct  965   FQVVAALVGFFMMRHPRFRHRLPSAPINFFRRLPSRTDSML  1005


 Score =   109 bits (272),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQR ++    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSSAFVELYFDGQRFRSTLKEKDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+  NV  T   +FLG++ L    FV   +  +++YPLE++ + S ++G+
Sbjct  65   LHYLTLEAYVYN--NVKATYSRSFLGKISLTGNSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYVTD  131



>ref|XP_006352275.1| PREDICTED: uncharacterized protein LOC102594579 [Solanum tuberosum]
Length=1001

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/766 (48%), Positives = 522/766 (68%), Gaps = 44/766 (6%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEW  1057
             M   ++DLVEKMH+LFV++VKAR LP      +  P V+V +     I++   K     W
Sbjct  255   MSGCTYDLVEKMHFLFVRVVKARELPAMDITGSVDPYVEVRIGNYKGITKHIEKNQNPMW  314

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             +  FAF R+    +S+LE+ V D           D+   +F+G   FD++E+P+R PPDS
Sbjct  315   NVVFAFSRER-MQASVLEVVVKD----------KDLVKDDFVGLCRFDLNEVPMRVPPDS  363

Query  1238  PLAPQWYRL--EGGGAHKGDLMLATWVGTQADESFPDAWKTD------TAGNPTSRSKVY  1393
             PLAP+WYRL  + G   KG+LMLA W+GTQADE++PDAW +D      T  +   RSKVY
Sbjct  364   PLAPEWYRLADKKGEKIKGELMLAVWIGTQADEAYPDAWHSDAALSVDTVASTLIRSKVY  423

Query  1394  QSPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNE  1564
              +P+LWY+R +V+EAQD+     P+ ++ F    +KAQ+G QV KTKP  + T +P WNE
Sbjct  424   HAPRLWYVRVNVVEAQDL----VPTDKTRFPDTYVKAQIGNQVLKTKPVQARTFNPLWNE  479

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--  1738
             DL+FVAAEPF E  L+  + + + P +  ++G   IPLS +E+R DDR + SRWF  E  
Sbjct  480   DLLFVAAEPF-EDNLVLTVEDRVAPGKDEIIGRVIIPLSMVEKRADDRMIHSRWFNLEKP  538

Query  1739  -----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                  DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELG+
Sbjct  539   VVVDIDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGVLELGV  597

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +    L PMKT  GKG+++ Y VAKYG KW+RTRT+ DNLCP++NEQYTW V+DP+TV+T
Sbjct  598   LNAVGLHPMKTRDGKGTSNTYCVAKYGHKWIRTRTVVDNLCPKYNEQYTWEVFDPATVLT  657

Query  2084  IGVFDSWEVID--PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIEL  2257
             +GV D+ ++ +     +KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ L
Sbjct  658   VGVLDNTQLGEKGSNGTKDLKVGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGELHL  717

Query  2258  AVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRR  2437
             A+RF   T   + L+ YS P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+
Sbjct  718   AIRFT-CTSFANMLYKYSCPLLPKMHYVRPFTVMQLDMLRHQAVNIVAMRLGRAEPPLRK  776

Query  2438  EVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLV  2617
             EVV YM D DSH +SMR+ +AN+FR++++   +    KW  D   W+NP  T+LVH L +
Sbjct  777   EVVEYMSDVDSHLWSMRRSKANFFRLMSIFTGLFAAAKWFGDICMWKNPITTVLVHVLFL  836

Query  2618  LLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPC  2797
             +LV FP+LI+PT   Y+F+IG WNYR+R R    H +TK+S AES+  DELDEEFD  P 
Sbjct  837   MLVSFPELILPTVFLYMFLIGVWNYRYRPRYP-PHMNTKLSQAESVHPDELDEEFDTFPT  895

Query  2798  TRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFI  2977
             +R  ++VR RYD+LR +  R+QT++GD+ATQGER+Q+L++WRDPRAT +F+  C V A  
Sbjct  896   SRSPELVRMRYDRLRSVAGRIQTVVGDVATQGERLQSLLSWRDPRATALFVTFCLVAALA  955

Query  2978  LYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +Y+ P ++IA   G + +RHP FR R+PS   NFFRRLP+  D ML
Sbjct  956   MYVTPFQVIAALIGIFMMRHPRFRHRLPSVPANFFRRLPARTDSML  1001


 Score =   117 bits (292),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 86/129 (67%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLLPKDG G+SS +V + F GQR +T    +DL+P WNE   FN+S  S+
Sbjct  7    KLGVEVVGAHNLLPKDGQGSSSSFVELYFDGQRFRTTIKEKDLSPVWNETFYFNISDPSN  66

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +   ML LD Y   N+  +   +FLG++ +N T FV   +  +++YPLE++++ S ++G+
Sbjct  67   L--HMLTLDAYVYNNIRASQSRSFLGKITINGTSFVPYSDAVVLHYPLEKRSIFSRVRGE  124

Query  512  IGLKIYFVD  538
            +GLK+Y +D
Sbjct  125  LGLKVYVID  133



>ref|XP_008238857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238859.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238860.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=1005

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/761 (48%), Positives = 525/761 (69%), Gaps = 39/761 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K     W+Q 
Sbjct  261   STYDLVERMYFLYVRVVKARELPAMDVTGSLDPFVEVRIGNYRGITKHFEKQQNPVWNQV  320

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ + D           D+   +F+G + FD++E+PLR PPDSPLA
Sbjct  321   FAFSKDRM-QASVLEVVIKD----------KDLIKDDFVGLVRFDINEVPLRVPPDSPLA  369

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS--------RSKVYQ  1396
             P+WYRLE   G   K +LMLA W+GTQADE+F DAW +D A    S        RSKVY 
Sbjct  370   PEWYRLEDKKGEKIKSELMLAVWIGTQADEAFSDAWHSDAATPADSTPAASTAIRSKVYH  429

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             +P+LWY+R +VIEAQD+FA        ++ +K QLG QV KTK   +   +P WNEDL+F
Sbjct  430   APRLWYVRVNVIEAQDLFAAEKNRFPDAY-VKVQLGNQVLKTKTLQARNLNPLWNEDLLF  488

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE------  1738
             VA+EPF +H L+  + + + P +  ++G   +PL+S++RR DDR + SRWF  E      
Sbjct  489   VASEPFEDH-LVISVEDRVGPGKDEIIGRVILPLNSVDRRADDRMIHSRWFNLEKPVVVD  547

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              DQ ++++ +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+P +G +ELGI+   
Sbjct  548   IDQLKKEK-FSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPSIGVLELGILNAV  606

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+GVF
Sbjct  607   GLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLVDNLSPKYNEQYTWEVFDPATVLTVGVF  666

Query  2096  DSWEVIDPE-NSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFI  2272
             D+ ++ D + + KD+++GKVRIRISTL TG++Y +++ L++L P G+KKMGE+ LA+RF 
Sbjct  667   DNSQLGDKDSHGKDLKIGKVRIRISTLETGRIYTHSYPLLVLHPTGVKKMGELHLAIRF-  725

Query  2273  RSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAY  2452
               T +++ L++YS+P+LP MH++RP   +Q + LR  AV ++   L R+EPPLR+EVV Y
Sbjct  726   SCTSSVNMLYIYSKPLLPKMHYVRPFNVIQLDMLRHQAVNIVAARLGRAEPPLRKEVVEY  785

Query  2453  MLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWF  2632
             M D DSH +SMR+ +AN+FR++ V + V  V KW  D   W+NP  T+LVH L ++LV F
Sbjct  786   MSDVDSHLWSMRRSKANFFRLMTVFSGVFAVGKWFTDICMWKNPITTVLVHVLFLMLVCF  845

Query  2633  PDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPND  2812
             P+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE +  DELDEEFD  P +R  +
Sbjct  846   PELILPTAFLYMFLIGIWNFRYRPRYP-PHMNTKISQAELVHPDELDEEFDTFPTSRNPE  904

Query  2813  MVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVP  2992
             +VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRA+ +F+  C + A ++Y+ P
Sbjct  905   LVRMRYDRLRSVAGRIQTVVGDIATQGERFQALLSWRDPRASALFVTFCLIAALVMYVTP  964

Query  2993  SKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +++A   GF+ +RHP FR R+PS  +NFFRRLPS  D ML
Sbjct  965   FQVVAALVGFFMMRHPRFRHRLPSAPINFFRRLPSRTDSML  1005


 Score =   109 bits (273),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL V+V+ A NLLPKDG G+SS +V + F GQR ++    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVDVVSAHNLLPKDGQGSSSAFVELYFDGQRFRSTLKEKDLNPVWNESFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+  NV  T   +FLG++ L    FV   +  +++YPLE++ + S ++G+
Sbjct  65   LHYLTLEAYVYN--NVKATYSRSFLGKISLTGNSFVPYSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 520/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSLDPYVEVRLGNYRGTTRHFEKKSNPEWSQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVNVKD----------KDFVKDDFVGRVTFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLE--GGGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP++W +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRNGNKVKGELMLAVWMGTQADEAFPESWHSDAATVSGADALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     P   S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLI----PGDRSRFPEVYVKAILGNQALRTRVSMSKTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  I+RR+D R + S+W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKDEVLGRCAIPLQYIDRRLDHRPINSKWYNLEKHIIV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H RL  +GGYHV++E+ H  SD RPTA+QLWK  +G +ELG++  +
Sbjct  314   EGEKKKEIKFASRLHTRLYLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGVLNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+ +TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLSPMKTKDGRATTDAYCVAKYGQKWVRTRTIIDSFAPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   + S   +D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  434   DNCHLHGGDKSGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  ++ +H+YSQP+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+V
Sbjct  494   FTCSS-LMNMMHMYSQPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+ V+  +I + +W+D    W+NP  T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRRSKANFFRIMGVLGGIIAIGRWSDQICNWKNPITTVLIHILFLILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R+   H DT++S A++   DELDEEFD  P +RP
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRNP-PHMDTRLSCADNAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   PDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLTGFYVLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/763 (50%), Positives = 521/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKELPAKDVTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G I FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRI-QASMLEVTVKD----------KDFVKDDFMGRILFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   +G+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  139   PQWYRLEDRKGDKVRGELMLAVWMGTQADEAFPEAWHSDAATVTGTDGLANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA LG QV +T+ + S + +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDL----QPSDKGRYPEVYVKATLGNQVLRTRVSPSRSINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P +  VLG  +IPL  ++RR+D + V +RWF  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRIAPNKDEVLGKCAIPLHYMDRRLDHKPVNTRWFNLERHVIV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+  +
Sbjct  314   EGEKKKETKFSSRIHTRICLEGGYHVLDESTHYSSDLRPTAKQLWKNSIGVLEVGILNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMKT   +G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLMPMKTKDSRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   +    ++D R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVR
Sbjct  434   DNCHLHGGDKAGGARDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+E+V
Sbjct  494   FTCSS-LLNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEIV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+NV   +I V KW D    W+N   T+L+H L ++LV
Sbjct  553   EYMLDVGSHMWSMRRSKANFFRIMNVFGGLIAVGKWFDQICNWKNSITTVLIHILFIILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S AES   DELDEEFD  P ++ 
Sbjct  613   LYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSQT  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   ADIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLIGLYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/760 (50%), Positives = 519/760 (68%), Gaps = 37/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS+LE++V D           D    +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDRI-QSSVLEVTVKD----------KDFVKDDFMGRVLFDMNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A      G    RSKVY SP
Sbjct  139   PQWYRLEDKKGDKLKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDGLANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA LG Q  +T+ + + T +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDL-QPTDKGRYPEVFVKAVLGNQALRTRISQNRTINPLWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNE  1750
             AEPF E  L+  + + + P +   LG  +IPL  ++RR+D + V S+W+  E     + E
Sbjct  258   AEPFEEP-LILSVEDRVAPNKDETLGRCAIPLQYVDRRLDHKPVNSKWYNLEKHIILEGE  316

Query  1751  EKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+ LWK  +G +ELGI+  + L+
Sbjct  317   KKKEIKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKVLWKQSIGVLELGILNAQGLM  376

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TVVTIGVFD+ 
Sbjct  377   PMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVFDPCTVVTIGVFDNC  436

Query  2105  EVIDPENSKDV---RMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
              ++  +        R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI LAVRF  
Sbjct  437   HLLGGDKGGGTKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHLAVRFTC  496

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ +H+Y+ P+LP MH+I PL   Q +SLR  A ++++  L+R+EPPLR+EVV YM
Sbjct  497   SS-LLNMMHMYTHPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLTRAEPPLRKEVVEYM  555

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD  SH +SMR+ +AN+FRI+ V++ +I V KW D    W+NP  T+L+H L ++LV +P
Sbjct  556   LDVGSHMWSMRRSKANFFRIMGVLSGLIAVGKWFDQICNWKNPITTVLIHILFIILVMYP  615

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP D+
Sbjct  616   ELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRPGDI  674

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY+ P 
Sbjct  675   VRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPF  734

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   QVVALLTGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/760 (50%), Positives = 525/760 (69%), Gaps = 40/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+M YL+V++VKA+ LP      +  P V+V +      ++   K    EW+Q 
Sbjct  31    CTYDLVEQMQYLYVRVVKAKDLPGKDVTGSCDPYVEVKLGNYKGTTKHFEKKSNPEWNQC  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE+ V D           DV   + +G + FD++E+P R PPDSPLA
Sbjct  91    FAFSKDRI-QASVLEVLVKD----------KDVVLDDLIGRVMFDLNEVPKRIPPDSPLA  139

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G     G+LMLA W+GTQADE+FPDAW +D A     G    RSKVY SP
Sbjct  140   PQWYRLEDRKGDKVKTGELMLAVWMGTQADEAFPDAWHSDAATVSGEGVANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWY+R ++IEAQD+     PS +S F    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  200   KLWYVRVNIIEAQDLL----PSDKSRFPEVFVKAILGNQASRTRISPSKTINPMWNEDLM  255

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----  1738
             FVAAEPF E  L+  + + + P +  VLG   IPL +++RR+D + V +RWF  E     
Sbjct  256   FVAAEPF-EEPLILTVEDRVAPNKDEVLGKCLIPLQAVQRRLDHKPVNTRWFNLEKHVIV  314

Query  1739  DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKN  1918
             D  +++  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG++    
Sbjct  315   DGEKKETKFSSRIHLRICLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGILELGVLSAHG  374

Query  1919  LLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFD  2098
             L PMKT  G+G+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+T+GVFD
Sbjct  375   LTPMKTKDGRGTTDAYCVAKYGQKWVRTRTIVDSFGPRWNEQYTWEVFDPCTVITVGVFD  434

Query  2099  S-WEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
             +          KD R+GKVRIR+STL T +VY +++ L++L P+G++KMGE++LAVRF  
Sbjct  435   NGHIHGQGGGGKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPSGVRKMGEVQLAVRFTC  494

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  ++ LH+YSQP+LP MH+I PL  +Q +SLR  A+++++  L+R+EPPLR+EVV YM
Sbjct  495   SS-LINMLHMYSQPLLPKMHYIHPLSVIQLDSLRHQAMQIVSIRLNRAEPPLRKEVVEYM  553

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD DSH +SMR+ +AN+FRI+ V++++I V KW D    W+NP  TIL+H L ++LV +P
Sbjct  554   LDVDSHMWSMRRSKANFFRIMGVLSSLISVGKWFDQICNWKNPLTTILIHILFIILVLYP  613

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG WN+R+R R    H DT++S AE+   DELDEEFD  P T+ +D+
Sbjct  614   ELILPTVFLYLFLIGIWNFRWRPRHP-PHMDTRLSHAEAAHPDELDEEFDTFPTTKGSDI  672

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  RVQT++GDLATQGER Q+L++WRDPRAT +F+  C + A +LY+ P 
Sbjct  673   VRMRYDRLRSIAGRVQTVIGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPF  732

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  G Y LRHP FR ++PS  LNFFRRLP+ +D ML
Sbjct  733   QVVALLAGIYVLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_004960016.1| PREDICTED: uncharacterized protein LOC101781845 isoform X1 [Setaria 
italica]
 ref|XP_004960017.1| PREDICTED: uncharacterized protein LOC101781845 isoform X2 [Setaria 
italica]
Length=1012

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 530/763 (69%), Gaps = 41/763 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YLFV++V+AR LP         P V+V V     I++   K    EW+  
Sbjct  266   STYDLVERMQYLFVRVVRARDLPDMDVTGSLDPFVEVRVGNYRGITKHFEKQKNPEWNAV  325

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  326   FAFSRDCM-QASVLEVVVKD----------KDLLKDDFVGLVRFDLNDVPIRVPPDSPLA  374

Query  1247  PQWYRLEGGGAHK--GDLMLATWVGTQADESFPDAWKTDTAG--NPTS----RSKVYQSP  1402
             P+WYRL G    K  G+LMLA W+GTQADE+FPDAW +D A   +P++    +SKVY +P
Sbjct  375   PEWYRLVGKSGDKSMGELMLAVWIGTQADEAFPDAWHSDAATLEDPSAVTHMKSKVYHAP  434

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR +++EAQD+ A+   ++     ++ Q+G Q+ +TKP  +   +P WNEDL+FVA
Sbjct  435   RLWYLRVNIVEAQDV-AIFDKTRYPDVFVRVQVGHQMGRTKPVQARNFNPFWNEDLMFVA  493

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-------D  1741
             AEPF E  L+  L +   P +  +LG   IPL+ I+RR DDR +  +WF  E       D
Sbjct  494   AEPF-EDNLILTLEDRAAPNKDEMLGRVIIPLTMIDRRADDRIIHGKWFNLEKPVLVDVD  552

Query  1742  QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
             Q ++++ +  R+HLRLC DGGYHV++E  +  SD RPTA+QLWKP +G +ELGI+G + +
Sbjct  553   QLKKEK-FSTRLHLRLCLDGGYHVLDECTNYSSDLRPTAKQLWKPSIGLLELGILGAQGI  611

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKGS+D Y VAKYGSKWVRTRTI +N  PR+NEQYTW VYDP+TV+T+GVFD+
Sbjct  612   VPMKTRDGKGSSDTYCVAKYGSKWVRTRTIMNNPNPRFNEQYTWEVYDPATVLTVGVFDN  671

Query  2102  WEVID-----PENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
              ++ +       + KD ++GKVRIR+STL TG+VY +++ L++L  +G+KKMGE+ LA+R
Sbjct  672   GQLGERSGEKTSSGKDGKIGKVRIRLSTLETGRVYTHSYPLLVLHSSGVKKMGELHLAIR  731

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  ST  ++ L++YS+P+LP MH++RP+  +Q + LR  AV+++   LSR EPPLR+EVV
Sbjct  732   F-SSTSLVNMLYLYSRPLLPKMHYVRPIPVLQVDMLRHQAVQIVAARLSRMEPPLRKEVV  790

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YM D DSH +SMRK +AN+FR++ V + +  V KW     AW+NP  T+LVH L ++LV
Sbjct  791   EYMTDFDSHLWSMRKSKANFFRLMTVFSGLFAVSKWFTGVCAWKNPITTVLVHILYIMLV  850

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              FP+LI+PT   Y+F+IG WN+R+R R    H +TKIS AE++  DELDEEFD  P +R 
Sbjct  851   CFPELILPTVFLYMFLIGIWNFRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRN  909

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              ++VR RYD+LR +  R+QT++GD+ATQGERVQAL++WRDPRATG+F+  C + A +LY+
Sbjct  910   PEIVRMRYDRLRSVAGRIQTVVGDIATQGERVQALLSWRDPRATGVFVLFCLIAAVVLYV  969

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  970   TPVQVLAALAGFYVMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012


 Score =   102 bits (253),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 83/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG G+++  V + F GQR +T    +DLNP WNE   FN+S  S+
Sbjct  5    KLGVEVVSAHDLMPKDGQGSANACVEVTFDGQRFRTAVKEKDLNPVWNERFYFNISDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY+      ++R +FLG+V++  T FV   +  +++YPLE++ + S ++G+
Sbjct  65   LPELALEAYVYNVNKTIESSR-SFLGKVRIAGTSFVPFPDAVVMHYPLEKRGMFSRVKGE  123

Query  512  IGLKIYFVD  538
            +GLK+Y  +
Sbjct  124  LGLKVYITN  132



>ref|XP_010231956.1| PREDICTED: uncharacterized protein LOC100844262 isoform X2 [Brachypodium 
distachyon]
Length=1057

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/813 (50%), Positives = 553/813 (68%), Gaps = 45/813 (6%)
 Frame = +2

Query  764   MKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAME--RSSFDLVEKMHYL  937
             M +S     +P    GGG   P   + +P V S     +   A+E  +S++DLVE M YL
Sbjct  261   MASSTERVRLPRHPSGGGYGPPDYYAASPRVISGRFVSTGE-AVEPVQSTYDLVEPMRYL  319

Query  938   FVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQTFAFGRDAPDSSSIL  1108
             FV+IV+ R +     P VK+      + SR  R    T   EW+Q FA     P+ +  L
Sbjct  320   FVRIVRVRGIRPCEGPYVKIQAGPHCLRSRHGRDVSGTGSPEWNQVFAISHAKPEPT--L  377

Query  1109  EISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGG--GAH  1282
             EISVWD  +    D         FLGG+CFD+S++P+RD PD PLA QWYRLEGG  G  
Sbjct  378   EISVWDGGAPSPAD--------AFLGGVCFDLSDVPVRDQPDGPLAAQWYRLEGGDPGMV  429

Query  1283  KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTA  1462
              GD+M++ W+GTQAD+ FP+AW TD      +R+KVYQSPKLWYLR+SVIEAQD+   T 
Sbjct  430   TGDIMVSVWIGTQADDVFPEAWNTDAPYAAYTRAKVYQSPKLWYLRASVIEAQDLRVPTP  489

Query  1463  PSK-ESSFQIKAQLGFQVQKTKP--ASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHL  1633
             P       ++K QLGFQ  +T+   ASS+  + +W EDL+FVA+EP  +  L+  + +  
Sbjct  490   PPGLPFDVRVKVQLGFQSARTRRSVASSSGSAFAWAEDLMFVASEPLDDT-LVLLVEDRS  548

Query  1634  PPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFED---------------QNEEKRVY  1765
               KE ++LG A+IP+SS+E+R+D+RQ++ SRWF  E                  +    Y
Sbjct  549   MIKEPSLLGHATIPVSSVEQRLDERQLVASRWFNLEGGMGHGHGHGDAGDHPHGQPAGFY  608

Query  1766  KGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRG  1945
              GR+HLRL  +GGYHV++EAAH+CSDYRPTA+QLWKPPVG +ELGI+G   LLPMKT  G
Sbjct  609   SGRLHLRLSLEGGYHVLDEAAHVCSDYRPTAKQLWKPPVGVLELGIVGACGLLPMKTKGG  668

Query  1946  -KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDP-  2119
              KGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+ VFD+W +    
Sbjct  669   SKGSTDAYCVAKYGKKWVRTRTVTDSFSPRWNEQYTWQVYDPCTVLTVAVFDNWRMFAGA  728

Query  2120  -ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDF  2296
              +  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE++LAVRF       D 
Sbjct  729   GDERQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEVQLAVRFTSPAHLPDT  788

Query  2297  LHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHS  2476
                Y+ P+LP MH++RP+G  QQE+LR AAV+ +   L+RSEPPL  EVV YMLDAD+H+
Sbjct  789   WATYTSPLLPRMHYLRPIGVAQQEALRGAAVRTVAAWLARSEPPLGPEVVRYMLDADAHT  848

Query  2477  FSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTF  2656
             +S+R+ +ANWFRI+ V+A  + + +W D  R WRNP+ T+LVH L ++LVW+P+L++PT 
Sbjct  849   WSVRRAKANWFRIMGVLAWAVGLERWLDGVRRWRNPSTTVLVHVLYLVLVWYPELVVPTA  908

Query  2657  AFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDK  2836
             + YVF+IG W YRFR R      D ++S A++++ DEL+EEF+AVP     D++R RY++
Sbjct  909   SLYVFLIGVWYYRFRPRAPAG-MDARLSQADTVEGDELEEEFEAVPAP---DVLRLRYER  964

Query  2837  LRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAF  3016
             LR L  RVQ ++GD+A QGER+QALV+WRDPRA+ IF+ +C  VA  LY +P KM+A+A 
Sbjct  965   LRTLAGRVQRVMGDVAAQGERLQALVSWRDPRASRIFVGVCLAVAVALYAMPPKMVAVAT  1024

Query  3017  GFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             GFYYLRHP+FRD MP+ A+NFFRRLPSL+DRML
Sbjct  1025  GFYYLRHPMFRDPMPAAAVNFFRRLPSLSDRML  1057


 Score =   163 bits (412),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL VEV++AR+L+PKDG G SS Y V DF GQRK+TRTV RDLNPQW+E LEF +   +
Sbjct  3    RKLAVEVVDARDLVPKDGLGTSSAYAVADFDGQRKRTRTVPRDLNPQWHERLEFAVPDPA  62

Query  329  DIFGDMLELDVYHDKNVGPT---TRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             +  + L++ +YHD+   P+    +NNFLGRV++  +QF ++GEE ++Y+PLE+++LLSW
Sbjct  63   TMHAEALDVSLYHDRRFNPSGGGGKNNFLGRVRIYGSQFSRRGEEGIVYFPLEKRSLLSW  122

Query  500  IQGDIGLKIYFVD  538
            I+G++GLKIY+ D
Sbjct  123  IRGEVGLKIYYYD  135



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/765 (49%), Positives = 519/765 (68%), Gaps = 40/765 (5%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEW  1057
             +  S++DLVE+M YLFV++VKAR LP+        P V+V V     I++   K    EW
Sbjct  260   LRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEW  319

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             ++ FAF R+    SS+LE++V             DV   +++G + FD++E+P R PPDS
Sbjct  320   NEVFAFSRERI-QSSVLEVAV----------KDKDVVKDDYVGLVRFDLNEVPTRVPPDS  368

Query  1238  PLAPQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS---------RS  1384
             PLA +WYRLE   G   KG+LMLA W GTQADE+FPDAW +D A  PT          RS
Sbjct  369   PLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSD-AVTPTDSPSNVSTHIRS  427

Query  1385  KVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNE  1564
             KVY SP+LWY+R +V+EAQD+  ++  ++     +K Q+G QV KTK   S T +P WNE
Sbjct  428   KVYHSPRLWYVRVNVMEAQDL-VISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNE  486

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             D++FVA+EPF +H L+  + + + P +   +G   IPL S+E+R DDR V +RWF  E  
Sbjct  487   DMMFVASEPFEDH-LILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKS  545

Query  1745  --------NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
                     N +K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG
Sbjct  546   VSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELG  605

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             I+    L PMKT  G+G+ D Y VAKYG KWVRTRTI ++L  ++NEQYTW VYDP+TV+
Sbjct  606   ILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVL  665

Query  2081  TIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             T+GVFD+  +     SKDV++GKVRIRISTL TG+VY +++ L++L P+G+KKMGE+ LA
Sbjct  666   TVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLA  725

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + + +YS+P+LP MH++RPL   QQ+ LR  AV ++   LSR+EPPLR+E
Sbjct  726   IRF-SYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKE  784

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR+++V + +    KW  +   WRNP  T+LVH L V+
Sbjct  785   VVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVM  844

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV+FP+LI+PT   Y+FMIG WNYR+R R    H +T+IS A+++  DELDEEFD  P T
Sbjct  845   LVYFPELILPTVFLYMFMIGLWNYRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTT  903

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRA  IF+  C V A +L
Sbjct  904   RSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVL  963

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P +++A+  G Y +RHP FR + PS  +NFFRRLP+  D ML
Sbjct  964   YVTPFQLLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML  1008


 Score =   104 bits (259),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A  L+PKDG G+S+ +V + F GQ+ +T T  +DL P WNE   FN+S   +
Sbjct  5    KLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD Y   +   T   +FLG+V+L  T FV   +  +++YPLE++++ S ++G+
Sbjct  65   LSN--LALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGE  122

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  123  LGLKVFVTD  131



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/764 (50%), Positives = 522/764 (68%), Gaps = 44/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP      +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSCDPYTEVKLGNYKGTTRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +SILE++V             DV   +F+G + FD++EIP R PPDSPLA
Sbjct  90    FAFSKDR-IQASILEVTV----------KDKDVVKDDFIGRVLFDLNEIPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKAKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR ++IEAQD+     PS +  +    +KA LG Q  +T+ + S T +P WNEDL+
Sbjct  199   KLWYLRVNIIEAQDL----QPSDKGRYPEVFVKATLGNQTLRTRISQSRTINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVAAEPF E  L+  + + + P ++  LG  +IPL  ++RR+D + V ++W+  E     
Sbjct  255   FVAAEPFEEP-LILSVEDRVAPNKEESLGRCAIPLQMVDRRLDQKPVNTKWYNIEKHIVI  313

Query  1742  -QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGC  1912
              + E+K+  K   ++H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  
Sbjct  314   MEGEKKKEIKFSSKIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKSSIGVLELGILSA  373

Query  1913  KNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGV  2092
               L+PMKT  GKG+TDAY VAKYG KWVRTRTI D+  PRWNEQYTW V+DP TV+TIGV
Sbjct  374   HGLMPMKTKDGKGTTDAYCVAKYGQKWVRTRTIIDSFAPRWNEQYTWEVFDPCTVITIGV  433

Query  2093  FDSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             FD+  +     P  SKD ++GKVRIR+STL T +VY +++ L++L+P G+KKMGEI LAV
Sbjct  434   FDNCHLHGGDKPGGSKDSKIGKVRIRLSTLETDRVYTHSYPLLVLNPNGVKKMGEIHLAV  493

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF  S+  L+ +H+YS P+LP MH+I PL   Q ++LR  A ++++  LSR+EPPLR+E+
Sbjct  494   RFTCSS-LLNMMHMYSLPLLPKMHYIHPLTVSQLDNLRHQATQIVSMRLSRAEPPLRKEI  552

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YMLD  SH +SMR+ +AN+FRI+ V+  +I V KW D    W+NP  T+L+H L ++L
Sbjct  553   VEYMLDVGSHMWSMRRSKANFFRIMGVLGGLIAVGKWFDQICNWKNPITTVLIHILFIIL  612

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
             V +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P TR
Sbjct  613   VMYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTTR  671

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
              +D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C V A +LY
Sbjct  672   ASDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLY  731

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   VTPFQIVALFTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>emb|CDP10108.1| unnamed protein product [Coffea canephora]
Length=796

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/767 (48%), Positives = 518/767 (68%), Gaps = 44/767 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M+YL+V++VKA+ LPT     +  P V+V +      ++   K    EW+Q 
Sbjct  45    STYDLVEQMYYLYVRVVKAKDLPTNPVTGSCDPYVEVKLGNYKGKTQRFEKKTNPEWNQV  104

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    SS+LE+ V D            VA  ++LG + FD++E+P R PPDSPLA
Sbjct  105   FAFSKEK-IQSSMLEVFVRD---------REMVARDDYLGKVVFDMNEVPTRVPPDSPLA  154

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G    KG++MLA W+GTQADE+FP++W +D A     G  + RSKVY SP
Sbjct  155   PQWYRLEHRRGDSKVKGEIMLAVWMGTQADEAFPESWHSDAATVQGEGVYSVRSKVYVSP  214

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR ++IEAQD+ +         F +KAQ+G Q+ KTK   + T SP WNEDL+FVA
Sbjct  215   KLWYLRVNIIEAQDVESQDKSQLPQVF-VKAQVGNQILKTKLCPTRTTSPFWNEDLIFVA  273

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE--------  1738
             AEPF E  +L    +  P K++ V G  S+PL++ ERR+D R V S WF  E        
Sbjct  274   AEPFEEQLVLTVENKASPTKDELV-GRKSLPLNNFERRLDHRPVHSSWFNLEKFGFGVLE  332

Query  1739  -DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
              D+ +E + +  R+H+R C +G YHV++E+    SD RPTARQLWK PVG +E+GI+  +
Sbjct  333   ADRRKEHK-FSTRIHIRACLEGAYHVLDESTMYISDQRPTARQLWKQPVGILEVGILSAQ  391

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L PMKT  G+G+TDAY VAKYG KWVRTRTI ++  P+WNEQYTW VYDP TV+T+GVF
Sbjct  392   GLQPMKTKDGRGTTDAYCVAKYGQKWVRTRTIVESFSPKWNEQYTWEVYDPCTVITLGVF  451

Query  2096  DSWEVIDPEN-------SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIE  2254
             D+  +   E         +D R+GKVRIR+STL T ++Y +++ L++L P+G+KKMGE++
Sbjct  452   DNCHLGGNEKPAAGGGPGRDSRIGKVRIRLSTLETDRIYTHSYPLLVLQPSGVKKMGELQ  511

Query  2255  LAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLR  2434
             +A RF   + T   +++Y +P+LP MH++ P    Q +SLR  A+ ++ + L R+EPPLR
Sbjct  512   IAFRFTCLSLT-HMIYLYGRPLLPKMHYLHPFTVSQLDSLRYEAMNIVASRLGRAEPPLR  570

Query  2435  REVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALL  2614
             +EVV YMLD DSH +SMR+ +AN+FRI+++   ++ + KW  + R W+NP  ++LVH L 
Sbjct  571   KEVVEYMLDVDSHMWSMRRSKANFFRIVSLFTGMVSMSKWLGEVRHWKNPVTSVLVHVLF  630

Query  2615  VLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVP  2794
              +L+ +P+LI+PT   Y+F+IG WNYRFR R    H DTK+S AE++  DELDEEFD  P
Sbjct  631   CILICYPELILPTIFLYMFLIGIWNYRFRPRHP-PHMDTKLSWAEAVHPDELDEEFDTFP  689

Query  2795  CTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAF  2974
              ++P D++R RYD+LR +  ++QT++GD+ATQGER+ AL++WRDPRAT +FI  C   A 
Sbjct  690   TSKPQDVIRMRYDRLRSVAGKIQTVVGDMATQGERLHALLSWRDPRATCLFIVFCLCTAI  749

Query  2975  ILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             ILY+ P K++ +  GFY+LRHP FR +MPS   N FRRLPS AD ML
Sbjct  750   ILYVTPFKLVTLLAGFYFLRHPRFRSKMPSIPSNLFRRLPSAADSML  796



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 519/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+MHYL+V++VKA+ LP      +  P V+V +      +R   K    EW+Q 
Sbjct  31    STYDLVEQMHYLYVRVVKAKDLPAKDVTGSCDPYVEVRLGNYKGTTRHFEKKSNPEWNQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +S+LE++V D           D+   +F+G + FD++EIP R PPDSPLA
Sbjct  91    FAFSKERI-QASMLEVTVKD----------KDLVKDDFIGRVLFDMNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   +G+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  140   PQWYRLEDRKGDKSRGELMLAVWMGTQADEAFPEAWHSDAATISGTDSLANIRSKVYLSP  199

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    +KA LG QV +T+ + S + +P WNEDL+
Sbjct  200   KLWYLRVNVIEAQDL----VPSDKGRYPEVYVKAILGNQVLRTRVSPSRSINPMWNEDLM  255

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVA+EPF E  L+  + + + P +  VLG   I +  ++RR+D + V +RWF  E     
Sbjct  256   FVASEPFEEP-LILSVEDRIAPNKDEVLGRCPISMHYVDRRLDHKPVNTRWFNLEKHVVV  314

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +ELGI+  +
Sbjct  315   EGEKKKEIKFASRIHMRICLEGGYHVLDESTHYSSDLRPTAKQLWKHSIGVLELGILNAQ  374

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMK   G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  375   GLMPMKAKDGRGTTDAYCVAKYGQKWVRTRTIIDSFTPKWNEQYTWEVFDPCTVITIGVF  434

Query  2096  DSWEVI---DPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +     P  S+D R+GKVRIR+STL T +VY +++ L++L   G+KKMGEI+LAVR
Sbjct  435   DNCHLHGGDKPGGSRDSRIGKVRIRLSTLETERVYTHSYPLLVLHRNGVKKMGEIQLAVR  494

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YS P+LP MH+I PL   Q ESLR  A  +++  LSRSEPPLR+E+V
Sbjct  495   FTCSS-LLNMMHMYSHPLLPKMHYIHPLTVSQLESLRHQATMIVSARLSRSEPPLRKEIV  553

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI+NV   +I + KW D    W+N   T+L+H L ++LV
Sbjct  554   EYMLDVGSHMWSMRRSKANFFRIMNVFGGLIAMGKWFDQICNWKNSITTVLIHILFIILV  613

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR R R    H DT++S AES   DELDEEFD  P ++ 
Sbjct  614   LYPELILPTIFLYLFLIGVWYYRLRPRHP-PHMDTRLSHAESAHPDELDEEFDTFPTSQT  672

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
              D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  673   ADIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYV  732

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  733   TPFQVVALLIGLYVLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>ref|XP_003566820.2| PREDICTED: uncharacterized protein LOC100844262 isoform X1 [Brachypodium 
distachyon]
Length=1071

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/813 (50%), Positives = 553/813 (68%), Gaps = 45/813 (6%)
 Frame = +2

Query  764   MKASVATASMPEVKIGGGLVGPKPLSRTPsvssfvsdvsdrsAME--RSSFDLVEKMHYL  937
             M +S     +P    GGG   P   + +P V S     +   A+E  +S++DLVE M YL
Sbjct  275   MASSTERVRLPRHPSGGGYGPPDYYAASPRVISGRFVSTGE-AVEPVQSTYDLVEPMRYL  333

Query  938   FVQIVKARSLPTAGRPvvkvvvsgshvisRPARK---TLLFEWDQTFAFGRDAPDSSSIL  1108
             FV+IV+ R +     P VK+      + SR  R    T   EW+Q FA     P+ +  L
Sbjct  334   FVRIVRVRGIRPCEGPYVKIQAGPHCLRSRHGRDVSGTGSPEWNQVFAISHAKPEPT--L  391

Query  1109  EISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLAPQWYRLEGG--GAH  1282
             EISVWD  +    D         FLGG+CFD+S++P+RD PD PLA QWYRLEGG  G  
Sbjct  392   EISVWDGGAPSPAD--------AFLGGVCFDLSDVPVRDQPDGPLAAQWYRLEGGDPGMV  443

Query  1283  KGDLMLATWVGTQADESFPDAWKTDTAGNPTSRSKVYQSPKLWYLRSSVIEAQDIFALTA  1462
              GD+M++ W+GTQAD+ FP+AW TD      +R+KVYQSPKLWYLR+SVIEAQD+   T 
Sbjct  444   TGDIMVSVWIGTQADDVFPEAWNTDAPYAAYTRAKVYQSPKLWYLRASVIEAQDLRVPTP  503

Query  1463  PSK-ESSFQIKAQLGFQVQKTKP--ASSATGSPSWNEDLVFVAAEPFTEHYLLFFLIEHL  1633
             P       ++K QLGFQ  +T+   ASS+  + +W EDL+FVA+EP  +  L+  + +  
Sbjct  504   PPGLPFDVRVKVQLGFQSARTRRSVASSSGSAFAWAEDLMFVASEPLDDT-LVLLVEDRS  562

Query  1634  PPKEQAVLGVASIPLSSIERRVDDRQVI-SRWFTFED---------------QNEEKRVY  1765
               KE ++LG A+IP+SS+E+R+D+RQ++ SRWF  E                  +    Y
Sbjct  563   MIKEPSLLGHATIPVSSVEQRLDERQLVASRWFNLEGGMGHGHGHGDAGDHPHGQPAGFY  622

Query  1766  KGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLLPMKTMRG  1945
              GR+HLRL  +GGYHV++EAAH+CSDYRPTA+QLWKPPVG +ELGI+G   LLPMKT  G
Sbjct  623   SGRLHLRLSLEGGYHVLDEAAHVCSDYRPTAKQLWKPPVGVLELGIVGACGLLPMKTKGG  682

Query  1946  -KGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSWEVIDP-  2119
              KGSTDAY VAKYG KWVRTRT++D+  PRWNEQYTW+VYDP TV+T+ VFD+W +    
Sbjct  683   SKGSTDAYCVAKYGKKWVRTRTVTDSFSPRWNEQYTWQVYDPCTVLTVAVFDNWRMFAGA  742

Query  2120  -ENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRSTPTLDF  2296
              +  +D R+GKVR+R+STL + + Y  ++ L++L  +GLKKMGE++LAVRF       D 
Sbjct  743   GDERQDYRIGKVRVRVSTLESNRAYTASYPLLVLLRSGLKKMGEVQLAVRFTSPAHLPDT  802

Query  2297  LHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLDADSHS  2476
                Y+ P+LP MH++RP+G  QQE+LR AAV+ +   L+RSEPPL  EVV YMLDAD+H+
Sbjct  803   WATYTSPLLPRMHYLRPIGVAQQEALRGAAVRTVAAWLARSEPPLGPEVVRYMLDADAHT  862

Query  2477  FSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDLIIPTF  2656
             +S+R+ +ANWFRI+ V+A  + + +W D  R WRNP+ T+LVH L ++LVW+P+L++PT 
Sbjct  863   WSVRRAKANWFRIMGVLAWAVGLERWLDGVRRWRNPSTTVLVHVLYLVLVWYPELVVPTA  922

Query  2657  AFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVRARYDK  2836
             + YVF+IG W YRFR R      D ++S A++++ DEL+EEF+AVP     D++R RY++
Sbjct  923   SLYVFLIGVWYYRFRPRAPAG-MDARLSQADTVEGDELEEEFEAVPAP---DVLRLRYER  978

Query  2837  LRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKMIAMAF  3016
             LR L  RVQ ++GD+A QGER+QALV+WRDPRA+ IF+ +C  VA  LY +P KM+A+A 
Sbjct  979   LRTLAGRVQRVMGDVAAQGERLQALVSWRDPRASRIFVGVCLAVAVALYAMPPKMVAVAT  1038

Query  3017  GFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             GFYYLRHP+FRD MP+ A+NFFRRLPSL+DRML
Sbjct  1039  GFYYLRHPMFRDPMPAAAVNFFRRLPSLSDRML  1071


 Score =   163 bits (412),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  149  RKLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHS  328
            RKL VEV++AR+L+PKDG G SS Y V DF GQRK+TRTV RDLNPQW+E LEF +   +
Sbjct  3    RKLAVEVVDARDLVPKDGLGTSSAYAVADFDGQRKRTRTVPRDLNPQWHERLEFAVPDPA  62

Query  329  DIFGDMLELDVYHDKNVGPT---TRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSW  499
             +  + L++ +YHD+   P+    +NNFLGRV++  +QF ++GEE ++Y+PLE+++LLSW
Sbjct  63   TMHAEALDVSLYHDRRFNPSGGGGKNNFLGRVRIYGSQFSRRGEEGIVYFPLEKRSLLSW  122

Query  500  IQGDIGLKIYFVD  538
            I+G++GLKIY+ D
Sbjct  123  IRGEVGLKIYYYD  135



>ref|XP_004306799.1| PREDICTED: uncharacterized protein LOC101305880 [Fragaria vesca 
subsp. vesca]
Length=1012

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/768 (48%), Positives = 518/768 (67%), Gaps = 45/768 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVEKM YLFV++VKAR LPT        P V+V +      ++   K    EW++ 
Sbjct  260   STYDLVEKMQYLFVRVVKARDLPTMDVTGSLDPYVEVKIGNYKGTTKHFEKQKNPEWNEV  319

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D   + + LE+ V D           D+   +++G + FD+ E+P R PPDSPLA
Sbjct  320   FAFAKDNLQAHT-LEVVVKD----------KDLMKDDYVGFVRFDLHEVPTRVPPDSPLA  368

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--------NPTSRSKVYQ  1396
             P+WYR+E   G    G+LMLA W GTQADE+FPDAW +D  G           SRSKVY 
Sbjct  369   PEWYRIENKKGEKRNGELMLAVWYGTQADEAFPDAWHSDAIGPDDTSSATYAHSRSKVYH  428

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             SP+LWY+R +VIEAQD+  ++  S+      K Q+G QV KTK   +   +P WNEDL+F
Sbjct  429   SPRLWYVRVNVIEAQDLI-ISDRSRFPDAYAKVQIGNQVLKTKTVQTRVLNPMWNEDLMF  487

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED-----  1741
             VAAEPF +H L+  + + + P +   LG  +IPL+++ERR DDR +  RW+  E      
Sbjct  488   VAAEPFDDH-LIVSVEDRVGPNKDETLGRVAIPLNTVERRADDRIIRGRWYNLEKHMSDA  546

Query  1742  ---------QNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVE  1894
                      +++EK  +  R+HLR+C DGGYHV++E+ H  SD RPTA+ LWK  +G +E
Sbjct  547   LELEGEQRKKDKEKDKFSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKPLWKSSIGVLE  606

Query  1895  LGIIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPST  2074
             LGI+    L PMKT  GKG+ D Y VAKYG KWVRTRTI+++L P++NEQYTW V+DP+T
Sbjct  607   LGILNADGLHPMKTRDGKGTADTYCVAKYGHKWVRTRTINNSLSPKYNEQYTWEVFDPAT  666

Query  2075  VVTIGVFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEI  2251
             V+T+GVFD+ ++    N  +DV++GKVRIR+STL TG+VY +++ L++L P+G+KKMGE+
Sbjct  667   VLTVGVFDNTQIFSNSNGHRDVKIGKVRIRMSTLETGRVYTHSYPLLVLHPSGVKKMGEL  726

Query  2252  ELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPL  2431
              LA+RF   T  ++ +  YS+P+LP MH++RPL  +QQ+ LR  AV ++   LSR+EPPL
Sbjct  727   HLAIRF-SCTSLVNMMFKYSRPLLPKMHYVRPLTVIQQDMLRHQAVNIVAARLSRAEPPL  785

Query  2432  RREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHAL  2611
             R+EVV YM DADSH +SMR+ +AN+FR++ V A +  V KW  +   W+NP  T LVH L
Sbjct  786   RKEVVEYMSDADSHLWSMRRSKANFFRLMTVFAGLFAVGKWFGEVCMWKNPITTALVHVL  845

Query  2612  LVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAV  2791
              V+LV FP+LI+PT   Y+F+IG WN+R+R R    H +T+IS A+++  DELDEEFD  
Sbjct  846   FVMLVCFPELILPTVFLYMFLIGIWNFRYRPRYP-PHMNTRISYADAVHPDELDEEFDTF  904

Query  2792  PCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVA  2971
             P +R  D+VR RYD+LR +  R+QT++GD+ATQGER+Q+L++WRDPRAT +FI  C V A
Sbjct  905   PTSRGTDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQSLLSWRDPRATMLFITFCLVAA  964

Query  2972  FILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              +LY+ P +++ +  G Y++RHP FR +MPS  +NFFRRLP+  D ML
Sbjct  965   IVLYVTPFQVLVLLGGVYFMRHPRFRHKMPSAPVNFFRRLPARTDSML  1012


 Score = 97.1 bits (240),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 76/129 (59%), Gaps = 5/129 (4%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A +L+PKDG   +S +V + F  QR +T    RDLNP WNE   FN++  +D
Sbjct  5    KLGVEVVAAHDLMPKDG--TASTFVELHFDHQRFRTTVKERDLNPVWNESFYFNVTDPND  62

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    LE  VY   N G       LG+V L  T FV   +  +++YPLE+K L S ++G+
Sbjct  63   LSNMNLEAYVY---NHGKANTKTCLGKVCLTGTSFVPYSDACVLHYPLEKKGLFSRVKGE  119

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  120  LGLKVFVTD  128



>ref|XP_002298449.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE83254.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1051

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/770 (49%), Positives = 519/770 (67%), Gaps = 51/770 (7%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE++ YL+V+IVKA+ LP++       P V+V +      +R   K +  EW+Q 
Sbjct  301   STYDLVEQVSYLYVRIVKAKDLPSSSITASCDPYVEVKLGNYKGRTRHFEKKMNPEWNQV  360

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    SS+LE+ V D            V   ++LG + FD++E+P R PPDSPLA
Sbjct  361   FAFSKDRI-QSSVLEVFVKD---------KEMVGRDDYLGRVVFDLNEVPTRVPPDSPLA  410

Query  1247  PQWYRLE---GGGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSP  1402
             PQWYRLE   G G  +G++MLA W+GTQADE+FPDAW +D A     G    RSKVY SP
Sbjct  411   PQWYRLEDRRGEGKVRGEIMLAVWMGTQADEAFPDAWHSDAASVYGEGVLNIRSKVYVSP  470

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQ---IKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS  S      +K Q+G QV +TK   + T +P WNEDLV
Sbjct  471   KLWYLRVNVIEAQDV----VPSDRSRLPEVFVKVQVGNQVLRTKIHPTRTANPLWNEDLV  526

Query  1574  FVAAEPFTEHYLLFFLIE-HLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE----  1738
             FV AEPF E   LF  +E  L P +  VLG  S+PL+  E+R+D R V SRWF  E    
Sbjct  527   FVVAEPFEEQ--LFLTVEDRLTPLKDDVLGKISVPLNIFEKRLDHRPVHSRWFNLEKYGF  584

Query  1739  -----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGI  1903
                  D+ +E + +  R+HLR+C +GGYHV++E+    SD RPTARQLWK PVG +E+GI
Sbjct  585   GVLEADRRKELK-FSSRIHLRVCLEGGYHVMDESTMYISDQRPTARQLWKQPVGILEVGI  643

Query  1904  IGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVT  2083
             +G + LLPMK   G+GSTDAY VAKYG KWVRTRTI D   P+WNEQYTW VYDP TV+T
Sbjct  644   LGAQGLLPMKMKDGRGSTDAYCVAKYGQKWVRTRTIVDTFNPKWNEQYTWEVYDPCTVIT  703

Query  2084  IGVFDSWEVIDPEN------SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMG  2245
             +GVFD+  +   E       ++D+R+GKVRIR+STL   + Y +++ L++L P G+KKMG
Sbjct  704   LGVFDNCHLGGGEKPTAANAARDLRIGKVRIRLSTLEAYRTYTHSYPLLVLHPLGVKKMG  763

Query  2246  EIELAVRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEP  2425
             E++LAVRF  +    + ++VY  P+LP MH++ P    Q ++LR  A+ ++   L R+EP
Sbjct  764   ELQLAVRFT-TLSLANMIYVYGHPLLPKMHYLHPFTVNQVDNLRYQAMNIVAVRLGRAEP  822

Query  2426  PLRREVVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVH  2605
             PLR+EVV YMLD DSH++SMR+ +AN+FRI+++++ +  +  W  D   WRNP  ++LVH
Sbjct  823   PLRKEVVEYMLDVDSHTWSMRRSKANFFRIMSLVSGLFSMSHWFGDICQWRNPITSVLVH  882

Query  2606  ALLVLLVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFD  2785
              L ++L+W+P+LI+PT   Y+F+IG WNYRFR R    H DTK+S AE++  DELDEEFD
Sbjct  883   ILFLILIWYPELILPTLFLYMFLIGIWNYRFRPRHP-PHMDTKLSWAEAVHPDELDEEFD  941

Query  2786  AVPCTRPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFV  2965
               P ++ +D+VR RYD+LR +  R+QT++GD+ATQGER Q+L++WRDPRAT +FI  C  
Sbjct  942   TFPTSKSHDIVRMRYDRLRGVAGRIQTVVGDIATQGERFQSLLSWRDPRATSLFIVFCLC  1001

Query  2966  VAFILYLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              A +LY+ P +++A+  G YYLRHP FR ++PS   NFF+RLP+  D +L
Sbjct  1002  AAVVLYVTPFRVVALVAGLYYLRHPRFRSKLPSVPSNFFKRLPARTDSLL  1051


 Score =   113 bits (283),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL+VE+++A +L+PKDG G++SP+V +DF  Q  KT+T+ ++LNP WN+ L F+L +  +
Sbjct  2    KLVVEIVDAHDLMPKDGKGSASPFVEVDFQNQLSKTKTIPKNLNPVWNQKLLFDLDETKN  61

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
                 +E+ VY+++   P    NFLGR ++  +  VKKG+E    + LE+K   S ++G+
Sbjct  62   RHHQSIEVSVYNERR--PIPGRNFLGRTRIPCSNVVKKGDEVYQTFQLEKKWFFSTVKGE  119

Query  512  IGLKIY  529
            IGLKIY
Sbjct  120  IGLKIY  125



>ref|XP_002299538.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
 gb|EEE84343.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
Length=1008

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/764 (49%), Positives = 523/764 (68%), Gaps = 45/764 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M++L+V++VKAR LP         P V+V +     I++   K    EW+Q 
Sbjct  264   STYDLVERMYFLYVRVVKARDLPAMDVTGSLDPFVEVRIGNYRGITKHFEKKQNPEWNQV  323

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF R+    +S+LE+ + D           D+   +F+G I FD++E+PLR PPDSPLA
Sbjct  324   FAFSRERM-QASVLEVVIKD----------KDLVKDDFVGVIRFDINEVPLRVPPDSPLA  372

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA----GNPTS----RSKVYQ  1396
             P+WYRLE   G   KG+LMLA W+GTQADE+FPDAW +D A      P S    RSKVY 
Sbjct  373   PEWYRLEDKKGEKIKGELMLAVWIGTQADEAFPDAWHSDAATPVDSTPASSTVIRSKVYH  432

Query  1397  SPKLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNED  1567
             +P+LWY+R +V+EAQD+     PS+++ F    +K Q+G QV KTK   + T S  WNED
Sbjct  433   APRLWYVRVNVVEAQDL----VPSEKNRFPEVYVKVQIGNQVLKTKTYQARTFSALWNED  488

Query  1568  LVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE---  1738
             L+FVAAEPF +H L+  + + + P +  ++G   IPLSS+E+R DDR + S WF  E   
Sbjct  489   LLFVAAEPFEDH-LVLSVEDRVGPGKDEIIGRVIIPLSSVEKRADDRIIHSCWFNLEKPV  547

Query  1739  ----DQNEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGII  1906
                 DQ ++ + +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLW+PP+G +ELGI+
Sbjct  548   AVDVDQLKKDK-FSSRIHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWRPPIGMLELGIL  606

Query  1907  GCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTI  2086
                 L PMKT  G+G++D Y VAKYG KWVRTRT+ DNL P++NEQYTW V+DP+TV+T+
Sbjct  607   NAVGLHPMKTRDGRGTSDTYCVAKYGHKWVRTRTLIDNLSPKYNEQYTWEVFDPATVLTV  666

Query  2087  GVFDSWEVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAV  2263
             GVFD+ ++ +  +S KD+++GKVRIRISTL TG+VY +++ L++L P G+KKMGE+ LA+
Sbjct  667   GVFDNNQLGEKGSSGKDLKIGKVRIRISTLETGRVYTHSYPLLVLHPTGVKKMGELHLAI  726

Query  2264  RFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREV  2443
             RF       + L+ YS+P+LP MH+IRP   +Q + LR  AV ++   L R+EPPLR+EV
Sbjct  727   RFT-CISFANMLYQYSRPLLPKMHYIRPFTVMQLDMLRHQAVNIVALRLGRAEPPLRKEV  785

Query  2444  VAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLL  2623
             V YM D D+H +SMR+ +AN+FR++ + + +    KW  D   W+NP  T+LVH L ++L
Sbjct  786   VEYMSDVDAHLWSMRRSKANFFRLMTIFSGLFAAGKWFGDICMWKNPITTVLVHVLYLML  845

Query  2624  VWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTR  2803
               FP+LI+PT   Y+F+IG WNYR+R R    H +TKIS AE +  DELDEEFD  P +R
Sbjct  846   ACFPELILPTVFLYMFLIGIWNYRYRPRYP-PHMNTKISQAEVVHPDELDEEFDTFPTSR  904

Query  2804  PNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILY  2983
               ++VR RYD+LR +  R+QT++GD+ATQGER QAL++WRDPRAT IF+  C V A +L+
Sbjct  905   SPELVRMRYDRLRSVSGRIQTVVGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLF  964

Query  2984  LVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             + P ++IA   GFY +RHP FR R PS  +NFFRRLPS  D ML
Sbjct  965   VTPFQVIAALAGFYMMRHPRFRYRTPSVPINFFRRLPSRTDSML  1008


 Score =   112 bits (280),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 82/129 (64%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A NLLPKD HG+SS +V +DF GQR +T    +DL+P WNE   FN+S  S+
Sbjct  5    KLGVEVVSAHNLLPKDEHGSSSAFVELDFDGQRFRTTIKEKDLHPVWNESFYFNVSDPSN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD +   N+  T   +FLG+V L    FV   +  +++YPLE++ + S ++G+
Sbjct  65   L--HYLTLDAHVYCNIRATNSRSFLGKVCLTGNSFVLHSDAVVLHYPLEKRGIFSRVRGE  122

Query  512  IGLKIYFVD  538
            +GLK+Y  D
Sbjct  123  LGLKVYITD  131



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 522/763 (68%), Gaps = 43/763 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKAR LP      +  P V+V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKARDLPAKDATGSCDPYVEVKLGNYKGATRHFEKKSNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +++LE+ V D           D+   +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDR-IQATVLEVIVKD----------KDLMKDDFMGRVSFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   +G+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDHKGNKARGELMLAVWMGTQADEAFPEAWHSDAATISGADSLANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLV  1573
             KLWYLR +VIEAQD+     PS +  +    ++A LG Q  KT+ + S + +P WNEDL+
Sbjct  199   KLWYLRVNVIEAQDLM----PSDKGRYPEVYVRAILGNQALKTRISPSRSINPMWNEDLM  254

Query  1574  FVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----  1741
             FVA+EPF E  L+  + + + P +  VLG  +IPL  + RR D + V + W   E     
Sbjct  255   FVASEPFEEP-LILSVEDRIAPNKDEVLGRCAIPLQYVPRRYDHKPVNTSWHHLEKHVIV  313

Query  1742  QNEEKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCK  1915
             + E+K+  K   R+H+R+C +GGYHV++E+ +  SD RPTA+ LWK  +G +E+GI+  +
Sbjct  314   EGEKKKEIKFASRIHMRICLEGGYHVLDESTYYSSDLRPTAKPLWKSSIGILEVGILNAQ  373

Query  1916  NLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVF  2095
              L+PMKT  G+G+TDAY VAKYG KWVRTRTI D+  P+WNEQYTW V+DP TV+TIGVF
Sbjct  374   GLMPMKTKDGRGTTDAYCVAKYGQKWVRTRTIIDSFMPKWNEQYTWEVFDPCTVITIGVF  433

Query  2096  DSWEVIDPENS---KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVR  2266
             D+  +   E +   KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI +AVR
Sbjct  434   DNCHLHGGEKAGGAKDARIGKVRIRLSTLETDRVYTHSYPLLVLHPNGVKKMGEIHMAVR  493

Query  2267  FIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVV  2446
             F  S+  L+ +H+YSQP+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+EVV
Sbjct  494   FTCSS-LLNMMHMYSQPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVV  552

Query  2447  AYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLV  2626
              YMLD  SH +SMR+ +AN+FRI++V+  +I V KW D    WRNP  T+L+H L ++LV
Sbjct  553   EYMLDVRSHMWSMRRSKANFFRIMSVLGGIIAVGKWFDQICNWRNPITTVLIHILFIILV  612

Query  2627  WFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRP  2806
              +P+LI+PT   Y+F+IG W YR+R R    H DT++S A+S   DELDEEFD  P +RP
Sbjct  613   MYPELILPTIFLYLFLIGVWYYRWRPRHP-PHMDTRLSHADSAHPDELDEEFDTFPTSRP  671

Query  2807  NDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYL  2986
             +D+VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A +LY+
Sbjct  672   SDIVRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYV  731

Query  2987  VPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
              P +++A+  GFY LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  732   TPFQVVALLAGFYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/758 (49%), Positives = 518/758 (68%), Gaps = 39/758 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+MHYL+V++VKA+ LP      +  P V+V +     +++   K    EW Q 
Sbjct  31    CTYDLVEQMHYLYVRVVKAKELPGKDVTGSCDPYVEVKLGNYRGMTKHFEKKSNPEWRQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +SILE+ V D           DV   +F+GGI FD++EIP R PPDSPLA
Sbjct  91    FAFSKERI-QASILEVIVKD----------KDVMLDDFIGGIMFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A     G    RSKVY SPK
Sbjct  140   PQWYRLEDRHGRKVKGELMLAVWMGTQADEAFSDAWHSDAATVGPEGVTNIRSKVYLSPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     P  ++ F    +KA LG Q  +T+ + + T +P WNEDL+F
Sbjct  200   LWYVRVNVIEAQDLI----PHDKTKFPEVYVKAMLGNQTLRTRISQNRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ----  1744
             V AEPF E  L+  +   + P     LG   IPL S++RR+D R + SRWF  E      
Sbjct  256   VVAEPFEEP-LILAVENRVAPNNDETLGRCGIPLQSVQRRLDHRPLHSRWFNLEKHIMVD  314

Query  1745  NEEKRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
              E+K + +  R+HLR+  +GGYHV++E+ H  SD RPTA+QLWKP +G +E+GII    L
Sbjct  315   GEKKEIKFASRIHLRIFLEGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLEVGIISAHGL  374

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKG+TDAY VAKYG KW+RTRTI D+L P+WNEQYTW V+D  TV+T G FD+
Sbjct  375   MPMKTKDGKGTTDAYCVAKYGQKWIRTRTIVDSLMPKWNEQYTWEVFDTCTVITFGAFDN  434

Query  2102  WEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
                I   + KD+R+GKVRIR+STL + ++Y +++ L++  P+G+KK GEI+LAVRF    
Sbjct  435   GH-IPGGSGKDMRIGKVRIRLSTLESDRIYTHSYPLLVFHPSGIKKTGEIQLAVRFT-CL  492

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
               ++ LH+YSQP+LP MH+I PL  +Q +SLR  A+ +++  L+R+EPPLR+EVV YMLD
Sbjct  493   SVINMLHMYSQPLLPKMHYIHPLSVLQLDSLRHQAMNIVSARLNRAEPPLRKEVVEYMLD  552

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
              DSH +SMR+ +AN+FRI+NV++ ++ V KW D    WRNP  TIL+H L ++LV +P+L
Sbjct  553   VDSHMWSMRRSKANFFRIMNVLSGLVAVTKWFDQICNWRNPITTILIHVLFIILVLYPEL  612

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             I+PT   Y+F+IG WN+R+R R    H DT++S A+++  DELDEEFD  P +R  ++VR
Sbjct  613   ILPTVFLYLFLIGIWNFRWRPRHP-PHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVR  671

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RYD+LR +G RVQT++GDLATQGER  +L++WRDPRAT +F+  C + A +LY+ P ++
Sbjct  672   MRYDRLRSIGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFLFFCLIAAVVLYVTPFQV  731

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A+  G Y LRHP FR ++PS  LN FRRLP+ +D ++
Sbjct  732   VALLTGIYVLRHPRFRHKLPSVPLNLFRRLPARSDSLI  769



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/765 (49%), Positives = 519/765 (68%), Gaps = 40/765 (5%)
 Frame = +2

Query  893   MERSSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEW  1057
             +  S++DLVE+M YLFV++VKAR LP+        P V+V V     I++   K    EW
Sbjct  260   LRASTYDLVEQMRYLFVRVVKARDLPSKDVTGSLDPFVEVKVGNYKGITKYYEKKQNPEW  319

Query  1058  DQTFAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDS  1237
             ++ FAF R+    SS+LE++V             DV   +++G + FD++E+P R PPDS
Sbjct  320   NEVFAFSRERI-QSSVLEVAV----------KDKDVVKDDYVGLVRFDLNEVPTRVPPDS  368

Query  1238  PLAPQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS---------RS  1384
             PLA +WYRLE   G   KG+LMLA W GTQADE+FPDAW +D A  PT          RS
Sbjct  369   PLAAEWYRLEDRKGEKKKGELMLAVWYGTQADEAFPDAWHSD-AVTPTDSPSNVSTHIRS  427

Query  1385  KVYQSPKLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNE  1564
             KVY SP+LWY+R +V+EAQD+  ++  ++     +K Q+G QV KTK   S T +P WNE
Sbjct  428   KVYHSPRLWYVRVNVMEAQDL-VISDKNRFPDAYVKVQIGNQVLKTKSVQSRTLNPVWNE  486

Query  1565  DLVFVAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ  1744
             D++FVA+EPF +H L+  + + + P +   +G   IPL S+E+R DDR V +RWF  E  
Sbjct  487   DMMFVASEPFEDH-LILTVEDRVGPNKDETIGKVVIPLHSVEKRADDRIVHTRWFNLEKS  545

Query  1745  --------NEEKRVYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELG  1900
                     N +K  +  R+HLR+C DGGYHV++E+ H  SD RPTA+QLWKP +G +ELG
Sbjct  546   VSAALDGDNAKKDKFSSRLHLRVCLDGGYHVLDESTHYSSDLRPTAKQLWKPSIGVLELG  605

Query  1901  IIGCKNLLPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVV  2080
             I+    L PMKT  G+G+ D Y VAKYG KWVRTRTI ++L  ++NEQYTW VYDP+TV+
Sbjct  606   ILNADGLHPMKTRDGRGTADTYCVAKYGHKWVRTRTIINSLSAKYNEQYTWEVYDPATVL  665

Query  2081  TIGVFDSWEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELA  2260
             T+GVFD+  +     SKDV++GKVRIRISTL TG+VY +++ L++L P+G+KKMGE+ LA
Sbjct  666   TVGVFDNSHIGGSSGSKDVKIGKVRIRISTLETGRVYTHSYPLLVLHPSGVKKMGELHLA  725

Query  2261  VRFIRSTPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRRE  2440
             +RF   T   + + +YS+P+LP MH++RPL   QQ+ LR  AV ++   LSR+EPPLR+E
Sbjct  726   IRF-SYTSFANMMFLYSRPLLPKMHYVRPLTMAQQDMLRHQAVNIVAARLSRAEPPLRKE  784

Query  2441  VVAYMLDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVL  2620
             VV YM D DSH +SMR+ +AN+FR+++V + +    KW  +   WRNP  T+LVH L V+
Sbjct  785   VVEYMSDVDSHLWSMRRSKANFFRLMSVFSGLFAAGKWFGEVCMWRNPITTVLVHILFVM  844

Query  2621  LVWFPDLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCT  2800
             LV+FP+LI+PT   Y+FMIG WNYR+R R    H +T+IS A+++  DELDEEFD  P T
Sbjct  845   LVYFPELILPTVFLYMFMIGLWNYRYRPRYP-PHMNTRISYADAVHPDELDEEFDTFPTT  903

Query  2801  RPNDMVRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFIL  2980
             R  D+VR RYD+LR +  R+QT++GD+ATQGER+QAL++WRDPRA  IF+  C V A +L
Sbjct  904   RSPDIVRMRYDRLRSVAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVL  963

Query  2981  YLVPSKMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             Y+ P +++A+  G Y +RHP FR + PS  +NFFRRLP+  D ML
Sbjct  964   YVTPFQVLALLAGCYIMRHPRFRHKTPSAPINFFRRLPARTDSML  1008


 Score =   104 bits (259),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 81/129 (63%), Gaps = 2/129 (2%)
 Frame = +2

Query  152  KLIVEVIEARNLLPKDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSD  331
            KL VEV+ A  L+PKDG G+S+ +V + F GQ+ +T T  +DL P WNE   FN+S   +
Sbjct  5    KLGVEVVSAYELMPKDGQGSSNAFVELHFDGQKFRTTTKEKDLTPVWNESFYFNISDPHN  64

Query  332  IFGDMLELDVYHDKNVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGD  511
            +    L LD Y   +   T   +FLG+V+L  T FV   +  +++YPLE++++ S ++G+
Sbjct  65   LSN--LALDAYVYNHNRTTNSKSFLGKVRLTGTSFVPYSDAVVLHYPLEKRSIFSRVKGE  122

Query  512  IGLKIYFVD  538
            +GLK++  D
Sbjct  123  LGLKVFVTD  131



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/758 (49%), Positives = 518/758 (68%), Gaps = 39/758 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
              ++DLVE+MHYL+V++VKA+ LP      +  P V+V +     +++   K    EW Q 
Sbjct  31    CTYDLVEQMHYLYVRVVKAKELPGKDVTGSCDPYVEVKLGNYRGMTKHFEKKSNPEWRQV  90

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF ++    +SILE+ V D           DV   +F+GGI FD++EIP R PPDSPLA
Sbjct  91    FAFSKERI-QASILEVIVKD----------KDVMLDDFIGGIMFDLNEIPKRVPPDSPLA  139

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTA-----GNPTSRSKVYQSPK  1405
             PQWYRLE   G   KG+LMLA W+GTQADE+F DAW +D A     G    RSKVY SPK
Sbjct  140   PQWYRLEDRHGRKVKGELMLAVWMGTQADEAFSDAWHSDAATVRPEGVTNIRSKVYLSPK  199

Query  1406  LWYLRSSVIEAQDIFALTAPSKESSF---QIKAQLGFQVQKTKPASSATGSPSWNEDLVF  1576
             LWY+R +VIEAQD+     P  ++ F    +KA LG Q  +T+ + + T +P WNEDL+F
Sbjct  200   LWYVRVNVIEAQDLI----PHDKTKFPEVYVKAMLGNQTLRTRISQNRTLNPMWNEDLMF  255

Query  1577  VAAEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFEDQ----  1744
             V AEPF E  L+  +   + P     LG   IPL S++RR+D R + SRWF  E      
Sbjct  256   VVAEPFEEP-LILAVENRVAPNNDETLGRCGIPLQSVQRRLDHRPLHSRWFNLEKHIMVD  314

Query  1745  NEEKRV-YKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNL  1921
              E+K + +  R+HLR+  +GGYHV++E+ H  SD RPTA+QLWKP +G +E+GII    L
Sbjct  315   GEKKEIKFASRIHLRIFLEGGYHVLDESTHYSSDLRPTAKQLWKPSIGLLEVGIISAHGL  374

Query  1922  LPMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDS  2101
             +PMKT  GKG+TDAY VAKYG KW+RTRTI D+L P+WNEQYTW V+D  TV+T G FD+
Sbjct  375   MPMKTKDGKGTTDAYCVAKYGQKWIRTRTIVDSLMPKWNEQYTWEVFDTCTVITFGAFDN  434

Query  2102  WEVIDPENSKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
                I   + KD+R+GKVRIR+STL + ++Y +++ L++  P+G+KK GEI+LAVRF    
Sbjct  435   GH-IPGGSGKDMRIGKVRIRLSTLESDRIYTHSYPLLVFHPSGIKKTGEIQLAVRFT-CL  492

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
               ++ LH+YSQP+LP MH+I PL  +Q +SLR  A+ +++  L+R+EPPLR+EVV YMLD
Sbjct  493   SVINMLHMYSQPLLPKMHYIHPLSVLQLDSLRHQAMNIVSARLNRAEPPLRKEVVEYMLD  552

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
              DSH +SMR+ +AN+FRI+NV++ ++ V KW D    WRNP  TIL+H L ++LV +P+L
Sbjct  553   VDSHMWSMRRSKANFFRIMNVLSGLVAVTKWFDQICHWRNPITTILIHVLFIILVLYPEL  612

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             I+PT   Y+F+IG WN+R+R R    H DT++S A+++  DELDEEFD  P +R  ++VR
Sbjct  613   ILPTVFLYLFLIGIWNFRWRPRHP-PHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVR  671

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RYD+LR +G RVQT++GDLATQGER  +L++WRDPRAT +F+  C + A +LY+ P ++
Sbjct  672   MRYDRLRSIGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFLFFCLIAAVVLYVTPFQV  731

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A+  G Y LRHP FR ++PS  LN FRRLP+ +D ++
Sbjct  732   VALLTGIYVLRHPRFRHKLPSVPLNLFRRLPARSDSLI  769



>ref|XP_008663748.1| PREDICTED: uncharacterized protein LOC103642209 [Zea mays]
Length=990

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/758 (49%), Positives = 530/758 (70%), Gaps = 35/758 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+  YLFV++VKAR LP         P V+V V     I++   K    EW+  
Sbjct  248   STYDLVERTQYLFVRVVKARDLPDMDVTGSLDPYVEVRVGNYRGITKHFEKQKNPEWNAV  307

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF RD    +S+LE+ V D           D+   +F+G + FD++++P+R PPDSPLA
Sbjct  308   FAFSRDRM-QASVLEVVVKD----------KDLIKDDFVGFVRFDLNDVPIRVPPDSPLA  356

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAG--NPTS----RSKVYQSP  1402
             P+WYRL G  G    G+LMLA WVGTQADE+FPDAW +D A   +P++    +SKVY +P
Sbjct  357   PEWYRLVGKSGDRSMGELMLAVWVGTQADEAFPDAWHSDAATLEDPSTVTHMKSKVYHAP  416

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             +LWYLR ++IEAQD+  L        F ++AQ+G Q+ +TKP  +   +P WNED++FVA
Sbjct  417   RLWYLRVNIIEAQDVAILDKTRCPDVF-VRAQVGHQLGRTKPVQARNFNPFWNEDIMFVA  475

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFE-----DQN  1747
             AEPF +H L+  L + + P +  +LG   IPL+ ++RR DDR V  +WF+ E     D +
Sbjct  476   AEPFEDH-LVLTLEDRVGPNKDEMLGRVIIPLAMVDRRADDRIVHGKWFSLEKPVLVDVD  534

Query  1748  EEKR-VYKGRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             + KR  +  R+H+RLC DGGYHV++E+ +  SD RPTA+QLWKP +G +ELG++G + ++
Sbjct  535   QLKRDKFSTRLHIRLCLDGGYHVLDESTNYSSDLRPTAKQLWKPSIGLLELGVLGAQGIV  594

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMKT  GKGS+D Y VAKYGSKWVRTRTI +N  PR+NEQYTW VYDP+TV+T+GVFD+ 
Sbjct  595   PMKTRDGKGSSDTYCVAKYGSKWVRTRTIMNNPHPRFNEQYTWEVYDPATVLTVGVFDNG  654

Query  2105  EVIDPENS-KDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIRST  2281
             ++ +  +S KD ++GKVRIR+STL +G+VY +++ L++L P+G+KKMGE+ LA+RF  ST
Sbjct  655   QLGEKTSSGKDGKIGKVRIRLSTLESGRVYTHSYPLLVLHPSGVKKMGELHLAIRF-SST  713

Query  2282  PTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYMLD  2461
               ++ L++YS+P+LP MH++RP+  +Q + LR  AV+++   LSR EPPLR+EVV YM D
Sbjct  714   SLVNMLYLYSRPLLPKMHYVRPIPVLQVDMLRHQAVQIVAARLSRMEPPLRKEVVEYMTD  773

Query  2462  ADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFPDL  2641
              DSH +SMRK +AN+FR++ V + +    +W     +W+NP  T+LVH L ++LV FP+L
Sbjct  774   FDSHLWSMRKSKANFFRLVTVFSGLFAASRWFIGICSWKNPITTVLVHILFIMLVCFPEL  833

Query  2642  IIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDMVR  2821
             I+PT   Y+F+IG WN+R+R R    H +TKIS AE++  DELDEEFD  P +R  ++VR
Sbjct  834   ILPTVFLYMFLIGIWNFRYRPRYP-PHMNTKISHAEAVHPDELDEEFDTFPTSRNPEIVR  892

Query  2822  ARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPSKM  3001
              RYD+LR +  R+Q ++GD+ATQGERVQAL++WRDPRAT +F+  C + A +LY+ P ++
Sbjct  893   VRYDRLRSVAGRIQIVVGDIATQGERVQALLSWRDPRATSVFVLFCLIAAIVLYVTPLQV  952

Query  3002  IAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +A   GFY +RHP FR R+PS  +NFFRRLP+  D ML
Sbjct  953   LAALGGFYVMRHPRFRHRLPSVPVNFFRRLPARTDSML  990


 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = +2

Query  194  KDGHGASSPYVVIDFYGQRKKTRTVLRDLNPQWNEMLEFNLSKHSDIFGDMLELDVYHDK  373
            K+G G++S  V + F GQR +T    +DLNP WNE   FN+S  S++    LE  VY   
Sbjct  3    KEGQGSASACVELTFDGQRFRTVVKEKDLNPVWNERFYFNISDPSNLRALALEAYVYSVN  62

Query  374  NVGPTTRNNFLGRVKLNATQFVKKGEEALIYYPLERKNLLSWIQGDIGLKIYFVD  538
                ++R +FLG+V++  T FV   +  +++YPLE++ + S ++G++G+K+Y  +
Sbjct  63   KTIESSR-SFLGKVRIAGTSFVPFPDAVVMHYPLEKRGMFSRVKGEMGMKVYITN  116



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/760 (50%), Positives = 525/760 (69%), Gaps = 37/760 (5%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPT-----AGRPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP+     +  P  +V +      +R   K    EW+Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPSKDVTGSCDPYAEVKLGNYKGTTRHFEKKTNPEWNQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V             DV   +F+G + FD++E+P R PPDSPLA
Sbjct  90    FAFSKDRL-QASVLEVTV----------KDKDVVKDDFIGRVWFDLNEVPKRVPPDSPLA  138

Query  1247  PQWYRLEG--GGAHKGDLMLATWVGTQADESFPDAWKTDTAGNPTS------RSKVYQSP  1402
             PQWYRLE   G   KG+LMLA W+GTQADE+FP+AW +D A    +      RSKVY SP
Sbjct  139   PQWYRLEDRKGDKVKGELMLAVWMGTQADEAFPEAWHSDAATVSGTDALANIRSKVYLSP  198

Query  1403  KLWYLRSSVIEAQDIFALTAPSKESSFQIKAQLGFQVQKTKPASSATGSPSWNEDLVFVA  1582
             KLWYLR +VIEAQD+   T   +     +KA LG Q  +T+ + S + +P WNEDL+FVA
Sbjct  199   KLWYLRVNVIEAQDL-QPTDKGRYPEVFVKAILGNQALRTRISQSRSINPLWNEDLMFVA  257

Query  1583  AEPFTEHYLLFFLIEHLPPKEQAVLGVASIPLSSIERRVDDRQVISRWFTFED----QNE  1750
             AEPF E  L+  + + + P ++ VLG  +IPL  ++RR+D + V +RWF  E     + E
Sbjct  258   AEPFEEP-LILSVEDRVAPNKEEVLGRCAIPLQFMDRRLDHKPVNTRWFNLEKHIIVEGE  316

Query  1751  EKRVYK--GRVHLRLCFDGGYHVIEEAAHLCSDYRPTARQLWKPPVGTVELGIIGCKNLL  1924
             +K+  K   R+H+R+C +GGYHV++E+ H  SD RPTA+QLWK  +G +E+GI+  + L+
Sbjct  317   KKKEIKFASRIHMRVCLEGGYHVLDESTHYSSDLRPTAKQLWKSGIGVLEVGILSAQGLM  376

Query  1925  PMKTMRGKGSTDAYAVAKYGSKWVRTRTISDNLCPRWNEQYTWRVYDPSTVVTIGVFDSW  2104
             PMK   G+G+TDAY VAKYG KW+RTRTI D+  PRWNEQYTW V+DP TV+TIGVFD+ 
Sbjct  377   PMKNKDGRGTTDAYCVAKYGQKWIRTRTIIDSFMPRWNEQYTWEVFDPCTVITIGVFDNC  436

Query  2105  EVIDPEN---SKDVRMGKVRIRISTLATGKVYRNTFSLILLSPAGLKKMGEIELAVRFIR  2275
              +  P+    +KD R+GKVRIR+STL T +VY +++ L++L P G+KKMGEI+LAVRF  
Sbjct  437   HLHGPDKAGGAKDSRIGKVRIRLSTLETDRVYTHSYPLLVLHPTGVKKMGEIQLAVRFTC  496

Query  2276  STPTLDFLHVYSQPMLPVMHHIRPLGAVQQESLRTAAVKLLTTHLSRSEPPLRREVVAYM  2455
             S+  L+ +H+YS P+LP MH+I PL   Q +SLR  A ++++  LSR+EPPLR+EVV YM
Sbjct  497   SS-LLNMMHMYSLPLLPKMHYIHPLTVSQLDSLRHQATQIVSMRLSRAEPPLRKEVVEYM  555

Query  2456  LDADSHSFSMRKVRANWFRiinviaavidvvKWADDTRAWRNPTATILVHALLVLLVWFP  2635
             LD  SH +SMR+ +AN+FRI+ V++ +I   KW D    W+NP  T+L+H L ++LV +P
Sbjct  556   LDVGSHMWSMRRSKANFFRIMGVLSGLIAAGKWFDQICNWKNPITTVLIHILFIILVMYP  615

Query  2636  DLIIPTFAFYVFMIGAWNYRFRSRDKLNHFDTKISLAESIDRDELDEEFDAVPCTRPNDM  2815
             +LI+PT   Y+F+IG W+YR+R R   N  DT++S A+S   DELDEEFD  P +RP+D+
Sbjct  616   ELILPTVFLYLFLIGIWHYRWRPRHPPN-MDTRLSHADSAHPDELDEEFDTFPTSRPSDI  674

Query  2816  VRARYDKLRMLGARVQTLLGDLATQGERVQALVTWRDPRATGIFIALCFVVAFILYLVPS  2995
             VR RYD+LR +  R+QT++GDLATQGER+Q+L++WRDPRAT +F+  C + A ILY+ P 
Sbjct  675   VRMRYDRLRSIAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLLAATILYVTPF  734

Query  2996  KMIAMAFGFYYLRHPLFRDRMPSPALNFFRRLPSLADRML  3115
             +++A+  G Y LRHP FR ++PS  LNFFRRLP+  D ML
Sbjct  735   QVVALLTGIYVLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/762 (49%), Positives = 517/762 (68%), Gaps = 42/762 (6%)
 Frame = +2

Query  902   SSFDLVEKMHYLFVQIVKARSLPTAG-----RPvvkvvvsgshvisRPARKTLLFEWDQT  1066
             S++DLVE+M YL+V++VKA+ LP         P V+V +      +R   K    EW Q 
Sbjct  30    STYDLVEQMQYLYVRVVKAKDLPAKDVTGSLDPYVEVKLGNYKGTTRHFEKKSNPEWSQV  89

Query  1067  FAFGRDAPDSSSILEISVWDPLSSKSLDPTSDVAGHNFLGGICFDVSEIPLRDPPDSPLA  1246
             FAF +D    +S+LE++V D           D    +F+G + FD+++IP R PPDSPLA
Sbjct  90    FAFSKDRI-QASVLEVTVKD----------KDFVKDDFVGRVLFDLNDIPKRVPPDSPLA  138

Query  1247  PQWYRLE--GGGAHKGDLMLATWVGTQADESFPDAWKTDTA------GNPTSRSKVYQSP  1402
             PQWYRLE   G   K